--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Tue Nov 22 06:25:57 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/3/Acp53C14b-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PA4b-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PA4b-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PA4b-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1052.11         -1060.32
2      -1051.90         -1060.90
--------------------------------------
TOTAL    -1052.00         -1060.65
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PA4b-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PA4b-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14b-PA4b-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.307659    0.001530    0.234631    0.384553    0.304199   1501.00   1501.00    1.000
r(A<->C){all}   0.100422    0.001154    0.035112    0.165206    0.096650    888.72    947.28    1.000
r(A<->G){all}   0.301574    0.002748    0.194541    0.399626    0.299679    729.86    775.48    1.000
r(A<->T){all}   0.160296    0.001526    0.087686    0.238749    0.157944    942.35   1045.29    1.000
r(C<->G){all}   0.172303    0.002032    0.088966    0.259862    0.169359    844.07    949.85    1.001
r(C<->T){all}   0.188875    0.002142    0.102943    0.282407    0.185379    719.26    785.09    1.000
r(G<->T){all}   0.076531    0.001061    0.015260    0.136736    0.073251    959.05    977.29    1.000
pi(A){all}      0.276458    0.000404    0.238774    0.316479    0.275637   1326.00   1413.05    1.000
pi(C){all}      0.226230    0.000390    0.189134    0.265232    0.225366   1317.41   1369.72    1.000
pi(G){all}      0.240794    0.000401    0.205392    0.282262    0.240413   1117.60   1235.49    1.000
pi(T){all}      0.256518    0.000413    0.216628    0.295464    0.256242   1052.33   1171.23    1.000
alpha{1,2}      0.887309    0.286952    0.174547    1.986910    0.756047   1390.56   1428.05    1.000
alpha{3}        1.025455    0.330627    0.187163    2.172389    0.894428   1415.10   1458.05    1.002
pinvar{all}     0.135472    0.010680    0.000028    0.331113    0.113391   1283.27   1298.22    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1025.055906
Model 2: PositiveSelection	-1025.055906
Model 0: one-ratio	-1025.224871
Model 3: discrete	-1024.22943
Model 7: beta	-1024.586583
Model 8: beta&w>1	-1024.586593


Model 0 vs 1	0.3379299999996874

Model 2 vs 1	0.0

Model 8 vs 7	1.9999999949504854E-5
>C1
MSVIKSIFLLSILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLA
DKIVPTVYELKQCSGYVTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKC
LHGLLNKLAATIKPFAEQISGLGCLDEEDYII
>C2
MSVIKSIFVLSILAVCLISRETEAQATIGESWGRLGKCTQVGIETLTSLA
NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKLVFDEPKC
LHSLLTKLGATIKPFAEQISGLGCSDEEDYII
>C3
MSVIKSIFVLSILAVCLIPRETEAQATIGESWGRLGKCTQVGIETLTSLA
NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKMVFDEPKC
LHSLLTKLGATIKPFAEQISGLGCLDEEDYII
>C4
MSGFKSIFLLSFLAVFLIPRDTEAQATLNESWGKLAKCTQVGIETLTTLA
DGVIPTVYELKQCSGYVSLEPPNGSHRKVTWYLKITYEFFKKLVFDEPRC
LHSLLNKLAVTIKPYAEQISALGCLDEEDYII
>C5
MSGMKSVFLLSFLAVLLIPRETVAQATISETWSKLGKCTHVGIQTLTTLA
NKIVPTVYELSQCSGFVFLEPPNGKQRRVTWYLKISYEFFKKLVFDEPRC
LHSLLNKLAFTIKPFAEQISVLGCLDEEDYII
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=132 

C1              MSVIKSIFLLSILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLA
C2              MSVIKSIFVLSILAVCLISRETEAQATIGESWGRLGKCTQVGIETLTSLA
C3              MSVIKSIFVLSILAVCLIPRETEAQATIGESWGRLGKCTQVGIETLTSLA
C4              MSGFKSIFLLSFLAVFLIPRDTEAQATLNESWGKLAKCTQVGIETLTTLA
C5              MSGMKSVFLLSFLAVLLIPRETVAQATISETWSKLGKCTHVGIQTLTTLA
                ** :**:*:**:*** **.*:* ****:.*:*.:*.***:*.*:***:**

C1              DKIVPTVYELKQCSGYVTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKC
C2              NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKLVFDEPKC
C3              NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKMVFDEPKC
C4              DGVIPTVYELKQCSGYVSLEPPNGSHRKVTWYLKITYEFFKKLVFDEPRC
C5              NKIVPTVYELSQCSGFVFLEPPNGKQRRVTWYLKISYEFFKKLVFDEPRC
                : ::******.****:* ***.**..*::*****::******:*****:*

C1              LHGLLNKLAATIKPFAEQISGLGCLDEEDYII
C2              LHSLLTKLGATIKPFAEQISGLGCSDEEDYII
C3              LHSLLTKLGATIKPFAEQISGLGCLDEEDYII
C4              LHSLLNKLAVTIKPYAEQISALGCLDEEDYII
C5              LHSLLNKLAFTIKPFAEQISVLGCLDEEDYII
                **.**.**. ****:***** *** *******




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  132 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  132 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2640]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [2640]--->[2640]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.256 Mb, Max= 30.451 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSVIKSIFLLSILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLA
DKIVPTVYELKQCSGYVTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKC
LHGLLNKLAATIKPFAEQISGLGCLDEEDYII
>C2
MSVIKSIFVLSILAVCLISRETEAQATIGESWGRLGKCTQVGIETLTSLA
NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKLVFDEPKC
LHSLLTKLGATIKPFAEQISGLGCSDEEDYII
>C3
MSVIKSIFVLSILAVCLIPRETEAQATIGESWGRLGKCTQVGIETLTSLA
NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKMVFDEPKC
LHSLLTKLGATIKPFAEQISGLGCLDEEDYII
>C4
MSGFKSIFLLSFLAVFLIPRDTEAQATLNESWGKLAKCTQVGIETLTTLA
DGVIPTVYELKQCSGYVSLEPPNGSHRKVTWYLKITYEFFKKLVFDEPRC
LHSLLNKLAVTIKPYAEQISALGCLDEEDYII
>C5
MSGMKSVFLLSFLAVLLIPRETVAQATISETWSKLGKCTHVGIQTLTTLA
NKIVPTVYELSQCSGFVFLEPPNGKQRRVTWYLKISYEFFKKLVFDEPRC
LHSLLNKLAFTIKPFAEQISVLGCLDEEDYII

FORMAT of file /tmp/tmp5269078508952440427aln Not Supported[FATAL:T-COFFEE]
>C1
MSVIKSIFLLSILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLA
DKIVPTVYELKQCSGYVTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKC
LHGLLNKLAATIKPFAEQISGLGCLDEEDYII
>C2
MSVIKSIFVLSILAVCLISRETEAQATIGESWGRLGKCTQVGIETLTSLA
NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKLVFDEPKC
LHSLLTKLGATIKPFAEQISGLGCSDEEDYII
>C3
MSVIKSIFVLSILAVCLIPRETEAQATIGESWGRLGKCTQVGIETLTSLA
NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKMVFDEPKC
LHSLLTKLGATIKPFAEQISGLGCLDEEDYII
>C4
MSGFKSIFLLSFLAVFLIPRDTEAQATLNESWGKLAKCTQVGIETLTTLA
DGVIPTVYELKQCSGYVSLEPPNGSHRKVTWYLKITYEFFKKLVFDEPRC
LHSLLNKLAVTIKPYAEQISALGCLDEEDYII
>C5
MSGMKSVFLLSFLAVLLIPRETVAQATISETWSKLGKCTHVGIQTLTTLA
NKIVPTVYELSQCSGFVFLEPPNGKQRRVTWYLKISYEFFKKLVFDEPRC
LHSLLNKLAFTIKPFAEQISVLGCLDEEDYII
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:132 S:100 BS:132
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 91.67 C1	 C2	 91.67
TOP	    1    0	 91.67 C2	 C1	 91.67
BOT	    0    2	 92.42 C1	 C3	 92.42
TOP	    2    0	 92.42 C3	 C1	 92.42
BOT	    0    3	 80.30 C1	 C4	 80.30
TOP	    3    0	 80.30 C4	 C1	 80.30
BOT	    0    4	 80.30 C1	 C5	 80.30
TOP	    4    0	 80.30 C5	 C1	 80.30
BOT	    1    2	 97.73 C2	 C3	 97.73
TOP	    2    1	 97.73 C3	 C2	 97.73
BOT	    1    3	 78.79 C2	 C4	 78.79
TOP	    3    1	 78.79 C4	 C2	 78.79
BOT	    1    4	 78.79 C2	 C5	 78.79
TOP	    4    1	 78.79 C5	 C2	 78.79
BOT	    2    3	 79.55 C3	 C4	 79.55
TOP	    3    2	 79.55 C4	 C3	 79.55
BOT	    2    4	 79.55 C3	 C5	 79.55
TOP	    4    2	 79.55 C5	 C3	 79.55
BOT	    3    4	 80.30 C4	 C5	 80.30
TOP	    4    3	 80.30 C5	 C4	 80.30
AVG	 0	 C1	  *	 86.17
AVG	 1	 C2	  *	 86.74
AVG	 2	 C3	  *	 87.31
AVG	 3	 C4	  *	 79.73
AVG	 4	 C5	  *	 79.73
TOT	 TOT	  *	 83.94
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAGCGTGATCAAGTCCATATTTCTGCTCAGTATTTTGGCTGTCTGCCT
C2              ATGAGCGTGATCAAGTCCATATTTGTGCTCAGTATTTTGGCTGTTTGCCT
C3              ATGAGCGTGATCAAGTCCATATTTGTGCTCAGTATTTTGGCTGTCTGCCT
C4              ATGAGCGGGTTCAAGTCCATATTTCTGCTCAGTTTTTTGGCTGTATTCCT
C5              ATGAGCGGGATGAAGTCCGTATTTTTGCTCAGTTTTTTGGCTGTCTTGCT
                ******* *:* ******.***** ********:********** *  **

C1              CATTCCCCGGGAGACGGAGGCCCAGGCCACTATAAGTGAAAGCTGGGGAA
C2              TATATCACGGGAGACGGAGGCCCAGGCCACTATTGGTGAAAGCTGGGGAA
C3              TATTCCCCGGGAGACGGAGGCCCAGGCCACTATTGGTGAAAGCTGGGGAA
C4              TATCCCACGGGACACTGAGGCACAGGCCACTTTAAATGAAAGCTGGGGAA
C5              TATCCCCCGAGAAACTGTGGCGCAGGCCACTATAAGTGAAACCTGGAGTA
                 **  *.**.** ** *:*** *********:*:..***** ****.*:*

C1              GGCTGGGCAAGTGTACTCAGGTGGCCATCGAAACACTGACCAGCCTGGCC
C2              GGCTGGGCAAGTGTACTCAGGTGGGCATCGAAACTCTGACCAGCCTGGCC
C3              GGCTGGGCAAGTGTACTCAGGTGGGCATCGAAACACTGACCAGCCTGGCC
C4              AGCTGGCCAAATGTACTCAGGTGGGCATCGAAACACTGACCACCCTGGCC
C5              AGCTGGGAAAATGTACTCATGTGGGCATCCAAACACTGACCACCCTGGCC
                .***** .**.******** **** **** ****:******* *******

C1              GATAAAATCGTCCCGACCGTATATGAGTTGAAACAATGCTCCGGATACGT
C2              AACAAAATCGTCCCGACCGTTTATGAGTTGAAACAATGCTCCGGATACGT
C3              AACAAAATCGTCCCGACCGTTTATGAGTTGAAACAATGCTCCGGATACGT
C4              GACGGAGTTATCCCGACCGTATATGAGTTGAAACAGTGCTCCGGATACGT
C5              AACAAAATTGTCCCGACCGTATATGAGTTGTCACAATGCTCCGGATTCGT
                .* ..*.* .**********:*********:.***.**********:***

C1              AACTTTGGAACCGGCAAACGGCAAAGACAGAAAGATTACCTGGTACCTAA
C2              ATCTTTGGAACCGCCAAACGGCAAAGACAGGAAGATTACCTGGTACCTAA
C3              ATCTTTGGAACCGCCAAACGGCAAAGACAGGAAGATTACCTGGTACCTCA
C4              GTCTTTGGAACCGCCAAACGGCTCACATAGAAAGGTCACCTGGTACCTGA
C5              TTTTTTGGAGCCGCCGAACGGCAAACAGAGAAGGGTTACCTGGTACCTAA
                 : ******.*** *.******:.* * **.*.*.* *********** *

C1              AGGTATCCTATGAATTCTTCAAGAAACTTGTCTTTGACGAACCCAAATGT
C2              AGGTATCCTATGAATTCTTCAAGAAACTGGTCTTTGATGAGCCCAAATGT
C3              AGGTATCCTATGAATTCTTCAAGAAAATGGTCTTTGACGAGCCCAAATGT
C4              AGATAACCTATGAATTCTTCAAGAAACTGGTCTTTGACGAACCCAGATGT
C5              AGATATCCTATGAATTCTTCAAGAAACTGGTCTTTGACGAACCCAGATGT
                **.**:********************.* ******** **.****.****

C1              CTGCACGGTCTACTGAACAAGTTGGCTGCCACAATCAAACCATTTGCCGA
C2              CTGCACAGTCTACTGACCAAGTTAGGTGCCACAATCAAACCATTTGCCGA
C3              CTGCACAGTCTACTGACCAAGTTAGGTGCCACAATCAAACCATTTGCCGA
C4              CTGCACAGTCTTCTCAACAAGTTGGCTGTTACCATTAAACCATATGCCGA
C5              CTGCACAGTCTTCTGAACAAGTTAGCTTTTACAATCAAACCTTTTGCCGA
                ******.****:** *.******.* *   **.** *****:*:******

C1              GCAGATATCGGGATTAGGTTGCTTGGACGAAGAAGATTATATCATT
C2              GCAGATATCGGGACTAGGTTGCTCGGACGAGGAAGATTATATCATT
C3              GCAGATATCGGGACTGGGTTGCTTGGACGAAGAAGATTATATCATT
C4              GCAGATATCGGCACTAGGTTGCTTGGACGAAGAAGATTATATCATT
C5              ACAGATATCGGTACTAGGTTGCTTGGACGAAGAAGATTATATCATT
                .********** * *.******* ******.***************



>C1
ATGAGCGTGATCAAGTCCATATTTCTGCTCAGTATTTTGGCTGTCTGCCT
CATTCCCCGGGAGACGGAGGCCCAGGCCACTATAAGTGAAAGCTGGGGAA
GGCTGGGCAAGTGTACTCAGGTGGCCATCGAAACACTGACCAGCCTGGCC
GATAAAATCGTCCCGACCGTATATGAGTTGAAACAATGCTCCGGATACGT
AACTTTGGAACCGGCAAACGGCAAAGACAGAAAGATTACCTGGTACCTAA
AGGTATCCTATGAATTCTTCAAGAAACTTGTCTTTGACGAACCCAAATGT
CTGCACGGTCTACTGAACAAGTTGGCTGCCACAATCAAACCATTTGCCGA
GCAGATATCGGGATTAGGTTGCTTGGACGAAGAAGATTATATCATT
>C2
ATGAGCGTGATCAAGTCCATATTTGTGCTCAGTATTTTGGCTGTTTGCCT
TATATCACGGGAGACGGAGGCCCAGGCCACTATTGGTGAAAGCTGGGGAA
GGCTGGGCAAGTGTACTCAGGTGGGCATCGAAACTCTGACCAGCCTGGCC
AACAAAATCGTCCCGACCGTTTATGAGTTGAAACAATGCTCCGGATACGT
ATCTTTGGAACCGCCAAACGGCAAAGACAGGAAGATTACCTGGTACCTAA
AGGTATCCTATGAATTCTTCAAGAAACTGGTCTTTGATGAGCCCAAATGT
CTGCACAGTCTACTGACCAAGTTAGGTGCCACAATCAAACCATTTGCCGA
GCAGATATCGGGACTAGGTTGCTCGGACGAGGAAGATTATATCATT
>C3
ATGAGCGTGATCAAGTCCATATTTGTGCTCAGTATTTTGGCTGTCTGCCT
TATTCCCCGGGAGACGGAGGCCCAGGCCACTATTGGTGAAAGCTGGGGAA
GGCTGGGCAAGTGTACTCAGGTGGGCATCGAAACACTGACCAGCCTGGCC
AACAAAATCGTCCCGACCGTTTATGAGTTGAAACAATGCTCCGGATACGT
ATCTTTGGAACCGCCAAACGGCAAAGACAGGAAGATTACCTGGTACCTCA
AGGTATCCTATGAATTCTTCAAGAAAATGGTCTTTGACGAGCCCAAATGT
CTGCACAGTCTACTGACCAAGTTAGGTGCCACAATCAAACCATTTGCCGA
GCAGATATCGGGACTGGGTTGCTTGGACGAAGAAGATTATATCATT
>C4
ATGAGCGGGTTCAAGTCCATATTTCTGCTCAGTTTTTTGGCTGTATTCCT
TATCCCACGGGACACTGAGGCACAGGCCACTTTAAATGAAAGCTGGGGAA
AGCTGGCCAAATGTACTCAGGTGGGCATCGAAACACTGACCACCCTGGCC
GACGGAGTTATCCCGACCGTATATGAGTTGAAACAGTGCTCCGGATACGT
GTCTTTGGAACCGCCAAACGGCTCACATAGAAAGGTCACCTGGTACCTGA
AGATAACCTATGAATTCTTCAAGAAACTGGTCTTTGACGAACCCAGATGT
CTGCACAGTCTTCTCAACAAGTTGGCTGTTACCATTAAACCATATGCCGA
GCAGATATCGGCACTAGGTTGCTTGGACGAAGAAGATTATATCATT
>C5
ATGAGCGGGATGAAGTCCGTATTTTTGCTCAGTTTTTTGGCTGTCTTGCT
TATCCCCCGAGAAACTGTGGCGCAGGCCACTATAAGTGAAACCTGGAGTA
AGCTGGGAAAATGTACTCATGTGGGCATCCAAACACTGACCACCCTGGCC
AACAAAATTGTCCCGACCGTATATGAGTTGTCACAATGCTCCGGATTCGT
TTTTTTGGAGCCGCCGAACGGCAAACAGAGAAGGGTTACCTGGTACCTAA
AGATATCCTATGAATTCTTCAAGAAACTGGTCTTTGACGAACCCAGATGT
CTGCACAGTCTTCTGAACAAGTTAGCTTTTACAATCAAACCTTTTGCCGA
ACAGATATCGGTACTAGGTTGCTTGGACGAAGAAGATTATATCATT
>C1
MSVIKSIFLLSILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLA
DKIVPTVYELKQCSGYVTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKC
LHGLLNKLAATIKPFAEQISGLGCLDEEDYII
>C2
MSVIKSIFVLSILAVCLISRETEAQATIGESWGRLGKCTQVGIETLTSLA
NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKLVFDEPKC
LHSLLTKLGATIKPFAEQISGLGCSDEEDYII
>C3
MSVIKSIFVLSILAVCLIPRETEAQATIGESWGRLGKCTQVGIETLTSLA
NKIVPTVYELKQCSGYVSLEPPNGKDRKITWYLKVSYEFFKKMVFDEPKC
LHSLLTKLGATIKPFAEQISGLGCLDEEDYII
>C4
MSGFKSIFLLSFLAVFLIPRDTEAQATLNESWGKLAKCTQVGIETLTTLA
DGVIPTVYELKQCSGYVSLEPPNGSHRKVTWYLKITYEFFKKLVFDEPRC
LHSLLNKLAVTIKPYAEQISALGCLDEEDYII
>C5
MSGMKSVFLLSFLAVLLIPRETVAQATISETWSKLGKCTHVGIQTLTTLA
NKIVPTVYELSQCSGFVFLEPPNGKQRRVTWYLKISYEFFKKLVFDEPRC
LHSLLNKLAFTIKPFAEQISVLGCLDEEDYII


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 396 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1479795754
      Setting output file names to "/opt/ADOPS/3/Acp53C14b-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 2126766150
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 4347723507
      Seed = 1541593719
      Swapseed = 1479795754
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 26 unique site patterns
      Division 2 has 25 unique site patterns
      Division 3 has 37 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1209.408803 -- -25.624409
         Chain 2 -- -1139.661198 -- -25.624409
         Chain 3 -- -1220.215584 -- -25.624409
         Chain 4 -- -1209.408803 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1210.332956 -- -25.624409
         Chain 2 -- -1213.642290 -- -25.624409
         Chain 3 -- -1139.661198 -- -25.624409
         Chain 4 -- -1216.825982 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1209.409] (-1139.661) (-1220.216) (-1209.409) * [-1210.333] (-1213.642) (-1139.661) (-1216.826) 
        500 -- [-1052.213] (-1060.534) (-1060.235) (-1060.856) * (-1060.542) (-1054.750) (-1057.327) [-1059.040] -- 0:00:00
       1000 -- [-1051.703] (-1053.904) (-1052.014) (-1061.410) * (-1060.408) (-1056.532) (-1054.626) [-1061.783] -- 0:00:00
       1500 -- [-1052.327] (-1053.342) (-1054.505) (-1055.666) * (-1059.149) [-1053.945] (-1060.215) (-1062.400) -- 0:00:00
       2000 -- (-1055.878) [-1058.340] (-1056.455) (-1057.411) * (-1062.103) [-1058.279] (-1055.943) (-1063.457) -- 0:00:00
       2500 -- (-1059.541) [-1056.663] (-1052.489) (-1054.214) * (-1060.795) (-1054.467) [-1054.026] (-1061.679) -- 0:06:39
       3000 -- [-1056.200] (-1053.982) (-1063.884) (-1052.679) * (-1059.489) (-1059.278) (-1051.723) [-1050.548] -- 0:05:32
       3500 -- [-1053.080] (-1058.812) (-1053.561) (-1053.281) * [-1053.224] (-1055.420) (-1056.849) (-1055.863) -- 0:04:44
       4000 -- (-1055.652) [-1054.563] (-1054.245) (-1057.872) * [-1053.359] (-1068.588) (-1051.597) (-1053.935) -- 0:04:09
       4500 -- [-1054.559] (-1052.650) (-1055.807) (-1052.565) * (-1057.637) (-1066.701) [-1056.193] (-1055.048) -- 0:03:41
       5000 -- (-1057.517) (-1061.391) (-1057.905) [-1050.795] * (-1050.539) (-1060.370) (-1061.540) [-1059.492] -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

       5500 -- (-1048.555) (-1048.935) [-1054.570] (-1052.696) * [-1052.669] (-1064.170) (-1054.455) (-1058.004) -- 0:03:00
       6000 -- [-1052.796] (-1052.379) (-1055.191) (-1052.192) * (-1055.025) (-1055.605) [-1055.768] (-1061.001) -- 0:02:45
       6500 -- [-1055.300] (-1052.150) (-1053.471) (-1052.629) * (-1051.527) (-1055.898) [-1057.119] (-1063.693) -- 0:02:32
       7000 -- (-1054.946) (-1055.806) (-1055.621) [-1052.711] * (-1058.819) [-1057.600] (-1058.410) (-1067.359) -- 0:02:21
       7500 -- (-1055.726) (-1051.033) (-1055.298) [-1049.907] * (-1053.315) [-1054.250] (-1064.121) (-1057.692) -- 0:02:12
       8000 -- (-1058.255) [-1053.168] (-1054.458) (-1057.349) * (-1055.488) (-1052.457) (-1058.452) [-1058.798] -- 0:04:08
       8500 -- (-1053.171) [-1055.326] (-1052.157) (-1056.459) * [-1052.957] (-1054.924) (-1061.571) (-1061.405) -- 0:03:53
       9000 -- [-1055.999] (-1056.132) (-1052.247) (-1052.182) * [-1053.365] (-1053.798) (-1051.537) (-1067.360) -- 0:03:40
       9500 -- (-1058.260) (-1052.937) [-1058.663] (-1050.768) * (-1052.011) (-1061.548) [-1053.669] (-1068.461) -- 0:03:28
      10000 -- [-1052.219] (-1051.665) (-1060.847) (-1050.234) * [-1049.286] (-1058.667) (-1058.651) (-1060.997) -- 0:03:18

      Average standard deviation of split frequencies: 0.000000

      10500 -- (-1062.065) (-1053.458) (-1056.392) [-1054.162] * [-1052.724] (-1064.516) (-1055.191) (-1059.556) -- 0:03:08
      11000 -- (-1061.212) (-1062.344) [-1053.555] (-1056.700) * (-1054.658) [-1061.185] (-1053.801) (-1057.393) -- 0:02:59
      11500 -- (-1056.538) (-1057.665) (-1054.183) [-1054.962] * [-1057.394] (-1061.092) (-1056.525) (-1060.019) -- 0:02:51
      12000 -- [-1056.852] (-1054.725) (-1049.519) (-1052.153) * (-1058.986) (-1057.663) (-1058.187) [-1050.516] -- 0:02:44
      12500 -- (-1060.407) (-1057.465) (-1050.508) [-1056.924] * (-1057.133) (-1055.117) (-1059.557) [-1056.850] -- 0:02:38
      13000 -- (-1060.413) (-1051.275) (-1050.195) [-1055.115] * (-1055.716) (-1051.749) [-1057.857] (-1057.717) -- 0:02:31
      13500 -- (-1055.860) (-1056.954) [-1059.117] (-1058.030) * (-1061.692) (-1053.415) (-1056.103) [-1056.009] -- 0:03:39
      14000 -- (-1058.939) (-1054.978) (-1053.447) [-1052.432] * (-1061.847) (-1054.105) (-1058.707) [-1058.619] -- 0:03:31
      14500 -- (-1054.988) (-1055.172) (-1056.498) [-1054.504] * [-1058.839] (-1056.619) (-1056.716) (-1061.552) -- 0:03:23
      15000 -- (-1052.042) [-1053.059] (-1054.176) (-1064.592) * (-1059.001) (-1057.267) [-1052.025] (-1053.500) -- 0:03:17

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-1048.804) (-1057.609) [-1054.981] (-1057.384) * [-1055.974] (-1062.694) (-1053.834) (-1053.010) -- 0:03:10
      16000 -- (-1058.926) (-1055.146) [-1051.858] (-1059.948) * [-1055.187] (-1058.118) (-1054.279) (-1052.210) -- 0:03:04
      16500 -- [-1054.357] (-1052.461) (-1056.264) (-1054.915) * [-1056.911] (-1063.403) (-1064.063) (-1054.733) -- 0:02:58
      17000 -- [-1055.461] (-1055.889) (-1057.732) (-1053.343) * [-1054.222] (-1057.043) (-1055.081) (-1051.713) -- 0:02:53
      17500 -- [-1056.088] (-1056.610) (-1056.741) (-1053.447) * (-1053.131) (-1055.819) (-1055.924) [-1052.231] -- 0:02:48
      18000 -- (-1059.414) (-1062.580) (-1052.994) [-1052.094] * [-1054.187] (-1055.372) (-1060.851) (-1052.269) -- 0:02:43
      18500 -- [-1056.218] (-1059.319) (-1053.703) (-1053.248) * [-1052.268] (-1054.571) (-1058.648) (-1054.905) -- 0:02:39
      19000 -- (-1057.238) (-1055.408) (-1058.932) [-1052.183] * [-1056.037] (-1056.036) (-1052.377) (-1052.711) -- 0:03:26
      19500 -- (-1061.686) [-1055.033] (-1057.625) (-1052.176) * (-1063.399) [-1055.319] (-1049.740) (-1057.711) -- 0:03:21
      20000 -- [-1060.200] (-1055.177) (-1058.829) (-1059.443) * (-1061.556) (-1058.420) [-1051.738] (-1056.657) -- 0:03:16

      Average standard deviation of split frequencies: 0.000000

      20500 -- (-1056.228) (-1052.270) (-1053.369) [-1053.013] * (-1054.041) (-1056.921) (-1052.899) [-1052.959] -- 0:03:11
      21000 -- (-1052.196) [-1053.488] (-1056.506) (-1052.181) * (-1055.697) (-1052.637) (-1057.137) [-1052.774] -- 0:03:06
      21500 -- (-1055.503) (-1053.081) [-1054.548] (-1055.320) * (-1049.666) [-1053.710] (-1053.990) (-1053.322) -- 0:03:02
      22000 -- (-1062.522) [-1053.879] (-1059.225) (-1058.793) * (-1050.873) [-1055.413] (-1055.188) (-1053.067) -- 0:02:57
      22500 -- (-1058.046) [-1054.604] (-1050.937) (-1054.565) * [-1049.551] (-1055.539) (-1051.866) (-1056.198) -- 0:02:53
      23000 -- (-1060.647) [-1057.830] (-1054.564) (-1057.551) * (-1055.687) (-1054.238) [-1053.036] (-1053.605) -- 0:02:49
      23500 -- (-1056.502) (-1056.628) [-1055.603] (-1056.910) * (-1054.223) (-1052.189) [-1056.722] (-1057.244) -- 0:02:46
      24000 -- (-1056.260) (-1060.289) (-1060.226) [-1056.720] * (-1049.232) [-1054.598] (-1053.653) (-1068.558) -- 0:02:42
      24500 -- (-1054.551) (-1053.231) (-1055.634) [-1059.829] * (-1055.482) (-1062.498) [-1048.613] (-1064.584) -- 0:02:39
      25000 -- (-1050.948) (-1061.960) [-1059.014] (-1055.745) * [-1054.752] (-1053.638) (-1057.156) (-1054.315) -- 0:02:36

      Average standard deviation of split frequencies: 0.000000

      25500 -- (-1052.906) (-1062.377) [-1056.012] (-1061.259) * (-1054.855) (-1056.596) (-1064.788) [-1054.108] -- 0:03:11
      26000 -- [-1053.251] (-1055.712) (-1062.480) (-1058.517) * (-1051.879) [-1056.866] (-1053.964) (-1052.140) -- 0:03:07
      26500 -- (-1057.136) (-1053.827) [-1063.851] (-1057.221) * (-1053.560) [-1054.686] (-1057.354) (-1051.278) -- 0:03:03
      27000 -- (-1056.243) (-1049.619) [-1065.844] (-1063.034) * (-1056.530) (-1059.072) (-1054.623) [-1054.456] -- 0:03:00
      27500 -- (-1057.730) (-1052.420) (-1063.979) [-1056.297] * (-1054.973) (-1056.137) (-1059.094) [-1053.693] -- 0:02:56
      28000 -- (-1052.704) [-1053.086] (-1055.252) (-1053.953) * (-1057.906) [-1056.047] (-1055.380) (-1056.542) -- 0:02:53
      28500 -- (-1051.548) (-1051.854) (-1060.999) [-1051.712] * (-1054.634) (-1054.725) [-1059.547] (-1060.992) -- 0:02:50
      29000 -- [-1056.895] (-1052.443) (-1055.932) (-1049.615) * [-1059.244] (-1058.965) (-1060.190) (-1054.536) -- 0:02:47
      29500 -- (-1056.834) [-1053.892] (-1057.075) (-1060.484) * (-1053.037) (-1052.400) (-1063.240) [-1055.689] -- 0:02:44
      30000 -- (-1054.933) (-1055.436) (-1057.098) [-1054.139] * [-1056.265] (-1052.019) (-1062.787) (-1053.667) -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      30500 -- [-1055.397] (-1058.323) (-1057.242) (-1055.076) * (-1058.122) (-1055.510) (-1065.636) [-1054.378] -- 0:02:38
      31000 -- (-1052.337) (-1058.105) [-1059.820] (-1055.486) * (-1056.154) [-1049.796] (-1058.061) (-1057.173) -- 0:03:07
      31500 -- (-1051.745) [-1053.783] (-1053.476) (-1060.025) * (-1057.965) (-1052.966) (-1057.373) [-1052.106] -- 0:03:04
      32000 -- (-1054.025) [-1052.897] (-1053.012) (-1054.575) * (-1058.331) (-1054.293) (-1066.479) [-1053.070] -- 0:03:01
      32500 -- (-1056.856) (-1061.154) [-1053.191] (-1050.384) * [-1054.866] (-1053.594) (-1054.146) (-1055.190) -- 0:02:58
      33000 -- (-1055.665) [-1054.623] (-1057.142) (-1054.566) * [-1051.620] (-1057.477) (-1051.116) (-1053.744) -- 0:02:55
      33500 -- [-1051.681] (-1051.113) (-1054.151) (-1052.661) * (-1057.859) (-1061.434) (-1056.474) [-1051.792] -- 0:02:53
      34000 -- [-1056.613] (-1052.670) (-1056.376) (-1052.529) * [-1056.172] (-1059.799) (-1053.283) (-1058.334) -- 0:02:50
      34500 -- (-1054.539) [-1055.836] (-1052.966) (-1052.904) * (-1058.685) (-1066.974) (-1060.294) [-1054.829] -- 0:02:47
      35000 -- (-1051.504) (-1055.209) [-1058.181] (-1054.908) * (-1057.435) [-1054.452] (-1053.925) (-1056.194) -- 0:02:45

      Average standard deviation of split frequencies: 0.000000

      35500 -- [-1051.829] (-1055.650) (-1060.138) (-1061.456) * (-1058.022) (-1063.947) [-1053.275] (-1051.071) -- 0:02:43
      36000 -- (-1053.891) (-1060.600) [-1053.626] (-1052.402) * [-1057.441] (-1064.638) (-1052.131) (-1060.691) -- 0:02:40
      36500 -- (-1056.205) (-1059.947) [-1053.832] (-1052.797) * (-1053.412) [-1059.310] (-1052.697) (-1054.627) -- 0:03:04
      37000 -- (-1054.963) (-1064.302) [-1058.550] (-1052.906) * (-1054.019) [-1059.595] (-1056.030) (-1057.448) -- 0:03:02
      37500 -- (-1051.443) (-1057.058) (-1062.434) [-1053.476] * (-1053.319) (-1056.932) (-1055.479) [-1051.380] -- 0:02:59
      38000 -- (-1053.484) (-1055.953) (-1058.897) [-1053.035] * [-1052.096] (-1052.140) (-1056.127) (-1055.090) -- 0:02:57
      38500 -- (-1054.668) (-1063.793) (-1059.827) [-1052.253] * (-1053.687) (-1050.737) (-1059.418) [-1052.033] -- 0:02:54
      39000 -- (-1058.119) (-1055.290) [-1060.378] (-1054.807) * (-1050.999) (-1054.363) [-1052.392] (-1052.998) -- 0:02:52
      39500 -- (-1054.864) (-1061.680) [-1062.389] (-1058.818) * (-1050.993) (-1060.226) [-1053.324] (-1055.631) -- 0:02:50
      40000 -- [-1053.183] (-1064.010) (-1060.543) (-1059.416) * (-1057.602) (-1055.384) [-1051.098] (-1064.566) -- 0:02:48

      Average standard deviation of split frequencies: 0.000000

      40500 -- (-1057.896) (-1058.298) [-1053.556] (-1053.598) * [-1059.223] (-1054.339) (-1058.256) (-1054.224) -- 0:02:45
      41000 -- (-1056.073) (-1052.726) [-1061.451] (-1057.938) * [-1054.995] (-1055.883) (-1057.235) (-1054.460) -- 0:02:43
      41500 -- (-1054.610) (-1051.136) (-1055.980) [-1050.777] * [-1055.158] (-1058.500) (-1052.938) (-1053.259) -- 0:02:41
      42000 -- (-1051.923) [-1054.822] (-1060.765) (-1052.854) * (-1059.128) (-1058.272) [-1054.687] (-1052.483) -- 0:03:02
      42500 -- [-1055.526] (-1054.182) (-1058.010) (-1054.439) * [-1054.563] (-1057.468) (-1051.145) (-1061.996) -- 0:03:00
      43000 -- (-1057.592) (-1056.590) (-1060.491) [-1052.909] * (-1055.388) (-1056.819) (-1051.399) [-1061.877] -- 0:02:58
      43500 -- (-1056.999) [-1054.583] (-1050.982) (-1061.618) * [-1056.090] (-1057.314) (-1054.705) (-1055.707) -- 0:02:55
      44000 -- (-1058.543) (-1061.735) [-1057.996] (-1052.609) * (-1056.191) [-1052.610] (-1052.205) (-1056.039) -- 0:02:53
      44500 -- (-1057.506) (-1055.251) [-1054.858] (-1060.512) * (-1050.320) [-1053.505] (-1053.545) (-1063.887) -- 0:02:51
      45000 -- (-1056.628) (-1053.103) [-1054.570] (-1054.324) * [-1049.090] (-1054.887) (-1062.835) (-1054.709) -- 0:02:49

      Average standard deviation of split frequencies: 0.000000

      45500 -- (-1052.922) (-1055.138) (-1055.685) [-1050.063] * (-1059.348) (-1053.935) (-1054.877) [-1051.294] -- 0:02:47
      46000 -- (-1055.082) (-1056.344) (-1061.647) [-1053.857] * [-1052.896] (-1054.838) (-1056.477) (-1057.214) -- 0:02:45
      46500 -- (-1061.475) [-1051.740] (-1055.020) (-1052.609) * [-1052.787] (-1054.137) (-1054.828) (-1054.387) -- 0:02:44
      47000 -- (-1053.624) (-1056.471) [-1053.369] (-1055.777) * (-1057.451) (-1056.518) [-1057.765] (-1053.518) -- 0:02:42
      47500 -- (-1052.221) (-1055.524) [-1052.491] (-1063.308) * (-1058.482) (-1060.111) [-1056.263] (-1052.497) -- 0:02:40
      48000 -- [-1054.860] (-1052.255) (-1052.263) (-1056.350) * [-1054.383] (-1063.667) (-1052.658) (-1053.758) -- 0:02:58
      48500 -- (-1054.877) (-1053.275) (-1056.602) [-1054.152] * (-1055.077) (-1052.461) [-1051.379] (-1057.501) -- 0:02:56
      49000 -- (-1055.188) [-1051.187] (-1053.717) (-1050.686) * (-1055.135) (-1058.829) [-1055.301] (-1058.737) -- 0:02:54
      49500 -- (-1064.013) [-1051.225] (-1059.189) (-1057.300) * (-1055.060) [-1053.146] (-1056.178) (-1056.786) -- 0:02:52
      50000 -- (-1062.190) [-1049.696] (-1058.473) (-1051.229) * [-1050.570] (-1052.753) (-1062.229) (-1059.014) -- 0:02:51

      Average standard deviation of split frequencies: 0.000000

      50500 -- [-1056.020] (-1057.373) (-1059.653) (-1053.535) * (-1059.455) [-1055.110] (-1056.666) (-1059.760) -- 0:02:49
      51000 -- [-1055.159] (-1050.262) (-1060.655) (-1054.451) * (-1054.832) (-1056.022) [-1058.482] (-1056.373) -- 0:02:47
      51500 -- (-1052.957) [-1057.728] (-1053.514) (-1053.929) * (-1054.836) (-1053.876) [-1060.219] (-1052.735) -- 0:02:45
      52000 -- [-1051.400] (-1056.985) (-1058.245) (-1065.346) * [-1050.299] (-1061.524) (-1058.549) (-1058.298) -- 0:02:44
      52500 -- (-1051.904) (-1056.171) (-1052.843) [-1053.110] * [-1055.407] (-1056.001) (-1053.728) (-1062.795) -- 0:02:42
      53000 -- (-1049.077) (-1051.614) (-1055.994) [-1054.675] * [-1054.912] (-1051.584) (-1061.707) (-1055.626) -- 0:02:40
      53500 -- (-1050.657) [-1052.754] (-1055.060) (-1057.091) * [-1054.005] (-1056.795) (-1059.293) (-1058.507) -- 0:02:39
      54000 -- (-1053.917) [-1054.899] (-1053.763) (-1056.076) * (-1052.395) (-1058.632) [-1054.686] (-1054.597) -- 0:02:55
      54500 -- (-1053.487) (-1052.808) (-1056.222) [-1055.241] * (-1057.534) (-1057.664) (-1057.090) [-1057.238] -- 0:02:53
      55000 -- [-1049.969] (-1054.980) (-1058.354) (-1053.003) * [-1053.686] (-1057.124) (-1059.082) (-1053.172) -- 0:02:51

      Average standard deviation of split frequencies: 0.000000

      55500 -- (-1058.586) [-1050.082] (-1054.562) (-1053.087) * [-1049.117] (-1054.717) (-1055.157) (-1053.293) -- 0:02:50
      56000 -- [-1051.812] (-1059.424) (-1053.237) (-1056.364) * [-1053.457] (-1056.081) (-1063.200) (-1054.887) -- 0:02:48
      56500 -- (-1052.082) [-1057.803] (-1056.367) (-1057.157) * (-1051.850) (-1058.467) (-1059.741) [-1053.470] -- 0:02:46
      57000 -- (-1053.648) (-1055.251) [-1055.628] (-1057.152) * (-1050.832) [-1052.170] (-1058.108) (-1053.871) -- 0:02:45
      57500 -- [-1051.019] (-1055.549) (-1054.019) (-1058.086) * (-1055.461) (-1058.183) (-1058.411) [-1053.123] -- 0:02:43
      58000 -- [-1054.183] (-1053.232) (-1054.676) (-1054.879) * (-1053.420) (-1057.288) [-1054.595] (-1051.457) -- 0:02:42
      58500 -- [-1049.315] (-1057.109) (-1055.239) (-1055.171) * [-1052.025] (-1059.840) (-1056.151) (-1053.191) -- 0:02:40
      59000 -- (-1051.786) (-1052.033) (-1060.697) [-1052.084] * (-1056.143) (-1059.174) [-1056.089] (-1052.508) -- 0:02:39
      59500 -- (-1054.630) (-1057.240) (-1053.961) [-1053.938] * (-1059.655) (-1051.837) (-1053.371) [-1056.506] -- 0:02:38
      60000 -- (-1062.290) [-1054.380] (-1056.655) (-1051.299) * (-1052.868) (-1056.840) (-1057.592) [-1051.107] -- 0:02:52

      Average standard deviation of split frequencies: 0.000000

      60500 -- (-1063.782) (-1060.201) (-1053.675) [-1052.745] * [-1053.907] (-1057.959) (-1062.874) (-1048.884) -- 0:02:50
      61000 -- (-1053.957) [-1057.670] (-1059.343) (-1056.219) * (-1055.286) (-1062.820) [-1062.754] (-1055.730) -- 0:02:49
      61500 -- (-1057.854) (-1053.587) (-1059.948) [-1052.381] * (-1056.782) (-1061.139) (-1056.292) [-1057.832] -- 0:02:47
      62000 -- [-1050.010] (-1056.949) (-1054.244) (-1053.846) * [-1052.330] (-1059.684) (-1064.095) (-1061.406) -- 0:02:46
      62500 -- (-1050.604) (-1056.607) [-1052.123] (-1062.086) * [-1049.012] (-1058.794) (-1062.099) (-1055.411) -- 0:02:45
      63000 -- [-1052.140] (-1061.293) (-1055.562) (-1058.377) * [-1050.294] (-1057.979) (-1061.342) (-1053.155) -- 0:02:43
      63500 -- [-1057.988] (-1054.518) (-1055.126) (-1052.635) * (-1051.271) (-1059.422) [-1057.055] (-1054.160) -- 0:02:42
      64000 -- (-1058.109) (-1053.137) [-1051.508] (-1052.609) * [-1052.020] (-1051.693) (-1060.084) (-1058.561) -- 0:02:40
      64500 -- (-1055.331) (-1055.231) [-1054.124] (-1067.339) * [-1052.420] (-1055.230) (-1054.410) (-1054.243) -- 0:02:39
      65000 -- (-1056.307) (-1059.059) [-1050.648] (-1054.537) * (-1055.551) [-1055.041] (-1057.427) (-1057.969) -- 0:02:38

      Average standard deviation of split frequencies: 0.000000

      65500 -- (-1054.748) (-1052.986) (-1053.688) [-1052.365] * (-1056.669) [-1053.528] (-1052.430) (-1059.139) -- 0:02:51
      66000 -- (-1053.680) (-1054.766) [-1048.997] (-1053.533) * (-1053.104) (-1060.057) [-1054.057] (-1058.438) -- 0:02:49
      66500 -- (-1060.181) (-1068.010) (-1048.397) [-1051.668] * (-1056.922) [-1061.085] (-1054.862) (-1057.618) -- 0:02:48
      67000 -- (-1055.795) (-1060.740) (-1053.559) [-1054.103] * (-1057.645) (-1064.713) [-1052.342] (-1056.914) -- 0:02:47
      67500 -- [-1057.803] (-1055.274) (-1054.710) (-1055.890) * (-1058.582) [-1054.338] (-1064.923) (-1060.460) -- 0:02:45
      68000 -- (-1055.349) [-1051.879] (-1056.395) (-1054.063) * (-1055.383) (-1054.853) (-1054.277) [-1059.651] -- 0:02:44
      68500 -- (-1057.245) [-1050.053] (-1056.401) (-1053.050) * (-1053.080) (-1061.645) (-1062.138) [-1059.619] -- 0:02:43
      69000 -- (-1060.571) [-1055.575] (-1057.282) (-1049.557) * (-1050.688) (-1059.114) (-1058.119) [-1053.551] -- 0:02:41
      69500 -- (-1061.265) (-1054.694) [-1054.687] (-1051.960) * [-1061.331] (-1062.147) (-1056.778) (-1057.737) -- 0:02:40
      70000 -- (-1069.474) [-1052.225] (-1056.528) (-1058.721) * (-1051.766) (-1057.152) [-1053.519] (-1051.857) -- 0:02:39

      Average standard deviation of split frequencies: 0.000000

      70500 -- (-1061.459) (-1056.421) (-1057.300) [-1052.831] * (-1058.919) (-1055.861) (-1056.999) [-1058.224] -- 0:02:38
      71000 -- (-1057.894) (-1052.902) (-1055.531) [-1052.840] * (-1058.901) (-1063.886) [-1058.760] (-1050.754) -- 0:02:37
      71500 -- (-1054.794) [-1055.658] (-1063.138) (-1054.728) * [-1056.288] (-1056.625) (-1057.073) (-1060.568) -- 0:02:48
      72000 -- (-1061.967) [-1050.894] (-1067.021) (-1059.808) * (-1056.435) (-1056.184) [-1058.461] (-1055.089) -- 0:02:47
      72500 -- [-1060.913] (-1053.266) (-1054.879) (-1055.133) * (-1054.731) (-1063.258) (-1057.867) [-1051.507] -- 0:02:46
      73000 -- (-1059.431) [-1053.368] (-1055.707) (-1050.938) * (-1051.836) (-1057.593) (-1061.377) [-1052.820] -- 0:02:45
      73500 -- [-1065.343] (-1051.636) (-1052.891) (-1057.013) * (-1057.275) (-1059.160) (-1053.875) [-1051.122] -- 0:02:43
      74000 -- (-1055.732) [-1050.497] (-1050.868) (-1063.167) * (-1059.561) (-1054.430) [-1049.605] (-1063.981) -- 0:02:42
      74500 -- (-1058.089) [-1056.086] (-1058.874) (-1055.768) * (-1053.162) (-1055.436) (-1052.422) [-1057.673] -- 0:02:41
      75000 -- (-1059.001) (-1054.553) (-1057.821) [-1049.775] * [-1054.699] (-1058.740) (-1054.777) (-1056.358) -- 0:02:40

      Average standard deviation of split frequencies: 0.000000

      75500 -- (-1054.344) [-1054.302] (-1049.797) (-1050.904) * (-1055.826) (-1063.327) [-1049.053] (-1048.699) -- 0:02:39
      76000 -- [-1051.268] (-1056.934) (-1063.562) (-1053.063) * (-1060.437) (-1056.179) [-1048.579] (-1052.243) -- 0:02:38
      76500 -- [-1055.956] (-1054.335) (-1050.540) (-1054.869) * [-1058.217] (-1054.040) (-1057.091) (-1051.762) -- 0:02:36
      77000 -- (-1056.516) (-1056.809) (-1056.912) [-1055.043] * (-1054.972) (-1056.210) (-1060.625) [-1052.944] -- 0:02:35
      77500 -- [-1055.305] (-1054.112) (-1054.989) (-1054.810) * (-1064.302) [-1052.858] (-1058.455) (-1054.331) -- 0:02:46
      78000 -- (-1058.807) (-1055.968) [-1055.749] (-1056.210) * [-1056.886] (-1054.254) (-1055.110) (-1051.354) -- 0:02:45
      78500 -- (-1060.109) (-1058.345) (-1058.531) [-1058.783] * (-1058.024) (-1054.345) [-1051.067] (-1056.435) -- 0:02:44
      79000 -- (-1056.360) (-1058.290) (-1053.165) [-1053.084] * (-1053.310) (-1059.463) (-1056.243) [-1053.804] -- 0:02:43
      79500 -- (-1052.458) (-1056.912) (-1062.730) [-1056.680] * [-1058.752] (-1064.150) (-1060.224) (-1058.573) -- 0:02:42
      80000 -- (-1050.267) (-1059.525) [-1055.787] (-1055.330) * (-1056.043) (-1052.027) [-1056.375] (-1055.269) -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      80500 -- [-1050.765] (-1055.254) (-1060.895) (-1053.896) * (-1056.300) [-1053.318] (-1051.381) (-1052.061) -- 0:02:39
      81000 -- (-1051.868) (-1057.884) (-1061.652) [-1051.683] * (-1059.768) [-1058.005] (-1053.637) (-1051.483) -- 0:02:38
      81500 -- (-1055.355) (-1055.041) [-1056.639] (-1054.275) * (-1058.442) (-1051.924) [-1052.082] (-1057.882) -- 0:02:37
      82000 -- (-1056.966) (-1054.083) (-1054.562) [-1051.564] * (-1066.398) (-1058.198) [-1053.016] (-1062.874) -- 0:02:36
      82500 -- (-1055.965) (-1054.212) [-1053.154] (-1052.323) * (-1057.499) (-1060.133) (-1054.087) [-1053.772] -- 0:02:35
      83000 -- (-1051.572) (-1057.880) (-1057.645) [-1053.015] * (-1054.499) (-1056.201) [-1055.063] (-1059.494) -- 0:02:45
      83500 -- [-1053.043] (-1056.153) (-1057.767) (-1055.388) * [-1052.415] (-1059.782) (-1052.038) (-1053.433) -- 0:02:44
      84000 -- (-1052.400) [-1056.598] (-1055.828) (-1056.936) * (-1051.747) (-1054.327) (-1059.549) [-1055.675] -- 0:02:43
      84500 -- (-1050.484) [-1053.309] (-1064.477) (-1055.844) * (-1061.163) [-1054.547] (-1054.724) (-1051.177) -- 0:02:42
      85000 -- (-1055.465) (-1054.353) (-1057.233) [-1052.180] * [-1052.687] (-1051.902) (-1053.472) (-1059.959) -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      85500 -- (-1054.932) (-1055.862) (-1050.609) [-1055.098] * [-1050.556] (-1051.148) (-1055.311) (-1053.090) -- 0:02:40
      86000 -- (-1052.073) (-1052.172) (-1055.699) [-1051.754] * (-1054.675) [-1050.779] (-1060.105) (-1054.298) -- 0:02:39
      86500 -- (-1062.900) (-1058.960) [-1053.161] (-1050.008) * [-1051.579] (-1055.195) (-1055.134) (-1058.467) -- 0:02:38
      87000 -- (-1063.867) (-1053.496) (-1053.437) [-1050.115] * [-1055.936] (-1054.266) (-1057.262) (-1059.115) -- 0:02:37
      87500 -- (-1054.789) (-1067.104) (-1055.880) [-1049.794] * (-1054.134) (-1057.253) [-1053.897] (-1054.546) -- 0:02:36
      88000 -- (-1050.949) (-1053.661) (-1056.570) [-1050.930] * [-1047.970] (-1057.965) (-1057.579) (-1062.225) -- 0:02:35
      88500 -- [-1060.785] (-1055.325) (-1056.057) (-1050.798) * (-1051.632) [-1061.005] (-1056.987) (-1058.704) -- 0:02:34
      89000 -- (-1063.970) (-1055.040) (-1053.215) [-1050.383] * [-1054.740] (-1060.633) (-1054.949) (-1058.877) -- 0:02:43
      89500 -- (-1053.108) (-1058.155) (-1056.609) [-1056.566] * (-1056.800) (-1056.691) [-1052.199] (-1053.403) -- 0:02:42
      90000 -- (-1060.602) (-1054.042) [-1057.327] (-1060.747) * (-1055.675) (-1055.799) [-1050.764] (-1064.882) -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      90500 -- [-1055.583] (-1057.194) (-1062.958) (-1064.189) * [-1052.610] (-1053.645) (-1059.757) (-1059.435) -- 0:02:40
      91000 -- (-1061.127) (-1056.533) (-1052.868) [-1063.999] * (-1057.434) [-1055.646] (-1057.011) (-1053.507) -- 0:02:39
      91500 -- (-1052.795) [-1056.095] (-1054.024) (-1057.752) * (-1054.808) (-1055.699) [-1056.587] (-1061.014) -- 0:02:38
      92000 -- (-1050.617) (-1062.401) [-1050.135] (-1057.192) * (-1062.378) (-1058.457) [-1049.773] (-1052.843) -- 0:02:37
      92500 -- (-1052.080) [-1058.386] (-1054.658) (-1052.674) * [-1055.537] (-1059.241) (-1054.638) (-1055.200) -- 0:02:36
      93000 -- (-1054.377) (-1052.588) (-1054.017) [-1052.647] * (-1054.148) [-1059.264] (-1057.400) (-1058.615) -- 0:02:36
      93500 -- [-1054.309] (-1055.458) (-1063.602) (-1054.671) * [-1052.813] (-1057.637) (-1057.881) (-1062.455) -- 0:02:35
      94000 -- (-1056.814) (-1058.245) (-1056.557) [-1057.304] * (-1066.632) (-1054.518) (-1056.234) [-1052.934] -- 0:02:34
      94500 -- (-1056.144) [-1060.852] (-1056.851) (-1060.131) * (-1063.173) (-1060.339) [-1055.212] (-1052.837) -- 0:02:33
      95000 -- (-1055.018) (-1068.208) (-1058.301) [-1056.416] * [-1054.923] (-1057.358) (-1052.035) (-1052.571) -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      95500 -- (-1049.967) (-1054.459) (-1055.297) [-1051.380] * [-1053.112] (-1053.444) (-1052.603) (-1056.309) -- 0:02:41
      96000 -- (-1055.284) (-1060.817) (-1053.642) [-1055.337] * (-1057.987) [-1054.669] (-1067.851) (-1056.714) -- 0:02:40
      96500 -- [-1055.333] (-1052.869) (-1053.152) (-1057.341) * (-1056.656) [-1058.718] (-1055.893) (-1052.576) -- 0:02:39
      97000 -- (-1054.766) [-1054.613] (-1055.423) (-1059.725) * (-1057.886) (-1057.123) [-1055.549] (-1059.417) -- 0:02:38
      97500 -- (-1051.717) (-1052.430) [-1052.472] (-1057.526) * [-1053.952] (-1052.561) (-1054.931) (-1063.305) -- 0:02:37
      98000 -- (-1051.772) [-1056.824] (-1060.074) (-1052.620) * (-1054.036) (-1053.989) (-1052.804) [-1062.656] -- 0:02:36
      98500 -- [-1054.001] (-1057.795) (-1057.739) (-1055.055) * [-1055.314] (-1053.261) (-1051.361) (-1052.836) -- 0:02:35
      99000 -- (-1056.212) (-1055.265) [-1055.833] (-1052.957) * [-1054.392] (-1052.615) (-1058.476) (-1054.586) -- 0:02:34
      99500 -- [-1051.638] (-1057.740) (-1062.421) (-1052.474) * (-1055.052) (-1058.085) (-1057.070) [-1058.248] -- 0:02:33
      100000 -- (-1056.561) [-1048.904] (-1059.200) (-1058.995) * (-1052.308) (-1059.919) [-1057.993] (-1057.697) -- 0:02:33

      Average standard deviation of split frequencies: 0.000000

      100500 -- [-1052.919] (-1055.140) (-1055.623) (-1057.117) * (-1053.198) (-1058.324) [-1054.718] (-1057.879) -- 0:02:32
      101000 -- (-1053.233) [-1054.631] (-1058.511) (-1058.691) * [-1054.946] (-1053.936) (-1056.068) (-1051.353) -- 0:02:40
      101500 -- (-1057.633) (-1052.966) (-1058.103) [-1055.603] * (-1053.667) (-1053.910) [-1060.441] (-1057.230) -- 0:02:39
      102000 -- (-1055.507) [-1054.925] (-1055.310) (-1060.568) * (-1052.141) (-1054.973) [-1052.051] (-1058.011) -- 0:02:38
      102500 -- (-1059.639) (-1053.865) [-1049.763] (-1056.101) * [-1055.391] (-1058.412) (-1048.248) (-1058.894) -- 0:02:37
      103000 -- [-1057.025] (-1054.112) (-1057.817) (-1061.481) * (-1054.393) (-1054.375) [-1053.242] (-1065.754) -- 0:02:36
      103500 -- (-1058.866) (-1059.852) [-1052.821] (-1061.657) * (-1057.129) (-1060.352) [-1057.486] (-1055.327) -- 0:02:35
      104000 -- (-1057.034) [-1052.945] (-1062.288) (-1057.669) * (-1055.146) (-1057.196) [-1052.204] (-1057.251) -- 0:02:35
      104500 -- (-1061.715) (-1060.017) (-1059.246) [-1048.751] * (-1057.853) (-1054.088) (-1056.204) [-1058.000] -- 0:02:34
      105000 -- [-1053.187] (-1057.393) (-1065.021) (-1049.665) * (-1056.435) (-1060.248) (-1052.030) [-1054.357] -- 0:02:33

      Average standard deviation of split frequencies: 0.000000

      105500 -- (-1052.639) (-1058.155) (-1053.478) [-1051.343] * (-1060.861) (-1055.185) (-1053.648) [-1054.277] -- 0:02:32
      106000 -- (-1058.720) (-1054.202) [-1053.408] (-1054.282) * (-1061.006) (-1062.347) [-1054.701] (-1054.909) -- 0:02:40
      106500 -- (-1063.978) (-1058.191) [-1057.593] (-1053.052) * (-1057.918) [-1059.714] (-1050.827) (-1054.133) -- 0:02:39
      107000 -- (-1055.680) (-1057.153) (-1055.330) [-1057.033] * (-1054.141) (-1053.263) (-1052.082) [-1056.625] -- 0:02:38
      107500 -- (-1060.310) [-1052.393] (-1048.386) (-1064.448) * (-1057.162) [-1058.766] (-1057.431) (-1057.723) -- 0:02:37
      108000 -- (-1054.612) (-1054.660) [-1054.501] (-1053.674) * (-1057.828) [-1060.105] (-1056.390) (-1063.036) -- 0:02:36
      108500 -- [-1054.281] (-1053.133) (-1054.618) (-1059.189) * (-1058.718) (-1056.291) (-1052.795) [-1059.689] -- 0:02:36
      109000 -- [-1050.054] (-1057.500) (-1056.218) (-1053.536) * [-1059.080] (-1052.697) (-1050.457) (-1056.606) -- 0:02:35
      109500 -- (-1057.350) (-1063.033) (-1049.642) [-1051.844] * (-1058.158) [-1052.164] (-1054.735) (-1061.022) -- 0:02:34
      110000 -- (-1059.653) [-1056.541] (-1053.877) (-1059.230) * [-1054.424] (-1052.594) (-1054.327) (-1061.014) -- 0:02:33

      Average standard deviation of split frequencies: 0.000000

      110500 -- (-1059.017) [-1054.457] (-1052.859) (-1060.527) * (-1053.870) [-1051.725] (-1057.215) (-1060.282) -- 0:02:32
      111000 -- (-1055.368) (-1056.903) [-1054.487] (-1056.526) * (-1060.555) [-1058.699] (-1053.882) (-1065.056) -- 0:02:32
      111500 -- (-1065.370) (-1053.600) [-1054.650] (-1053.648) * (-1059.724) [-1051.447] (-1054.592) (-1066.762) -- 0:02:31
      112000 -- (-1056.957) [-1053.921] (-1050.007) (-1056.560) * (-1056.788) (-1055.833) [-1056.837] (-1064.225) -- 0:02:38
      112500 -- (-1058.470) [-1054.203] (-1052.340) (-1056.239) * (-1057.540) (-1056.209) [-1058.584] (-1056.648) -- 0:02:37
      113000 -- (-1052.159) (-1060.599) [-1053.378] (-1052.997) * (-1056.169) (-1054.731) [-1055.356] (-1059.766) -- 0:02:36
      113500 -- [-1051.215] (-1059.237) (-1056.318) (-1060.536) * (-1052.310) (-1064.602) [-1055.557] (-1070.802) -- 0:02:36
      114000 -- (-1060.371) [-1052.553] (-1052.817) (-1053.380) * (-1051.221) [-1058.522] (-1054.961) (-1059.955) -- 0:02:35
      114500 -- (-1053.694) [-1052.551] (-1052.617) (-1053.141) * [-1051.437] (-1057.801) (-1061.344) (-1058.816) -- 0:02:34
      115000 -- (-1054.607) [-1053.175] (-1052.869) (-1056.920) * (-1054.137) (-1057.999) [-1055.546] (-1069.332) -- 0:02:33

      Average standard deviation of split frequencies: 0.000000

      115500 -- (-1049.917) (-1052.446) [-1052.056] (-1059.693) * (-1050.156) (-1059.298) (-1057.391) [-1063.695] -- 0:02:33
      116000 -- [-1056.236] (-1056.548) (-1055.438) (-1055.634) * [-1053.013] (-1058.426) (-1063.378) (-1065.289) -- 0:02:32
      116500 -- [-1049.223] (-1052.557) (-1053.561) (-1058.263) * (-1058.135) (-1056.746) (-1054.634) [-1063.541] -- 0:02:31
      117000 -- [-1056.044] (-1051.596) (-1054.580) (-1054.737) * [-1054.816] (-1059.852) (-1053.530) (-1054.617) -- 0:02:30
      117500 -- [-1052.887] (-1053.372) (-1054.168) (-1055.460) * (-1054.427) [-1056.339] (-1052.043) (-1060.025) -- 0:02:30
      118000 -- (-1050.431) (-1054.187) [-1053.297] (-1056.730) * (-1053.168) [-1052.339] (-1054.027) (-1053.521) -- 0:02:36
      118500 -- [-1049.466] (-1061.577) (-1053.427) (-1054.197) * [-1053.840] (-1051.702) (-1055.966) (-1051.935) -- 0:02:36
      119000 -- (-1053.784) (-1057.014) [-1050.456] (-1056.707) * (-1059.392) (-1051.292) [-1050.712] (-1056.706) -- 0:02:35
      119500 -- [-1049.431] (-1058.372) (-1059.062) (-1050.652) * (-1058.588) [-1055.837] (-1054.003) (-1055.932) -- 0:02:34
      120000 -- (-1054.084) [-1058.647] (-1052.766) (-1054.162) * [-1054.589] (-1052.866) (-1052.821) (-1058.912) -- 0:02:34

      Average standard deviation of split frequencies: 0.000000

      120500 -- [-1051.944] (-1051.685) (-1055.319) (-1053.815) * [-1052.822] (-1057.640) (-1052.517) (-1062.433) -- 0:02:33
      121000 -- [-1055.194] (-1051.243) (-1053.258) (-1056.959) * (-1052.482) (-1060.825) [-1052.947] (-1060.074) -- 0:02:32
      121500 -- [-1054.034] (-1051.294) (-1058.142) (-1052.481) * (-1052.855) (-1055.766) [-1052.117] (-1057.536) -- 0:02:31
      122000 -- (-1057.336) (-1053.840) (-1055.313) [-1052.700] * (-1060.810) [-1056.830] (-1053.009) (-1052.173) -- 0:02:31
      122500 -- (-1055.913) [-1059.780] (-1055.103) (-1052.620) * [-1053.455] (-1059.729) (-1058.194) (-1053.487) -- 0:02:30
      123000 -- [-1054.337] (-1059.654) (-1052.817) (-1049.931) * (-1055.657) (-1054.962) (-1056.405) [-1052.996] -- 0:02:29
      123500 -- (-1052.433) [-1051.427] (-1057.962) (-1052.415) * (-1053.911) (-1055.322) [-1059.510] (-1058.556) -- 0:02:36
      124000 -- (-1055.897) (-1059.032) [-1059.155] (-1054.415) * (-1056.667) (-1065.532) (-1057.552) [-1053.056] -- 0:02:35
      124500 -- (-1057.898) [-1053.909] (-1053.833) (-1052.401) * (-1052.990) [-1055.830] (-1054.939) (-1055.491) -- 0:02:34
      125000 -- (-1054.974) (-1054.643) [-1053.737] (-1058.532) * (-1058.699) [-1057.764] (-1053.267) (-1055.339) -- 0:02:34

      Average standard deviation of split frequencies: 0.000000

      125500 -- (-1059.311) (-1054.488) (-1051.507) [-1055.168] * (-1061.978) [-1056.385] (-1057.133) (-1049.655) -- 0:02:33
      126000 -- (-1052.874) (-1056.420) [-1056.134] (-1053.404) * (-1058.105) (-1060.883) (-1054.415) [-1049.576] -- 0:02:32
      126500 -- (-1056.451) [-1052.949] (-1053.081) (-1060.681) * (-1054.999) [-1055.077] (-1051.636) (-1049.857) -- 0:02:31
      127000 -- [-1053.414] (-1056.026) (-1058.429) (-1065.266) * (-1058.010) (-1059.272) [-1049.972] (-1054.598) -- 0:02:31
      127500 -- [-1064.191] (-1054.559) (-1056.051) (-1057.905) * (-1052.913) (-1057.016) [-1055.339] (-1052.486) -- 0:02:30
      128000 -- (-1058.546) (-1057.231) (-1060.202) [-1059.403] * (-1065.010) (-1054.321) [-1053.589] (-1052.138) -- 0:02:29
      128500 -- [-1053.832] (-1056.607) (-1054.231) (-1051.220) * (-1053.663) (-1053.671) (-1057.686) [-1057.474] -- 0:02:29
      129000 -- (-1052.814) (-1054.102) (-1055.301) [-1055.969] * (-1058.840) (-1054.459) [-1052.676] (-1052.133) -- 0:02:28
      129500 -- (-1057.886) [-1057.233] (-1056.710) (-1056.156) * (-1062.370) (-1061.819) (-1055.671) [-1062.045] -- 0:02:34
      130000 -- [-1055.588] (-1056.042) (-1056.284) (-1050.978) * (-1053.988) [-1060.725] (-1056.778) (-1060.263) -- 0:02:33

      Average standard deviation of split frequencies: 0.000000

      130500 -- (-1054.050) (-1056.340) [-1054.080] (-1056.963) * (-1060.052) (-1054.265) [-1055.775] (-1054.757) -- 0:02:33
      131000 -- (-1052.845) [-1053.025] (-1059.517) (-1050.491) * [-1055.635] (-1053.122) (-1062.083) (-1055.532) -- 0:02:32
      131500 -- (-1052.232) (-1059.760) (-1053.532) [-1055.102] * [-1050.099] (-1054.369) (-1051.628) (-1052.722) -- 0:02:31
      132000 -- [-1059.136] (-1055.687) (-1057.235) (-1054.876) * (-1058.843) (-1054.432) (-1051.908) [-1052.748] -- 0:02:31
      132500 -- (-1052.696) [-1064.793] (-1055.144) (-1058.857) * (-1057.397) [-1052.074] (-1053.362) (-1057.039) -- 0:02:30
      133000 -- [-1056.271] (-1051.741) (-1060.317) (-1055.980) * (-1058.954) (-1058.081) (-1051.588) [-1053.087] -- 0:02:29
      133500 -- [-1061.965] (-1060.077) (-1052.313) (-1057.304) * (-1055.146) (-1058.627) [-1052.123] (-1061.063) -- 0:02:29
      134000 -- (-1057.144) (-1063.018) (-1053.191) [-1052.799] * [-1054.313] (-1054.991) (-1055.203) (-1050.101) -- 0:02:28
      134500 -- (-1055.044) (-1055.819) [-1055.423] (-1065.268) * (-1053.580) (-1063.027) (-1054.906) [-1049.813] -- 0:02:28
      135000 -- (-1056.619) (-1058.173) [-1056.720] (-1056.267) * (-1051.630) (-1062.074) (-1063.691) [-1052.317] -- 0:02:27

      Average standard deviation of split frequencies: 0.000000

      135500 -- (-1054.010) (-1065.203) [-1056.678] (-1056.188) * (-1055.265) (-1054.488) (-1059.694) [-1054.267] -- 0:02:33
      136000 -- (-1054.983) (-1057.908) [-1055.251] (-1054.355) * [-1057.250] (-1051.957) (-1057.971) (-1051.557) -- 0:02:32
      136500 -- [-1053.752] (-1053.479) (-1051.104) (-1051.254) * [-1050.334] (-1063.695) (-1058.105) (-1053.107) -- 0:02:31
      137000 -- [-1051.215] (-1055.319) (-1056.988) (-1052.594) * [-1053.935] (-1056.089) (-1055.049) (-1057.523) -- 0:02:31
      137500 -- [-1051.299] (-1054.647) (-1060.547) (-1052.243) * (-1054.598) (-1057.025) [-1054.947] (-1052.466) -- 0:02:30
      138000 -- (-1055.331) (-1065.672) (-1059.382) [-1054.160] * [-1061.868] (-1063.549) (-1064.677) (-1053.922) -- 0:02:29
      138500 -- (-1051.922) (-1056.098) (-1059.356) [-1052.820] * (-1053.703) [-1057.511] (-1053.329) (-1056.380) -- 0:02:29
      139000 -- [-1051.848] (-1064.468) (-1059.223) (-1053.372) * [-1055.175] (-1058.550) (-1062.821) (-1052.685) -- 0:02:28
      139500 -- [-1057.704] (-1058.647) (-1064.943) (-1057.768) * (-1053.174) (-1056.471) [-1053.344] (-1054.353) -- 0:02:28
      140000 -- (-1054.124) (-1062.688) (-1054.896) [-1057.587] * (-1057.814) (-1055.623) [-1056.696] (-1050.679) -- 0:02:27

      Average standard deviation of split frequencies: 0.000000

      140500 -- (-1059.584) (-1056.921) (-1061.191) [-1056.031] * (-1061.238) (-1056.889) (-1053.308) [-1051.470] -- 0:02:26
      141000 -- (-1058.444) [-1055.769] (-1062.658) (-1055.022) * (-1059.410) (-1060.976) [-1054.249] (-1052.012) -- 0:02:26
      141500 -- (-1059.269) [-1052.194] (-1067.819) (-1057.939) * (-1057.685) (-1059.183) [-1052.187] (-1053.385) -- 0:02:31
      142000 -- (-1053.244) (-1051.099) (-1059.714) [-1052.980] * [-1058.983] (-1055.586) (-1054.920) (-1051.851) -- 0:02:31
      142500 -- (-1061.599) (-1056.687) (-1058.797) [-1054.221] * (-1058.261) [-1056.116] (-1051.034) (-1050.710) -- 0:02:30
      143000 -- (-1058.586) [-1050.601] (-1065.047) (-1053.977) * (-1054.081) (-1055.240) [-1051.082] (-1052.891) -- 0:02:29
      143500 -- (-1055.592) [-1049.264] (-1059.440) (-1054.044) * (-1058.233) [-1050.193] (-1052.533) (-1054.357) -- 0:02:29
      144000 -- [-1052.679] (-1062.547) (-1057.454) (-1052.924) * (-1055.208) (-1053.853) (-1051.774) [-1050.902] -- 0:02:28
      144500 -- [-1058.650] (-1049.137) (-1059.699) (-1057.975) * (-1053.435) (-1056.333) (-1054.516) [-1055.695] -- 0:02:28
      145000 -- [-1056.210] (-1051.550) (-1059.011) (-1057.441) * [-1053.127] (-1059.292) (-1052.114) (-1058.283) -- 0:02:27

      Average standard deviation of split frequencies: 0.000000

      145500 -- [-1055.507] (-1053.683) (-1064.195) (-1053.297) * (-1062.625) (-1056.061) (-1057.833) [-1059.151] -- 0:02:26
      146000 -- [-1058.837] (-1052.770) (-1054.096) (-1059.238) * (-1053.889) (-1062.532) (-1054.928) [-1059.697] -- 0:02:26
      146500 -- (-1057.060) (-1058.060) [-1055.718] (-1053.632) * (-1058.236) (-1051.673) (-1052.151) [-1055.217] -- 0:02:25
      147000 -- (-1054.742) [-1058.643] (-1057.897) (-1052.929) * (-1053.272) [-1056.348] (-1053.893) (-1054.931) -- 0:02:30
      147500 -- (-1059.371) (-1060.146) (-1055.525) [-1053.881] * (-1051.720) (-1056.193) (-1056.352) [-1052.112] -- 0:02:30
      148000 -- [-1056.786] (-1061.266) (-1053.147) (-1055.485) * (-1053.860) (-1059.127) [-1060.400] (-1056.311) -- 0:02:29
      148500 -- (-1056.896) (-1061.554) (-1054.200) [-1055.419] * (-1050.797) (-1054.196) [-1057.135] (-1057.122) -- 0:02:29
      149000 -- (-1050.570) (-1058.261) (-1057.268) [-1050.901] * (-1055.236) (-1053.509) (-1056.408) [-1053.716] -- 0:02:28
      149500 -- (-1056.185) [-1053.961] (-1062.846) (-1056.826) * [-1056.610] (-1055.791) (-1054.333) (-1053.108) -- 0:02:27
      150000 -- [-1059.374] (-1056.442) (-1059.356) (-1058.407) * (-1054.296) [-1050.935] (-1054.138) (-1052.872) -- 0:02:27

      Average standard deviation of split frequencies: 0.000000

      150500 -- (-1052.966) (-1055.957) (-1054.976) [-1051.857] * (-1051.820) (-1054.425) (-1061.028) [-1057.564] -- 0:02:26
      151000 -- (-1052.615) (-1051.681) (-1053.027) [-1050.168] * (-1054.491) [-1052.095] (-1058.085) (-1061.731) -- 0:02:26
      151500 -- (-1058.609) [-1050.841] (-1055.826) (-1049.785) * [-1055.457] (-1055.302) (-1052.907) (-1054.171) -- 0:02:25
      152000 -- (-1054.905) (-1058.120) [-1055.934] (-1056.127) * (-1064.706) (-1054.617) [-1053.824] (-1058.482) -- 0:02:25
      152500 -- [-1056.517] (-1055.650) (-1058.790) (-1056.557) * (-1051.499) [-1053.988] (-1056.793) (-1050.513) -- 0:02:24
      153000 -- (-1056.271) (-1056.911) (-1051.859) [-1054.802] * (-1056.522) [-1055.887] (-1066.129) (-1054.904) -- 0:02:29
      153500 -- (-1059.874) (-1052.188) [-1055.200] (-1058.917) * [-1054.360] (-1056.418) (-1059.342) (-1059.335) -- 0:02:28
      154000 -- (-1056.709) (-1053.848) [-1053.668] (-1059.133) * [-1051.931] (-1053.699) (-1052.383) (-1055.470) -- 0:02:28
      154500 -- (-1053.360) [-1051.551] (-1049.198) (-1055.046) * [-1052.856] (-1050.261) (-1053.092) (-1053.292) -- 0:02:27
      155000 -- (-1056.366) (-1050.408) (-1049.495) [-1052.716] * [-1054.936] (-1052.802) (-1054.398) (-1052.356) -- 0:02:27

      Average standard deviation of split frequencies: 0.000000

      155500 -- (-1053.984) [-1055.702] (-1056.124) (-1054.264) * (-1055.106) [-1053.875] (-1055.566) (-1054.340) -- 0:02:26
      156000 -- (-1053.106) (-1055.659) (-1055.884) [-1052.335] * (-1062.448) (-1054.982) (-1060.111) [-1051.638] -- 0:02:26
      156500 -- (-1056.659) (-1055.291) (-1053.835) [-1051.187] * (-1064.099) (-1054.554) (-1056.767) [-1052.759] -- 0:02:25
      157000 -- (-1057.193) (-1062.401) [-1052.968] (-1057.350) * (-1054.338) (-1053.659) (-1058.716) [-1054.388] -- 0:02:24
      157500 -- (-1070.533) (-1052.416) [-1049.485] (-1056.147) * (-1059.680) [-1052.655] (-1058.928) (-1056.000) -- 0:02:24
      158000 -- [-1061.846] (-1061.865) (-1058.745) (-1053.606) * (-1050.310) [-1055.359] (-1063.738) (-1052.881) -- 0:02:23
      158500 -- (-1065.896) (-1054.365) (-1060.776) [-1055.349] * (-1049.419) (-1054.268) (-1073.796) [-1056.767] -- 0:02:23
      159000 -- [-1057.741] (-1051.941) (-1055.808) (-1056.235) * [-1054.973] (-1060.853) (-1052.014) (-1056.206) -- 0:02:28
      159500 -- (-1051.397) (-1049.410) (-1054.732) [-1054.153] * (-1062.244) (-1064.047) (-1054.920) [-1056.206] -- 0:02:27
      160000 -- [-1054.186] (-1055.204) (-1057.872) (-1054.115) * [-1054.044] (-1064.886) (-1050.215) (-1056.514) -- 0:02:27

      Average standard deviation of split frequencies: 0.000000

      160500 -- (-1051.012) [-1060.519] (-1061.583) (-1064.106) * (-1064.805) (-1067.209) [-1052.098] (-1057.944) -- 0:02:26
      161000 -- [-1056.157] (-1053.374) (-1050.049) (-1056.979) * (-1056.834) [-1056.111] (-1057.053) (-1056.434) -- 0:02:25
      161500 -- (-1057.864) [-1056.780] (-1053.872) (-1050.169) * [-1053.827] (-1053.648) (-1059.722) (-1057.286) -- 0:02:25
      162000 -- (-1052.678) [-1051.204] (-1054.691) (-1063.005) * [-1053.780] (-1060.222) (-1059.316) (-1054.859) -- 0:02:24
      162500 -- (-1054.251) (-1057.458) [-1051.646] (-1055.283) * (-1055.700) [-1053.075] (-1054.583) (-1056.838) -- 0:02:24
      163000 -- [-1050.961] (-1057.790) (-1049.752) (-1052.542) * (-1062.939) [-1051.408] (-1062.934) (-1054.022) -- 0:02:23
      163500 -- (-1051.970) (-1052.828) [-1055.778] (-1056.329) * (-1054.845) (-1051.938) (-1063.483) [-1052.344] -- 0:02:23
      164000 -- (-1050.767) (-1060.406) (-1057.516) [-1057.654] * [-1051.688] (-1051.875) (-1058.564) (-1054.006) -- 0:02:22
      164500 -- [-1053.750] (-1053.501) (-1057.269) (-1053.953) * (-1054.716) (-1051.730) [-1053.390] (-1053.301) -- 0:02:22
      165000 -- (-1057.230) [-1059.690] (-1059.384) (-1051.084) * (-1059.926) (-1051.284) (-1059.998) [-1051.698] -- 0:02:26

      Average standard deviation of split frequencies: 0.000000

      165500 -- (-1054.288) (-1054.311) [-1054.217] (-1060.833) * (-1055.083) [-1055.146] (-1059.213) (-1053.156) -- 0:02:26
      166000 -- (-1051.914) (-1053.373) (-1054.643) [-1062.275] * (-1051.810) (-1059.335) [-1051.401] (-1057.970) -- 0:02:25
      166500 -- (-1057.936) (-1056.313) [-1052.993] (-1061.012) * [-1051.951] (-1055.300) (-1058.827) (-1060.249) -- 0:02:25
      167000 -- [-1055.430] (-1058.575) (-1066.058) (-1060.078) * (-1051.221) (-1059.193) [-1054.242] (-1057.570) -- 0:02:24
      167500 -- [-1056.418] (-1059.875) (-1059.773) (-1060.309) * [-1051.499] (-1060.064) (-1055.854) (-1056.576) -- 0:02:24
      168000 -- (-1054.388) [-1053.999] (-1054.535) (-1055.772) * (-1058.155) (-1056.836) [-1054.886] (-1060.853) -- 0:02:23
      168500 -- (-1050.211) [-1055.496] (-1055.368) (-1055.387) * (-1053.107) [-1055.582] (-1059.918) (-1054.605) -- 0:02:23
      169000 -- [-1053.150] (-1051.374) (-1057.301) (-1061.990) * (-1062.662) (-1061.258) [-1057.917] (-1058.766) -- 0:02:22
      169500 -- (-1055.993) (-1055.981) (-1060.715) [-1053.189] * (-1066.972) (-1052.344) [-1054.930] (-1052.253) -- 0:02:22
      170000 -- [-1054.097] (-1053.703) (-1058.452) (-1060.381) * (-1056.156) [-1056.218] (-1053.691) (-1057.714) -- 0:02:21

      Average standard deviation of split frequencies: 0.000000

      170500 -- (-1055.626) (-1053.648) [-1055.206] (-1056.529) * (-1052.467) (-1061.342) (-1051.003) [-1055.262] -- 0:02:21
      171000 -- [-1055.186] (-1056.977) (-1056.663) (-1059.019) * (-1053.240) (-1063.774) [-1058.984] (-1054.376) -- 0:02:25
      171500 -- (-1055.723) [-1053.665] (-1058.882) (-1059.059) * (-1053.941) [-1061.462] (-1062.764) (-1056.822) -- 0:02:24
      172000 -- (-1054.805) (-1059.012) [-1058.490] (-1061.534) * [-1051.453] (-1061.747) (-1062.121) (-1056.326) -- 0:02:24
      172500 -- (-1054.241) (-1062.046) (-1055.345) [-1057.482] * [-1052.199] (-1059.643) (-1055.152) (-1052.527) -- 0:02:23
      173000 -- (-1050.810) [-1057.815] (-1056.000) (-1057.314) * (-1058.817) [-1057.540] (-1056.478) (-1055.395) -- 0:02:23
      173500 -- [-1051.676] (-1054.779) (-1057.108) (-1056.337) * (-1056.435) (-1055.536) (-1058.017) [-1055.451] -- 0:02:22
      174000 -- (-1060.035) (-1053.036) [-1060.182] (-1066.795) * (-1052.434) (-1051.697) (-1060.095) [-1056.669] -- 0:02:22
      174500 -- [-1060.775] (-1056.653) (-1062.902) (-1057.202) * (-1055.271) [-1052.139] (-1059.734) (-1055.370) -- 0:02:21
      175000 -- [-1051.291] (-1061.351) (-1067.203) (-1054.682) * [-1056.675] (-1059.834) (-1061.237) (-1064.050) -- 0:02:21

      Average standard deviation of split frequencies: 0.000000

      175500 -- (-1055.915) [-1055.694] (-1063.363) (-1056.634) * [-1051.840] (-1056.570) (-1061.900) (-1054.598) -- 0:02:20
      176000 -- (-1061.947) (-1057.385) (-1064.424) [-1054.743] * (-1055.621) (-1059.225) (-1060.686) [-1058.185] -- 0:02:20
      176500 -- (-1058.328) (-1055.856) (-1061.916) [-1055.699] * (-1056.735) (-1061.207) [-1057.214] (-1057.640) -- 0:02:19
      177000 -- (-1059.382) (-1060.725) [-1055.093] (-1056.810) * (-1066.063) [-1050.311] (-1058.495) (-1055.585) -- 0:02:24
      177500 -- (-1060.729) [-1050.781] (-1062.851) (-1056.723) * (-1053.930) [-1051.133] (-1060.773) (-1059.173) -- 0:02:23
      178000 -- (-1051.313) (-1056.885) [-1051.148] (-1061.240) * (-1054.908) (-1054.317) (-1055.765) [-1055.896] -- 0:02:23
      178500 -- (-1055.301) [-1055.240] (-1054.469) (-1052.068) * (-1056.871) [-1050.650] (-1058.865) (-1055.567) -- 0:02:22
      179000 -- [-1049.299] (-1051.900) (-1055.017) (-1055.109) * (-1061.853) [-1055.442] (-1053.689) (-1055.046) -- 0:02:22
      179500 -- (-1052.779) (-1056.485) [-1051.119] (-1051.377) * [-1060.597] (-1065.417) (-1054.588) (-1058.941) -- 0:02:21
      180000 -- (-1057.630) (-1058.275) (-1054.396) [-1051.524] * [-1054.453] (-1055.589) (-1062.407) (-1056.731) -- 0:02:21

      Average standard deviation of split frequencies: 0.000000

      180500 -- (-1050.857) (-1064.600) (-1050.645) [-1053.201] * (-1050.942) (-1053.586) [-1055.653] (-1055.222) -- 0:02:20
      181000 -- (-1056.454) (-1057.850) [-1052.684] (-1052.795) * (-1060.801) [-1053.213] (-1052.145) (-1051.872) -- 0:02:20
      181500 -- (-1058.077) (-1063.248) [-1052.881] (-1053.348) * [-1054.689] (-1054.228) (-1056.652) (-1052.979) -- 0:02:19
      182000 -- (-1058.537) (-1058.585) [-1053.502] (-1058.338) * (-1054.314) (-1057.618) [-1058.429] (-1057.140) -- 0:02:19
      182500 -- [-1057.368] (-1055.834) (-1057.247) (-1052.128) * [-1051.841] (-1057.258) (-1060.784) (-1056.002) -- 0:02:23
      183000 -- (-1059.343) [-1051.836] (-1060.486) (-1049.594) * [-1054.544] (-1054.499) (-1058.534) (-1054.108) -- 0:02:22
      183500 -- (-1057.614) (-1057.656) (-1055.939) [-1055.436] * [-1052.363] (-1067.028) (-1056.157) (-1052.026) -- 0:02:22
      184000 -- (-1057.754) [-1049.800] (-1056.531) (-1054.803) * (-1054.491) (-1055.285) (-1058.580) [-1052.611] -- 0:02:21
      184500 -- (-1059.682) (-1053.970) (-1054.662) [-1052.938] * (-1057.654) (-1052.231) (-1054.681) [-1055.318] -- 0:02:21
      185000 -- [-1054.098] (-1058.330) (-1057.460) (-1059.426) * (-1058.523) (-1051.292) (-1054.104) [-1060.387] -- 0:02:20

      Average standard deviation of split frequencies: 0.000000

      185500 -- (-1058.088) [-1052.783] (-1055.283) (-1060.041) * (-1060.034) [-1054.208] (-1052.900) (-1057.383) -- 0:02:20
      186000 -- (-1056.980) (-1054.515) (-1060.305) [-1056.802] * (-1055.638) (-1053.070) (-1052.692) [-1054.188] -- 0:02:20
      186500 -- (-1058.403) (-1057.143) [-1057.805] (-1059.496) * (-1056.484) (-1053.025) (-1056.309) [-1053.532] -- 0:02:19
      187000 -- (-1054.589) [-1057.008] (-1051.459) (-1059.061) * (-1060.283) [-1058.032] (-1050.621) (-1061.796) -- 0:02:19
      187500 -- [-1052.731] (-1051.774) (-1052.470) (-1061.990) * (-1055.821) [-1056.741] (-1053.647) (-1060.855) -- 0:02:18
      188000 -- (-1056.375) [-1052.111] (-1054.043) (-1058.891) * (-1060.437) (-1056.729) (-1055.498) [-1056.390] -- 0:02:18
      188500 -- (-1050.163) (-1052.917) (-1053.026) [-1057.169] * (-1064.283) (-1053.527) [-1051.240] (-1054.155) -- 0:02:22
      189000 -- [-1051.586] (-1052.113) (-1049.066) (-1054.835) * [-1051.212] (-1057.993) (-1056.897) (-1056.172) -- 0:02:21
      189500 -- [-1053.556] (-1049.297) (-1051.487) (-1053.258) * (-1051.389) (-1056.944) (-1063.537) [-1055.091] -- 0:02:21
      190000 -- (-1053.965) [-1051.543] (-1055.285) (-1062.425) * (-1056.632) (-1062.962) [-1054.929] (-1057.567) -- 0:02:20

      Average standard deviation of split frequencies: 0.000000

      190500 -- (-1054.882) [-1053.098] (-1052.181) (-1060.312) * [-1054.693] (-1053.681) (-1066.848) (-1056.342) -- 0:02:20
      191000 -- (-1062.744) (-1056.039) (-1056.813) [-1055.220] * [-1055.696] (-1054.987) (-1053.875) (-1054.141) -- 0:02:19
      191500 -- (-1061.155) [-1052.140] (-1054.636) (-1055.468) * (-1052.667) (-1055.936) [-1059.816] (-1054.634) -- 0:02:19
      192000 -- (-1058.102) (-1060.606) (-1058.598) [-1055.300] * (-1053.268) [-1052.924] (-1058.311) (-1063.273) -- 0:02:18
      192500 -- (-1053.305) (-1050.768) (-1057.383) [-1066.004] * (-1049.756) (-1056.836) [-1051.104] (-1067.177) -- 0:02:18
      193000 -- [-1054.834] (-1050.300) (-1052.604) (-1063.330) * [-1054.781] (-1055.607) (-1057.625) (-1054.681) -- 0:02:17
      193500 -- (-1052.839) (-1054.634) (-1061.500) [-1058.192] * (-1055.033) (-1055.468) [-1053.058] (-1051.318) -- 0:02:17
      194000 -- [-1057.020] (-1052.467) (-1058.835) (-1059.642) * (-1054.903) (-1057.500) (-1055.234) [-1049.920] -- 0:02:17
      194500 -- (-1054.751) [-1053.525] (-1059.877) (-1054.606) * (-1053.116) (-1055.542) (-1052.783) [-1054.356] -- 0:02:20
      195000 -- (-1058.518) (-1052.696) (-1052.182) [-1055.603] * [-1057.523] (-1055.824) (-1059.224) (-1057.815) -- 0:02:20

      Average standard deviation of split frequencies: 0.000000

      195500 -- (-1058.223) (-1051.863) [-1051.995] (-1054.359) * (-1062.760) (-1060.450) [-1052.635] (-1055.589) -- 0:02:19
      196000 -- (-1058.519) [-1049.926] (-1055.858) (-1053.310) * (-1051.618) (-1060.402) [-1057.294] (-1052.447) -- 0:02:19
      196500 -- (-1055.500) (-1051.262) (-1051.224) [-1056.504] * [-1051.095] (-1056.098) (-1054.554) (-1059.620) -- 0:02:19
      197000 -- (-1051.354) (-1056.257) (-1050.940) [-1052.684] * (-1050.517) (-1054.691) (-1054.711) [-1053.231] -- 0:02:18
      197500 -- (-1057.532) (-1054.529) [-1053.291] (-1051.699) * (-1061.409) (-1052.063) (-1055.120) [-1050.426] -- 0:02:18
      198000 -- (-1050.015) [-1053.676] (-1056.093) (-1053.607) * (-1063.376) [-1054.014] (-1054.742) (-1056.446) -- 0:02:17
      198500 -- (-1055.067) (-1052.576) (-1054.186) [-1054.227] * (-1048.091) (-1057.672) (-1054.564) [-1050.770] -- 0:02:17
      199000 -- (-1054.347) (-1053.425) (-1053.202) [-1052.299] * (-1049.954) (-1056.059) [-1056.383] (-1051.717) -- 0:02:16
      199500 -- (-1062.646) (-1056.081) [-1052.875] (-1055.754) * (-1056.320) [-1056.493] (-1054.189) (-1055.803) -- 0:02:16
      200000 -- (-1055.276) [-1058.939] (-1055.575) (-1053.673) * (-1056.507) (-1052.839) [-1049.281] (-1057.187) -- 0:02:16

      Average standard deviation of split frequencies: 0.000000

      200500 -- (-1054.213) (-1057.387) [-1055.718] (-1053.517) * (-1054.556) (-1052.809) [-1051.059] (-1056.112) -- 0:02:19
      201000 -- (-1053.590) (-1059.266) [-1051.970] (-1053.123) * (-1050.384) [-1053.700] (-1055.403) (-1052.938) -- 0:02:19
      201500 -- [-1052.609] (-1061.159) (-1055.115) (-1055.020) * [-1055.587] (-1055.622) (-1058.252) (-1055.198) -- 0:02:18
      202000 -- (-1054.841) (-1060.463) [-1056.917] (-1056.415) * (-1053.956) (-1057.382) (-1059.059) [-1055.282] -- 0:02:18
      202500 -- [-1052.660] (-1057.383) (-1055.953) (-1063.515) * [-1057.192] (-1057.702) (-1059.230) (-1057.852) -- 0:02:17
      203000 -- (-1056.141) (-1056.062) [-1057.799] (-1054.656) * [-1052.842] (-1059.418) (-1056.711) (-1065.317) -- 0:02:17
      203500 -- (-1059.011) (-1054.182) [-1052.408] (-1053.901) * (-1056.024) (-1059.776) (-1061.700) [-1056.769] -- 0:02:16
      204000 -- (-1053.065) (-1055.697) (-1050.961) [-1056.024] * (-1057.717) [-1052.520] (-1059.765) (-1053.436) -- 0:02:16
      204500 -- (-1055.820) (-1061.574) (-1061.654) [-1059.562] * (-1057.252) [-1052.182] (-1059.514) (-1058.530) -- 0:02:16
      205000 -- (-1061.873) (-1058.918) (-1054.274) [-1056.527] * (-1054.927) [-1058.888] (-1053.239) (-1061.982) -- 0:02:15

      Average standard deviation of split frequencies: 0.000000

      205500 -- (-1057.581) [-1052.203] (-1053.401) (-1057.712) * (-1061.342) (-1057.026) [-1051.201] (-1056.906) -- 0:02:15
      206000 -- [-1063.950] (-1052.856) (-1052.586) (-1058.162) * (-1059.059) (-1048.960) [-1055.880] (-1061.715) -- 0:02:18
      206500 -- (-1059.595) (-1055.051) (-1054.434) [-1053.484] * (-1062.528) (-1052.698) [-1053.088] (-1053.548) -- 0:02:18
      207000 -- (-1056.041) (-1051.475) [-1052.381] (-1056.901) * (-1057.384) [-1050.648] (-1056.009) (-1053.737) -- 0:02:17
      207500 -- (-1054.472) (-1054.832) [-1053.717] (-1053.594) * (-1054.888) [-1053.104] (-1055.542) (-1056.960) -- 0:02:17
      208000 -- [-1051.796] (-1054.346) (-1056.104) (-1054.103) * [-1052.617] (-1051.811) (-1062.197) (-1056.321) -- 0:02:17
      208500 -- (-1058.563) [-1050.179] (-1052.995) (-1056.947) * (-1050.248) (-1054.074) (-1051.790) [-1052.063] -- 0:02:16
      209000 -- (-1055.074) (-1053.056) (-1051.843) [-1053.074] * (-1052.643) (-1056.123) [-1052.240] (-1054.245) -- 0:02:16
      209500 -- (-1054.280) (-1054.325) [-1054.219] (-1060.047) * (-1061.667) (-1059.924) (-1049.602) [-1054.548] -- 0:02:15
      210000 -- (-1055.076) [-1054.194] (-1054.781) (-1053.129) * (-1056.011) [-1060.594] (-1053.726) (-1051.483) -- 0:02:15

      Average standard deviation of split frequencies: 0.000000

      210500 -- (-1052.893) [-1059.263] (-1052.796) (-1051.984) * (-1063.076) (-1057.151) (-1057.131) [-1053.502] -- 0:02:15
      211000 -- (-1058.174) (-1057.061) [-1054.860] (-1054.592) * (-1053.862) (-1057.296) (-1063.046) [-1051.442] -- 0:02:14
      211500 -- (-1060.473) (-1053.891) [-1058.105] (-1051.661) * (-1060.632) (-1064.401) (-1053.556) [-1052.222] -- 0:02:14
      212000 -- (-1056.729) [-1053.889] (-1056.226) (-1058.372) * (-1059.469) (-1054.749) (-1051.142) [-1050.714] -- 0:02:17
      212500 -- (-1054.904) (-1058.064) (-1055.133) [-1056.601] * (-1052.934) [-1052.919] (-1052.655) (-1054.336) -- 0:02:17
      213000 -- (-1054.459) (-1056.364) [-1057.603] (-1052.698) * [-1052.858] (-1051.594) (-1051.351) (-1060.890) -- 0:02:16
      213500 -- [-1055.909] (-1055.136) (-1060.836) (-1054.957) * [-1057.699] (-1051.869) (-1054.689) (-1052.727) -- 0:02:16
      214000 -- [-1055.910] (-1060.608) (-1061.600) (-1056.850) * [-1056.099] (-1051.689) (-1056.524) (-1054.021) -- 0:02:15
      214500 -- [-1050.246] (-1058.690) (-1057.402) (-1055.516) * (-1053.636) [-1055.976] (-1054.238) (-1051.180) -- 0:02:15
      215000 -- (-1051.361) [-1058.823] (-1063.246) (-1057.117) * (-1051.333) (-1055.010) (-1056.849) [-1055.400] -- 0:02:15

      Average standard deviation of split frequencies: 0.000000

      215500 -- (-1055.708) [-1058.198] (-1056.166) (-1053.129) * (-1051.256) (-1057.259) [-1055.039] (-1054.280) -- 0:02:14
      216000 -- (-1060.708) [-1058.102] (-1053.238) (-1052.276) * (-1051.662) (-1054.802) (-1062.239) [-1059.157] -- 0:02:14
      216500 -- (-1055.082) (-1060.614) [-1054.395] (-1054.576) * [-1052.753] (-1056.089) (-1053.427) (-1063.548) -- 0:02:13
      217000 -- (-1056.709) (-1052.440) [-1063.909] (-1054.244) * (-1060.053) (-1055.055) [-1056.443] (-1055.679) -- 0:02:13
      217500 -- (-1053.059) (-1058.967) (-1061.416) [-1052.557] * [-1053.435] (-1052.272) (-1055.050) (-1055.251) -- 0:02:13
      218000 -- [-1051.855] (-1056.162) (-1058.835) (-1060.182) * (-1055.215) (-1056.180) (-1061.284) [-1052.151] -- 0:02:16
      218500 -- [-1059.582] (-1055.038) (-1062.272) (-1053.766) * (-1054.650) (-1054.919) [-1054.978] (-1053.874) -- 0:02:15
      219000 -- [-1052.511] (-1050.576) (-1059.251) (-1056.008) * [-1052.661] (-1052.712) (-1065.426) (-1053.894) -- 0:02:15
      219500 -- (-1055.885) (-1060.604) [-1056.861] (-1059.241) * [-1052.903] (-1057.667) (-1054.082) (-1057.164) -- 0:02:15
      220000 -- (-1058.672) (-1055.528) (-1057.525) [-1059.659] * (-1050.653) [-1053.563] (-1057.018) (-1056.012) -- 0:02:14

      Average standard deviation of split frequencies: 0.000000

      220500 -- (-1053.821) [-1060.319] (-1050.030) (-1065.909) * (-1051.391) [-1053.099] (-1054.929) (-1054.563) -- 0:02:14
      221000 -- (-1051.902) [-1054.993] (-1052.169) (-1052.990) * (-1051.543) (-1051.325) [-1053.405] (-1052.748) -- 0:02:13
      221500 -- (-1054.039) [-1055.238] (-1051.110) (-1055.016) * (-1057.450) [-1053.200] (-1054.186) (-1054.273) -- 0:02:13
      222000 -- (-1054.997) [-1051.099] (-1054.172) (-1052.951) * [-1053.323] (-1055.403) (-1058.279) (-1051.391) -- 0:02:13
      222500 -- [-1052.110] (-1053.643) (-1051.938) (-1056.447) * (-1054.237) (-1056.953) [-1053.913] (-1058.964) -- 0:02:12
      223000 -- (-1056.299) (-1054.617) [-1052.068] (-1060.812) * (-1056.839) (-1052.487) [-1053.090] (-1055.935) -- 0:02:12
      223500 -- [-1050.920] (-1050.477) (-1054.980) (-1057.756) * (-1065.423) (-1055.875) (-1055.587) [-1052.800] -- 0:02:12
      224000 -- [-1050.293] (-1052.426) (-1052.738) (-1056.697) * (-1069.852) [-1051.982] (-1055.294) (-1056.126) -- 0:02:15
      224500 -- (-1058.949) (-1057.169) [-1056.695] (-1061.932) * [-1053.138] (-1055.742) (-1054.994) (-1055.003) -- 0:02:14
      225000 -- (-1060.188) [-1054.397] (-1051.695) (-1052.628) * [-1054.793] (-1052.107) (-1054.110) (-1059.978) -- 0:02:14

      Average standard deviation of split frequencies: 0.000000

      225500 -- (-1056.956) (-1052.071) (-1055.558) [-1061.600] * [-1055.988] (-1054.508) (-1051.543) (-1057.795) -- 0:02:13
      226000 -- (-1057.453) (-1056.215) (-1055.112) [-1055.915] * (-1056.298) (-1054.127) (-1054.551) [-1063.014] -- 0:02:13
      226500 -- (-1054.880) (-1057.377) [-1057.980] (-1065.405) * (-1059.837) (-1061.967) [-1054.906] (-1055.947) -- 0:02:13
      227000 -- (-1054.223) (-1056.330) [-1058.765] (-1048.735) * (-1054.528) [-1057.044] (-1054.784) (-1057.350) -- 0:02:12
      227500 -- [-1050.736] (-1054.753) (-1050.504) (-1051.474) * (-1058.138) (-1055.214) [-1059.829] (-1059.377) -- 0:02:12
      228000 -- (-1050.972) [-1050.761] (-1054.505) (-1061.645) * (-1058.987) (-1063.716) [-1060.144] (-1057.026) -- 0:02:12
      228500 -- (-1053.570) (-1055.124) [-1052.306] (-1064.185) * (-1051.904) [-1054.980] (-1053.256) (-1058.222) -- 0:02:11
      229000 -- (-1055.483) [-1049.794] (-1059.140) (-1054.285) * (-1054.405) (-1053.484) (-1056.575) [-1054.830] -- 0:02:11
      229500 -- (-1059.093) (-1054.103) [-1059.416] (-1060.349) * (-1051.364) [-1053.691] (-1054.193) (-1052.957) -- 0:02:10
      230000 -- (-1058.694) (-1060.930) [-1049.753] (-1055.316) * (-1055.760) (-1059.192) [-1050.203] (-1057.367) -- 0:02:13

      Average standard deviation of split frequencies: 0.000000

      230500 -- (-1053.599) (-1053.819) [-1055.256] (-1052.505) * (-1061.789) (-1054.904) [-1059.885] (-1051.114) -- 0:02:13
      231000 -- (-1048.854) (-1055.202) [-1057.684] (-1052.870) * (-1052.482) [-1053.692] (-1059.339) (-1051.499) -- 0:02:13
      231500 -- (-1053.128) (-1056.935) [-1051.905] (-1055.926) * [-1055.430] (-1055.963) (-1054.289) (-1053.011) -- 0:02:12
      232000 -- (-1054.930) [-1051.639] (-1053.536) (-1051.659) * (-1053.797) [-1057.243] (-1054.854) (-1051.894) -- 0:02:12
      232500 -- [-1050.667] (-1054.660) (-1052.276) (-1054.857) * [-1058.605] (-1060.123) (-1050.662) (-1052.278) -- 0:02:12
      233000 -- (-1050.849) (-1056.134) [-1053.128] (-1053.613) * [-1055.045] (-1055.137) (-1049.365) (-1055.413) -- 0:02:11
      233500 -- [-1051.234] (-1051.912) (-1057.982) (-1057.449) * (-1059.231) (-1056.920) [-1051.938] (-1054.803) -- 0:02:11
      234000 -- (-1055.226) (-1057.425) [-1056.549] (-1059.783) * [-1059.989] (-1053.729) (-1053.994) (-1054.661) -- 0:02:10
      234500 -- (-1058.883) [-1049.778] (-1059.587) (-1055.243) * (-1060.232) (-1056.821) [-1055.110] (-1053.927) -- 0:02:10
      235000 -- (-1050.860) [-1050.175] (-1055.265) (-1055.867) * (-1052.535) (-1057.001) (-1054.498) [-1057.529] -- 0:02:10

      Average standard deviation of split frequencies: 0.000000

      235500 -- (-1059.223) (-1053.939) (-1059.153) [-1053.503] * (-1051.078) (-1054.404) [-1056.767] (-1058.979) -- 0:02:09
      236000 -- (-1061.779) (-1055.043) [-1054.036] (-1059.457) * (-1052.624) [-1055.130] (-1057.651) (-1059.600) -- 0:02:12
      236500 -- (-1054.751) (-1054.861) [-1057.205] (-1058.163) * (-1052.030) [-1054.651] (-1056.952) (-1063.371) -- 0:02:12
      237000 -- (-1053.360) [-1056.578] (-1056.361) (-1061.834) * (-1054.097) [-1058.033] (-1057.033) (-1054.482) -- 0:02:11
      237500 -- [-1051.969] (-1054.581) (-1053.704) (-1056.560) * (-1056.590) (-1053.671) [-1057.621] (-1058.840) -- 0:02:11
      238000 -- (-1053.924) (-1057.377) [-1055.053] (-1056.884) * [-1058.661] (-1057.657) (-1052.916) (-1057.388) -- 0:02:11
      238500 -- (-1063.919) (-1056.071) [-1054.971] (-1058.937) * (-1059.912) [-1053.132] (-1057.085) (-1057.760) -- 0:02:10
      239000 -- (-1059.101) (-1052.693) (-1055.926) [-1055.031] * (-1051.863) (-1058.614) [-1053.226] (-1060.197) -- 0:02:10
      239500 -- (-1058.976) (-1052.734) [-1051.126] (-1054.804) * (-1055.226) [-1057.429] (-1050.471) (-1064.408) -- 0:02:10
      240000 -- [-1056.406] (-1062.039) (-1052.881) (-1054.841) * (-1054.931) [-1053.186] (-1054.748) (-1052.671) -- 0:02:09

      Average standard deviation of split frequencies: 0.000000

      240500 -- (-1064.141) (-1053.616) [-1052.745] (-1057.494) * [-1051.054] (-1051.462) (-1052.487) (-1054.663) -- 0:02:09
      241000 -- (-1060.844) (-1056.757) [-1050.180] (-1059.306) * [-1051.183] (-1059.977) (-1055.079) (-1052.205) -- 0:02:09
      241500 -- [-1062.907] (-1059.062) (-1050.980) (-1058.600) * (-1050.270) (-1061.539) [-1049.379] (-1052.578) -- 0:02:08
      242000 -- (-1057.095) (-1055.716) (-1052.733) [-1058.772] * (-1052.136) (-1061.424) [-1051.094] (-1058.409) -- 0:02:11
      242500 -- (-1052.611) (-1054.171) [-1055.824] (-1057.371) * (-1054.999) [-1057.162] (-1053.504) (-1055.309) -- 0:02:11
      243000 -- [-1053.098] (-1054.740) (-1053.436) (-1057.055) * (-1054.111) [-1053.988] (-1060.614) (-1060.432) -- 0:02:10
      243500 -- (-1059.410) (-1057.025) [-1055.418] (-1059.941) * (-1056.467) (-1063.126) [-1053.664] (-1063.235) -- 0:02:10
      244000 -- (-1055.863) [-1055.499] (-1057.115) (-1052.885) * (-1060.054) (-1059.862) [-1053.000] (-1053.800) -- 0:02:10
      244500 -- (-1055.638) (-1054.103) [-1054.232] (-1066.946) * (-1054.121) (-1058.429) [-1055.637] (-1052.375) -- 0:02:09
      245000 -- [-1050.627] (-1058.362) (-1050.704) (-1060.737) * [-1054.060] (-1059.009) (-1055.126) (-1050.240) -- 0:02:09

      Average standard deviation of split frequencies: 0.000000

      245500 -- (-1048.944) (-1058.401) (-1057.999) [-1056.647] * (-1050.681) [-1060.311] (-1060.139) (-1053.313) -- 0:02:09
      246000 -- (-1055.680) (-1057.119) (-1058.229) [-1054.412] * [-1051.659] (-1062.910) (-1055.318) (-1053.948) -- 0:02:08
      246500 -- [-1055.805] (-1063.256) (-1056.189) (-1060.946) * [-1051.297] (-1057.294) (-1060.002) (-1052.227) -- 0:02:08
      247000 -- (-1058.842) [-1059.329] (-1058.161) (-1058.038) * (-1054.886) (-1057.758) (-1058.511) [-1060.323] -- 0:02:08
      247500 -- (-1050.795) (-1056.962) (-1055.123) [-1050.729] * (-1057.541) (-1053.417) (-1061.437) [-1058.084] -- 0:02:07
      248000 -- (-1055.093) (-1057.794) [-1053.204] (-1059.736) * (-1053.017) (-1054.541) (-1055.988) [-1053.653] -- 0:02:10
      248500 -- (-1056.161) [-1053.161] (-1056.998) (-1057.349) * [-1064.437] (-1057.184) (-1063.439) (-1052.030) -- 0:02:10
      249000 -- (-1054.922) [-1054.864] (-1054.458) (-1067.363) * (-1056.676) (-1053.177) (-1052.766) [-1053.610] -- 0:02:09
      249500 -- (-1051.072) (-1051.100) (-1055.996) [-1052.325] * (-1060.080) (-1056.812) [-1051.906] (-1056.945) -- 0:02:09
      250000 -- (-1051.061) [-1052.423] (-1057.328) (-1055.562) * (-1056.971) (-1051.115) (-1056.166) [-1052.739] -- 0:02:09

      Average standard deviation of split frequencies: 0.000000

      250500 -- (-1054.692) (-1053.555) [-1058.298] (-1059.621) * (-1063.567) (-1060.347) [-1056.723] (-1056.703) -- 0:02:08
      251000 -- (-1057.678) (-1058.013) [-1057.860] (-1056.874) * (-1064.488) [-1058.735] (-1057.616) (-1053.277) -- 0:02:08
      251500 -- [-1054.198] (-1061.332) (-1051.804) (-1053.921) * (-1066.364) (-1056.295) (-1053.147) [-1055.937] -- 0:02:07
      252000 -- (-1057.119) [-1053.308] (-1053.843) (-1054.559) * (-1070.411) [-1052.873] (-1053.989) (-1064.090) -- 0:02:07
      252500 -- (-1053.646) (-1055.358) [-1053.020] (-1055.133) * (-1064.682) (-1065.615) (-1054.789) [-1052.385] -- 0:02:07
      253000 -- (-1068.064) (-1055.567) (-1049.734) [-1057.172] * (-1070.300) (-1060.337) (-1052.980) [-1052.779] -- 0:02:06
      253500 -- (-1056.563) (-1056.089) [-1050.635] (-1061.311) * (-1070.487) (-1058.140) [-1054.863] (-1056.462) -- 0:02:06
      254000 -- (-1052.243) (-1055.347) [-1051.749] (-1054.222) * (-1070.030) (-1054.530) [-1058.255] (-1055.536) -- 0:02:09
      254500 -- (-1057.552) (-1053.366) (-1055.955) [-1058.510] * (-1073.629) [-1052.654] (-1056.414) (-1054.074) -- 0:02:08
      255000 -- (-1050.913) (-1059.341) (-1053.306) [-1054.376] * (-1069.652) (-1055.184) [-1053.092] (-1052.852) -- 0:02:08

      Average standard deviation of split frequencies: 0.000000

      255500 -- (-1059.479) (-1060.465) (-1055.657) [-1052.812] * (-1063.365) [-1053.333] (-1054.568) (-1053.109) -- 0:02:08
      256000 -- [-1055.099] (-1060.588) (-1051.385) (-1054.836) * (-1065.917) [-1057.846] (-1053.890) (-1057.382) -- 0:02:07
      256500 -- [-1058.172] (-1061.789) (-1054.844) (-1056.964) * (-1063.493) (-1052.524) (-1055.875) [-1053.725] -- 0:02:07
      257000 -- (-1063.714) (-1059.467) [-1055.181] (-1051.011) * (-1061.528) (-1052.660) (-1054.650) [-1050.275] -- 0:02:07
      257500 -- (-1062.773) (-1055.050) [-1053.442] (-1053.185) * (-1059.064) (-1052.852) [-1053.108] (-1051.193) -- 0:02:06
      258000 -- (-1060.304) (-1062.788) (-1055.629) [-1048.961] * (-1051.690) (-1054.166) (-1057.673) [-1053.387] -- 0:02:06
      258500 -- (-1056.753) [-1052.746] (-1056.027) (-1061.977) * (-1052.956) (-1056.658) (-1054.441) [-1056.145] -- 0:02:06
      259000 -- [-1055.333] (-1057.019) (-1062.795) (-1058.416) * (-1059.334) [-1054.243] (-1059.775) (-1055.801) -- 0:02:05
      259500 -- [-1053.737] (-1055.721) (-1062.099) (-1060.303) * [-1055.777] (-1056.917) (-1060.974) (-1055.384) -- 0:02:05
      260000 -- (-1056.144) (-1058.051) (-1066.069) [-1059.658] * (-1053.844) (-1057.238) [-1056.998] (-1057.342) -- 0:02:08

      Average standard deviation of split frequencies: 0.000000

      260500 -- (-1053.283) (-1058.575) [-1064.036] (-1057.689) * (-1052.668) [-1057.095] (-1054.394) (-1053.698) -- 0:02:07
      261000 -- (-1052.926) (-1051.668) [-1058.406] (-1057.711) * (-1058.912) (-1051.181) (-1055.005) [-1056.039] -- 0:02:07
      261500 -- (-1059.544) [-1053.615] (-1053.239) (-1054.899) * [-1053.581] (-1054.272) (-1056.020) (-1055.882) -- 0:02:07
      262000 -- [-1053.015] (-1051.618) (-1054.372) (-1056.143) * (-1052.329) (-1055.699) [-1051.844] (-1061.705) -- 0:02:06
      262500 -- (-1055.414) [-1055.435] (-1057.496) (-1062.911) * (-1054.300) (-1055.217) [-1057.359] (-1056.844) -- 0:02:06
      263000 -- [-1054.929] (-1058.514) (-1058.404) (-1059.108) * [-1056.697] (-1051.364) (-1059.226) (-1058.612) -- 0:02:06
      263500 -- (-1059.784) [-1058.292] (-1060.796) (-1057.933) * [-1061.527] (-1054.674) (-1058.920) (-1057.272) -- 0:02:05
      264000 -- [-1056.072] (-1054.486) (-1061.607) (-1059.677) * [-1057.456] (-1056.670) (-1055.812) (-1061.787) -- 0:02:05
      264500 -- [-1053.926] (-1057.835) (-1054.911) (-1058.372) * [-1056.564] (-1053.927) (-1058.961) (-1055.189) -- 0:02:05
      265000 -- [-1051.213] (-1056.214) (-1053.711) (-1061.982) * (-1057.557) (-1052.580) (-1057.068) [-1058.076] -- 0:02:04

      Average standard deviation of split frequencies: 0.000000

      265500 -- (-1060.106) (-1055.413) [-1055.126] (-1063.749) * (-1059.787) [-1054.093] (-1058.869) (-1064.793) -- 0:02:04
      266000 -- (-1052.570) (-1055.294) (-1055.583) [-1056.310] * (-1068.904) (-1059.360) [-1051.905] (-1054.812) -- 0:02:06
      266500 -- (-1055.873) [-1052.378] (-1052.332) (-1055.408) * [-1058.967] (-1054.423) (-1051.303) (-1052.224) -- 0:02:06
      267000 -- (-1052.124) (-1055.610) [-1054.538] (-1056.897) * [-1055.982] (-1054.535) (-1053.923) (-1056.371) -- 0:02:06
      267500 -- (-1051.242) [-1051.979] (-1054.806) (-1056.971) * (-1058.420) (-1057.360) (-1056.811) [-1050.213] -- 0:02:05
      268000 -- (-1064.448) (-1057.944) [-1055.542] (-1054.038) * (-1054.516) (-1056.034) (-1057.465) [-1057.134] -- 0:02:05
      268500 -- (-1056.788) (-1065.722) (-1056.828) [-1051.441] * [-1053.640] (-1060.245) (-1057.437) (-1059.139) -- 0:02:05
      269000 -- (-1061.126) (-1056.768) [-1052.811] (-1052.048) * [-1051.426] (-1054.369) (-1057.881) (-1059.989) -- 0:02:05
      269500 -- (-1068.771) (-1063.224) [-1052.312] (-1053.808) * (-1054.454) (-1057.551) [-1056.430] (-1058.479) -- 0:02:04
      270000 -- (-1055.955) [-1061.906] (-1053.354) (-1052.801) * (-1055.345) (-1052.431) (-1059.720) [-1056.176] -- 0:02:04

      Average standard deviation of split frequencies: 0.000000

      270500 -- (-1058.396) (-1061.272) (-1056.173) [-1053.065] * (-1056.313) (-1053.685) (-1055.770) [-1050.675] -- 0:02:04
      271000 -- (-1057.118) [-1051.702] (-1052.751) (-1052.064) * (-1057.093) (-1056.091) [-1057.135] (-1058.592) -- 0:02:03
      271500 -- (-1058.166) (-1057.493) [-1054.653] (-1055.511) * (-1067.268) [-1058.631] (-1056.912) (-1051.383) -- 0:02:03
      272000 -- (-1060.031) (-1059.490) [-1053.118] (-1057.463) * [-1056.808] (-1060.345) (-1053.442) (-1054.728) -- 0:02:05
      272500 -- [-1058.451] (-1053.796) (-1052.898) (-1052.071) * (-1050.836) [-1056.704] (-1053.462) (-1061.891) -- 0:02:05
      273000 -- [-1062.941] (-1059.608) (-1057.012) (-1050.982) * (-1057.707) (-1054.948) [-1052.235] (-1064.368) -- 0:02:05
      273500 -- (-1056.622) [-1060.331] (-1056.040) (-1058.779) * (-1052.222) (-1054.916) [-1052.482] (-1053.023) -- 0:02:04
      274000 -- (-1060.126) (-1060.914) (-1057.271) [-1054.636] * [-1063.137] (-1056.304) (-1057.827) (-1053.125) -- 0:02:04
      274500 -- (-1053.495) (-1053.274) [-1057.911] (-1056.081) * (-1056.841) [-1054.225] (-1055.993) (-1056.894) -- 0:02:04
      275000 -- (-1054.684) [-1055.943] (-1059.650) (-1054.551) * (-1060.839) (-1059.878) [-1054.635] (-1052.023) -- 0:02:03

      Average standard deviation of split frequencies: 0.000000

      275500 -- [-1061.493] (-1053.070) (-1062.933) (-1064.510) * (-1050.829) [-1058.947] (-1056.884) (-1055.867) -- 0:02:03
      276000 -- (-1055.270) (-1054.928) (-1062.195) [-1060.056] * [-1055.868] (-1049.488) (-1056.886) (-1060.746) -- 0:02:03
      276500 -- (-1053.994) (-1054.641) [-1057.170] (-1055.345) * [-1049.826] (-1053.169) (-1061.918) (-1064.126) -- 0:02:02
      277000 -- (-1053.979) [-1055.483] (-1062.085) (-1054.854) * [-1051.303] (-1052.143) (-1065.932) (-1054.986) -- 0:02:02
      277500 -- (-1059.108) (-1059.682) (-1057.816) [-1051.940] * [-1054.185] (-1055.294) (-1055.369) (-1052.007) -- 0:02:04
      278000 -- (-1062.173) (-1054.807) [-1054.918] (-1057.342) * (-1056.285) (-1052.814) [-1058.902] (-1053.989) -- 0:02:04
      278500 -- (-1056.694) [-1052.008] (-1053.484) (-1052.064) * (-1057.978) (-1056.944) (-1057.887) [-1054.361] -- 0:02:04
      279000 -- (-1056.508) [-1050.325] (-1056.560) (-1052.077) * (-1052.701) (-1051.470) (-1056.663) [-1051.463] -- 0:02:04
      279500 -- (-1054.294) (-1051.505) (-1056.520) [-1051.927] * (-1054.932) [-1058.280] (-1059.047) (-1056.075) -- 0:02:03
      280000 -- (-1054.528) (-1053.371) (-1050.995) [-1052.131] * [-1053.418] (-1060.312) (-1056.222) (-1050.556) -- 0:02:03

      Average standard deviation of split frequencies: 0.000000

      280500 -- (-1056.150) (-1056.265) (-1055.108) [-1051.416] * (-1057.653) (-1062.041) (-1057.501) [-1056.596] -- 0:02:03
      281000 -- (-1054.685) (-1058.627) [-1053.596] (-1055.001) * (-1053.838) (-1052.941) [-1055.244] (-1051.286) -- 0:02:02
      281500 -- (-1058.273) (-1058.065) [-1051.831] (-1056.782) * (-1052.153) (-1056.098) (-1056.370) [-1055.657] -- 0:02:02
      282000 -- [-1055.322] (-1053.270) (-1051.323) (-1054.168) * (-1060.010) [-1053.605] (-1054.608) (-1054.558) -- 0:02:02
      282500 -- (-1054.002) (-1054.167) (-1055.963) [-1053.561] * (-1058.959) [-1055.204] (-1055.020) (-1056.607) -- 0:02:01
      283000 -- [-1054.654] (-1056.304) (-1058.377) (-1050.700) * (-1054.020) [-1057.898] (-1055.220) (-1055.787) -- 0:02:01
      283500 -- (-1063.140) (-1056.415) [-1052.896] (-1054.905) * (-1055.542) (-1059.874) (-1058.769) [-1054.468] -- 0:02:03
      284000 -- (-1058.485) (-1049.816) (-1053.050) [-1050.773] * (-1057.137) (-1056.454) [-1053.579] (-1058.211) -- 0:02:03
      284500 -- (-1058.692) (-1050.372) [-1054.400] (-1051.505) * (-1055.800) (-1055.794) [-1053.741] (-1060.195) -- 0:02:03
      285000 -- (-1053.216) (-1061.277) (-1055.626) [-1056.494] * (-1050.519) (-1057.745) (-1054.537) [-1059.888] -- 0:02:02

      Average standard deviation of split frequencies: 0.000000

      285500 -- (-1058.948) (-1054.862) [-1051.113] (-1055.342) * [-1051.314] (-1053.991) (-1058.244) (-1054.137) -- 0:02:02
      286000 -- [-1057.019] (-1056.393) (-1055.171) (-1055.720) * (-1054.940) (-1056.658) [-1051.805] (-1056.238) -- 0:02:02
      286500 -- (-1051.577) [-1054.227] (-1056.789) (-1059.935) * [-1052.950] (-1056.366) (-1059.172) (-1057.462) -- 0:02:02
      287000 -- (-1052.099) (-1056.409) (-1059.463) [-1056.400] * (-1055.749) (-1052.732) (-1052.118) [-1050.753] -- 0:02:01
      287500 -- (-1053.928) [-1056.560] (-1055.823) (-1056.051) * (-1059.510) [-1053.300] (-1052.548) (-1051.811) -- 0:02:01
      288000 -- [-1051.327] (-1051.258) (-1054.532) (-1063.231) * (-1059.826) (-1052.541) [-1063.348] (-1054.285) -- 0:02:01
      288500 -- (-1053.755) [-1056.892] (-1055.263) (-1053.941) * (-1058.227) [-1055.278] (-1051.292) (-1057.739) -- 0:02:00
      289000 -- [-1055.409] (-1056.060) (-1059.705) (-1054.857) * [-1055.194] (-1056.740) (-1051.838) (-1059.575) -- 0:02:03
      289500 -- [-1053.630] (-1055.002) (-1059.058) (-1059.188) * (-1053.482) [-1051.644] (-1050.084) (-1060.691) -- 0:02:02
      290000 -- [-1054.472] (-1056.098) (-1059.377) (-1057.174) * (-1059.556) [-1056.620] (-1055.127) (-1051.931) -- 0:02:02

      Average standard deviation of split frequencies: 0.000000

      290500 -- [-1053.278] (-1052.495) (-1074.157) (-1055.950) * [-1052.248] (-1057.845) (-1056.322) (-1054.513) -- 0:02:02
      291000 -- (-1052.098) (-1053.761) (-1057.196) [-1054.846] * (-1051.426) (-1062.095) (-1053.404) [-1052.016] -- 0:02:01
      291500 -- (-1056.240) [-1055.408] (-1056.192) (-1054.592) * [-1053.436] (-1054.251) (-1061.657) (-1053.019) -- 0:02:01
      292000 -- [-1052.983] (-1053.146) (-1054.985) (-1058.053) * [-1052.535] (-1054.348) (-1055.881) (-1059.610) -- 0:02:01
      292500 -- (-1052.180) [-1051.096] (-1060.654) (-1052.440) * (-1049.333) [-1052.416] (-1061.987) (-1056.604) -- 0:02:00
      293000 -- (-1057.026) (-1055.212) (-1064.031) [-1053.614] * [-1056.449] (-1053.239) (-1056.929) (-1054.998) -- 0:02:00
      293500 -- (-1055.082) [-1055.096] (-1058.161) (-1056.216) * [-1054.192] (-1056.511) (-1052.322) (-1052.741) -- 0:02:00
      294000 -- (-1054.842) (-1052.950) [-1056.680] (-1054.511) * [-1050.546] (-1055.169) (-1053.061) (-1053.407) -- 0:02:00
      294500 -- (-1053.151) (-1054.414) (-1064.917) [-1055.642] * (-1054.442) [-1056.959] (-1053.397) (-1051.097) -- 0:01:59
      295000 -- (-1058.852) (-1054.426) (-1068.921) [-1051.968] * (-1058.123) (-1051.359) (-1054.650) [-1053.495] -- 0:02:01

      Average standard deviation of split frequencies: 0.000000

      295500 -- (-1058.842) [-1054.095] (-1061.992) (-1055.168) * (-1050.247) (-1053.961) [-1049.616] (-1055.966) -- 0:02:01
      296000 -- (-1054.402) [-1054.376] (-1055.600) (-1052.264) * (-1056.374) (-1054.563) [-1055.339] (-1051.874) -- 0:02:01
      296500 -- (-1058.105) [-1059.255] (-1061.705) (-1053.526) * [-1053.203] (-1058.425) (-1056.066) (-1052.041) -- 0:02:01
      297000 -- (-1054.985) (-1058.577) [-1057.663] (-1055.407) * (-1055.156) [-1053.882] (-1056.528) (-1051.348) -- 0:02:00
      297500 -- (-1057.939) (-1055.629) (-1060.508) [-1054.267] * [-1059.083] (-1052.146) (-1056.996) (-1053.803) -- 0:02:00
      298000 -- (-1059.062) (-1057.948) [-1055.342] (-1055.498) * (-1054.581) (-1054.364) [-1058.202] (-1052.090) -- 0:02:00
      298500 -- (-1061.611) (-1056.169) [-1053.280] (-1053.368) * (-1057.201) (-1052.969) (-1059.965) [-1051.621] -- 0:01:59
      299000 -- (-1056.613) (-1058.981) (-1054.221) [-1053.005] * (-1051.442) (-1055.989) (-1062.502) [-1053.162] -- 0:01:59
      299500 -- (-1059.547) (-1067.546) (-1053.951) [-1054.409] * (-1051.734) (-1062.915) [-1052.539] (-1054.791) -- 0:01:59
      300000 -- (-1053.106) (-1061.017) [-1051.577] (-1058.184) * (-1049.618) (-1065.528) (-1054.334) [-1052.099] -- 0:01:59

      Average standard deviation of split frequencies: 0.000000

      300500 -- (-1062.404) (-1057.477) (-1052.833) [-1058.725] * (-1053.497) (-1063.860) (-1055.889) [-1050.450] -- 0:02:01
      301000 -- [-1055.484] (-1054.174) (-1051.504) (-1054.260) * [-1054.834] (-1066.679) (-1058.646) (-1057.812) -- 0:02:00
      301500 -- (-1057.261) (-1058.043) (-1050.528) [-1051.693] * [-1051.298] (-1059.528) (-1057.909) (-1052.297) -- 0:02:00
      302000 -- (-1058.399) (-1056.838) [-1054.817] (-1062.136) * (-1058.492) (-1064.523) (-1056.737) [-1052.366] -- 0:02:00
      302500 -- (-1053.003) [-1053.700] (-1054.456) (-1055.392) * [-1053.592] (-1066.543) (-1052.672) (-1055.805) -- 0:01:59
      303000 -- [-1052.857] (-1050.259) (-1060.563) (-1051.306) * (-1052.396) (-1054.404) [-1052.420] (-1057.425) -- 0:01:59
      303500 -- (-1051.072) (-1056.226) [-1058.664] (-1052.904) * (-1049.553) [-1052.201] (-1053.874) (-1050.914) -- 0:01:59
      304000 -- (-1055.494) [-1058.176] (-1054.449) (-1053.239) * (-1053.923) (-1054.158) (-1054.949) [-1052.159] -- 0:01:59
      304500 -- (-1053.080) (-1055.871) (-1058.333) [-1055.916] * (-1051.200) (-1063.106) [-1049.629] (-1052.523) -- 0:01:58
      305000 -- (-1058.599) [-1057.421] (-1054.833) (-1062.943) * (-1053.730) (-1060.936) [-1054.249] (-1051.132) -- 0:01:58

      Average standard deviation of split frequencies: 0.000000

      305500 -- (-1059.045) [-1057.657] (-1056.110) (-1055.636) * (-1055.713) [-1058.049] (-1052.040) (-1054.343) -- 0:01:58
      306000 -- (-1060.806) (-1051.098) [-1050.469] (-1054.023) * (-1060.876) (-1052.639) [-1053.205] (-1051.737) -- 0:01:57
      306500 -- (-1055.249) [-1053.090] (-1050.511) (-1053.783) * (-1056.244) [-1051.697] (-1055.895) (-1055.946) -- 0:01:59
      307000 -- (-1052.184) (-1052.936) [-1053.332] (-1051.973) * (-1053.716) (-1056.643) (-1054.413) [-1056.642] -- 0:01:59
      307500 -- [-1051.216] (-1054.378) (-1057.044) (-1054.532) * (-1054.455) (-1052.155) [-1051.109] (-1054.205) -- 0:01:59
      308000 -- [-1055.821] (-1052.782) (-1050.672) (-1056.241) * (-1054.586) (-1057.959) (-1057.455) [-1054.463] -- 0:01:59
      308500 -- (-1053.397) (-1049.814) (-1058.509) [-1052.724] * (-1055.755) (-1051.835) [-1051.887] (-1059.634) -- 0:01:58
      309000 -- [-1055.256] (-1054.002) (-1051.337) (-1057.007) * [-1056.341] (-1055.413) (-1059.897) (-1057.397) -- 0:01:58
      309500 -- (-1064.337) (-1060.242) (-1056.727) [-1052.733] * (-1055.027) (-1051.972) [-1051.784] (-1056.385) -- 0:01:58
      310000 -- (-1056.611) [-1053.208] (-1057.376) (-1057.639) * [-1052.480] (-1051.272) (-1053.592) (-1054.242) -- 0:01:57

      Average standard deviation of split frequencies: 0.000000

      310500 -- (-1053.345) (-1053.097) (-1057.779) [-1053.604] * (-1054.850) (-1053.258) (-1062.226) [-1052.861] -- 0:01:57
      311000 -- (-1060.872) (-1055.579) [-1058.384] (-1054.069) * [-1052.086] (-1055.254) (-1061.637) (-1055.397) -- 0:01:57
      311500 -- (-1054.883) (-1056.930) [-1057.251] (-1054.337) * (-1057.921) [-1055.073] (-1064.233) (-1054.795) -- 0:01:57
      312000 -- (-1058.523) (-1056.626) (-1059.641) [-1058.460] * (-1058.201) (-1053.313) (-1067.159) [-1053.356] -- 0:01:56
      312500 -- (-1056.109) (-1051.749) [-1062.587] (-1058.268) * (-1059.508) (-1054.892) [-1060.636] (-1052.473) -- 0:01:58
      313000 -- (-1050.955) [-1053.293] (-1054.688) (-1053.846) * (-1058.210) (-1052.244) [-1057.535] (-1053.627) -- 0:01:58
      313500 -- (-1061.966) [-1057.204] (-1052.576) (-1057.955) * (-1059.246) [-1051.716] (-1059.876) (-1057.129) -- 0:01:58
      314000 -- (-1052.493) (-1053.308) [-1053.271] (-1057.268) * [-1052.393] (-1050.087) (-1059.714) (-1056.680) -- 0:01:57
      314500 -- (-1054.426) [-1051.135] (-1056.330) (-1062.452) * (-1051.346) [-1049.400] (-1063.187) (-1056.104) -- 0:01:57
      315000 -- [-1051.301] (-1057.217) (-1049.494) (-1058.018) * (-1052.502) [-1052.495] (-1060.184) (-1054.229) -- 0:01:57

      Average standard deviation of split frequencies: 0.000000

      315500 -- (-1059.809) [-1056.776] (-1056.084) (-1053.072) * (-1059.548) (-1052.603) [-1054.349] (-1055.358) -- 0:01:57
      316000 -- [-1053.551] (-1049.214) (-1062.508) (-1057.124) * (-1057.893) [-1055.309] (-1061.640) (-1058.063) -- 0:01:56
      316500 -- (-1056.904) (-1052.895) (-1056.557) [-1054.605] * [-1049.926] (-1051.672) (-1060.113) (-1064.746) -- 0:01:56
      317000 -- [-1053.820] (-1051.934) (-1054.436) (-1057.592) * (-1056.667) [-1056.267] (-1059.976) (-1050.463) -- 0:01:56
      317500 -- (-1053.415) (-1054.824) [-1057.207] (-1052.283) * (-1055.437) [-1054.623] (-1055.277) (-1053.637) -- 0:01:58
      318000 -- (-1056.983) [-1052.647] (-1053.517) (-1059.007) * (-1053.511) [-1054.396] (-1057.173) (-1056.726) -- 0:01:57
      318500 -- (-1061.064) (-1051.044) (-1057.039) [-1057.160] * (-1054.066) (-1058.558) (-1054.842) [-1055.135] -- 0:01:57
      319000 -- (-1054.132) (-1053.123) [-1059.461] (-1052.078) * [-1052.416] (-1054.309) (-1055.707) (-1052.811) -- 0:01:57
      319500 -- (-1053.569) (-1053.687) [-1060.064] (-1058.330) * [-1049.935] (-1056.713) (-1054.545) (-1057.128) -- 0:01:57
      320000 -- (-1051.902) (-1058.956) (-1065.066) [-1053.475] * (-1053.199) (-1051.072) (-1059.714) [-1055.023] -- 0:01:56

      Average standard deviation of split frequencies: 0.000000

      320500 -- (-1058.780) (-1054.975) (-1058.809) [-1050.302] * [-1051.059] (-1056.549) (-1056.614) (-1060.139) -- 0:01:56
      321000 -- (-1063.524) (-1061.838) (-1053.904) [-1053.959] * (-1057.747) (-1054.865) [-1054.689] (-1053.521) -- 0:01:56
      321500 -- [-1055.318] (-1066.706) (-1057.035) (-1058.983) * [-1048.858] (-1052.681) (-1063.245) (-1073.508) -- 0:01:56
      322000 -- (-1054.289) [-1059.243] (-1056.336) (-1058.717) * [-1050.412] (-1056.658) (-1052.393) (-1058.803) -- 0:01:55
      322500 -- (-1056.663) (-1051.178) [-1056.948] (-1059.404) * [-1052.045] (-1059.164) (-1060.753) (-1050.601) -- 0:01:55
      323000 -- (-1055.459) (-1049.655) [-1057.787] (-1061.634) * (-1060.254) [-1054.426] (-1060.513) (-1055.426) -- 0:01:57
      323500 -- (-1064.575) (-1053.435) (-1055.167) [-1057.509] * (-1060.435) (-1054.834) [-1050.630] (-1053.308) -- 0:01:57
      324000 -- (-1058.952) [-1058.394] (-1053.935) (-1055.044) * (-1056.209) (-1057.467) [-1057.978] (-1061.426) -- 0:01:56
      324500 -- (-1057.519) [-1050.038] (-1054.436) (-1052.425) * (-1053.378) [-1052.751] (-1052.096) (-1050.422) -- 0:01:56
      325000 -- (-1053.502) (-1052.175) (-1053.420) [-1052.365] * (-1053.857) (-1064.585) (-1055.145) [-1053.568] -- 0:01:56

      Average standard deviation of split frequencies: 0.000000

      325500 -- [-1053.385] (-1054.518) (-1052.968) (-1060.948) * (-1052.531) (-1061.029) [-1051.367] (-1051.373) -- 0:01:56
      326000 -- (-1055.245) (-1055.230) [-1054.467] (-1062.180) * [-1054.490] (-1059.515) (-1062.460) (-1054.272) -- 0:01:55
      326500 -- [-1053.074] (-1054.764) (-1050.655) (-1053.607) * (-1057.721) (-1060.387) (-1057.132) [-1051.145] -- 0:01:55
      327000 -- (-1056.764) [-1057.553] (-1054.438) (-1054.479) * (-1063.041) (-1050.207) (-1053.425) [-1054.834] -- 0:01:55
      327500 -- [-1051.539] (-1054.881) (-1053.329) (-1054.458) * (-1063.554) [-1050.041] (-1055.557) (-1061.765) -- 0:01:54
      328000 -- [-1057.040] (-1053.828) (-1058.024) (-1053.392) * (-1053.120) [-1051.155] (-1067.536) (-1052.746) -- 0:01:54
      328500 -- (-1052.969) [-1054.798] (-1054.287) (-1053.824) * (-1054.639) (-1057.493) [-1058.062] (-1054.415) -- 0:01:54
      329000 -- (-1054.323) (-1052.150) (-1072.034) [-1055.654] * (-1055.914) (-1057.934) [-1052.476] (-1056.102) -- 0:01:56
      329500 -- (-1058.261) (-1060.656) [-1051.179] (-1060.342) * (-1053.840) [-1056.493] (-1056.714) (-1056.934) -- 0:01:55
      330000 -- [-1058.343] (-1056.470) (-1054.780) (-1055.490) * [-1055.002] (-1056.635) (-1058.540) (-1051.171) -- 0:01:55

      Average standard deviation of split frequencies: 0.000000

      330500 -- (-1059.411) (-1058.898) [-1055.857] (-1059.555) * (-1060.400) [-1058.385] (-1055.855) (-1058.269) -- 0:01:55
      331000 -- (-1068.390) [-1051.108] (-1052.429) (-1064.290) * (-1057.023) (-1051.471) (-1054.827) [-1057.732] -- 0:01:55
      331500 -- (-1061.244) [-1054.222] (-1053.537) (-1062.434) * (-1054.564) [-1052.588] (-1059.038) (-1058.774) -- 0:01:54
      332000 -- [-1061.412] (-1059.081) (-1059.399) (-1057.451) * (-1060.076) (-1053.453) [-1051.544] (-1053.804) -- 0:01:54
      332500 -- (-1050.595) [-1054.578] (-1055.591) (-1053.493) * (-1058.125) (-1055.370) [-1052.007] (-1056.054) -- 0:01:54
      333000 -- [-1052.430] (-1058.027) (-1061.425) (-1057.556) * [-1050.974] (-1057.132) (-1051.429) (-1059.126) -- 0:01:54
      333500 -- (-1055.544) (-1056.230) [-1054.790] (-1061.795) * (-1054.952) (-1054.838) (-1055.097) [-1058.557] -- 0:01:53
      334000 -- (-1057.607) (-1057.418) (-1053.573) [-1056.902] * (-1056.487) (-1060.729) (-1054.767) [-1050.781] -- 0:01:53
      334500 -- (-1053.365) (-1060.705) [-1054.344] (-1057.945) * (-1052.586) [-1057.298] (-1055.542) (-1052.219) -- 0:01:53
      335000 -- (-1053.057) (-1059.364) (-1054.841) [-1057.192] * [-1053.368] (-1056.412) (-1053.934) (-1058.664) -- 0:01:53

      Average standard deviation of split frequencies: 0.000000

      335500 -- (-1053.689) (-1055.892) [-1052.496] (-1054.025) * (-1051.079) (-1053.135) [-1054.645] (-1054.772) -- 0:01:54
      336000 -- (-1050.237) (-1064.348) [-1053.131] (-1054.111) * [-1050.351] (-1054.217) (-1053.207) (-1056.533) -- 0:01:54
      336500 -- (-1051.327) (-1058.548) [-1054.351] (-1059.240) * [-1053.082] (-1055.227) (-1052.568) (-1055.929) -- 0:01:54
      337000 -- (-1052.184) (-1054.173) [-1049.923] (-1061.201) * (-1055.001) (-1058.469) [-1053.371] (-1056.737) -- 0:01:54
      337500 -- [-1057.253] (-1057.331) (-1055.956) (-1065.247) * (-1055.377) (-1050.550) (-1056.487) [-1056.621] -- 0:01:53
      338000 -- (-1054.861) [-1052.819] (-1058.610) (-1059.170) * (-1055.179) (-1054.539) (-1050.665) [-1054.667] -- 0:01:53
      338500 -- (-1058.713) (-1051.307) [-1053.889] (-1055.492) * (-1059.846) (-1060.104) (-1056.977) [-1058.142] -- 0:01:53
      339000 -- [-1054.309] (-1056.892) (-1056.483) (-1052.841) * [-1064.626] (-1059.751) (-1057.120) (-1057.998) -- 0:01:53
      339500 -- (-1057.693) [-1056.580] (-1060.931) (-1053.751) * (-1053.610) (-1057.079) [-1063.490] (-1053.163) -- 0:01:52
      340000 -- (-1058.734) (-1056.823) [-1055.767] (-1057.185) * (-1052.965) [-1055.229] (-1055.493) (-1051.407) -- 0:01:52

      Average standard deviation of split frequencies: 0.000000

      340500 -- (-1055.557) (-1056.347) [-1055.014] (-1058.774) * (-1054.620) (-1059.679) [-1051.304] (-1053.304) -- 0:01:52
      341000 -- [-1053.885] (-1052.608) (-1059.183) (-1056.295) * (-1057.227) [-1055.597] (-1054.061) (-1060.612) -- 0:01:52
      341500 -- [-1052.635] (-1057.326) (-1052.952) (-1057.698) * [-1056.752] (-1057.013) (-1058.925) (-1056.756) -- 0:01:53
      342000 -- (-1051.051) [-1055.139] (-1054.198) (-1060.854) * [-1051.858] (-1053.809) (-1060.798) (-1061.186) -- 0:01:53
      342500 -- (-1055.654) (-1054.182) (-1060.880) [-1061.518] * (-1055.536) [-1049.350] (-1057.698) (-1056.874) -- 0:01:53
      343000 -- (-1054.031) (-1051.305) (-1058.215) [-1055.479] * (-1062.342) (-1057.073) (-1061.437) [-1061.765] -- 0:01:53
      343500 -- (-1058.538) (-1056.355) (-1051.070) [-1056.074] * (-1059.867) [-1055.789] (-1057.799) (-1060.031) -- 0:01:52
      344000 -- (-1054.008) (-1055.859) (-1058.505) [-1052.559] * [-1060.046] (-1059.748) (-1060.143) (-1051.867) -- 0:01:52
      344500 -- (-1057.903) (-1051.067) (-1052.960) [-1051.760] * [-1056.838] (-1056.144) (-1056.521) (-1057.556) -- 0:01:52
      345000 -- [-1052.824] (-1057.884) (-1053.054) (-1054.207) * (-1051.847) (-1056.734) (-1054.109) [-1054.440] -- 0:01:52

      Average standard deviation of split frequencies: 0.000000

      345500 -- (-1055.011) (-1055.894) (-1058.653) [-1054.422] * (-1048.249) (-1062.003) [-1052.588] (-1061.400) -- 0:01:51
      346000 -- (-1052.541) (-1059.081) [-1049.431] (-1056.760) * (-1049.441) (-1054.571) [-1055.232] (-1056.148) -- 0:01:51
      346500 -- (-1057.095) (-1053.622) (-1048.562) [-1055.157] * (-1050.782) (-1056.474) [-1054.765] (-1051.314) -- 0:01:51
      347000 -- (-1055.059) (-1062.238) (-1061.353) [-1053.179] * (-1053.205) (-1055.829) (-1059.640) [-1053.320] -- 0:01:51
      347500 -- (-1051.370) [-1055.354] (-1057.160) (-1055.077) * (-1056.224) [-1053.069] (-1053.210) (-1063.458) -- 0:01:52
      348000 -- (-1050.836) [-1054.425] (-1060.542) (-1053.219) * [-1050.984] (-1050.740) (-1055.928) (-1057.743) -- 0:01:52
      348500 -- (-1053.729) [-1057.708] (-1053.412) (-1053.075) * [-1053.507] (-1065.763) (-1061.516) (-1058.932) -- 0:01:52
      349000 -- (-1051.252) (-1061.417) [-1054.926] (-1056.339) * (-1052.980) (-1052.349) [-1054.735] (-1060.115) -- 0:01:51
      349500 -- (-1067.933) (-1055.054) (-1058.839) [-1050.943] * [-1053.616] (-1058.367) (-1052.985) (-1057.972) -- 0:01:51
      350000 -- (-1053.281) [-1049.300] (-1066.947) (-1057.606) * (-1051.049) [-1053.206] (-1061.394) (-1054.032) -- 0:01:51

      Average standard deviation of split frequencies: 0.000000

      350500 -- (-1057.196) (-1054.567) (-1054.641) [-1050.398] * (-1051.411) (-1054.838) [-1055.207] (-1057.031) -- 0:01:51
      351000 -- [-1058.789] (-1059.337) (-1058.058) (-1050.517) * (-1060.681) (-1057.259) [-1055.763] (-1054.982) -- 0:01:50
      351500 -- (-1052.819) [-1052.213] (-1058.886) (-1056.539) * (-1055.102) (-1055.634) [-1054.726] (-1054.699) -- 0:01:50
      352000 -- [-1051.624] (-1053.862) (-1055.841) (-1055.323) * [-1052.445] (-1053.735) (-1056.110) (-1056.773) -- 0:01:50
      352500 -- (-1055.732) (-1059.638) [-1058.350] (-1052.715) * (-1055.290) (-1050.845) (-1056.249) [-1055.847] -- 0:01:50
      353000 -- (-1056.429) [-1054.915] (-1061.514) (-1054.161) * (-1054.955) [-1054.344] (-1052.624) (-1056.149) -- 0:01:49
      353500 -- [-1053.220] (-1056.649) (-1061.137) (-1058.193) * (-1053.682) (-1060.016) [-1052.096] (-1063.000) -- 0:01:51
      354000 -- (-1060.790) [-1061.113] (-1059.824) (-1056.684) * (-1053.784) (-1063.956) [-1050.196] (-1056.384) -- 0:01:51
      354500 -- (-1054.518) (-1056.489) [-1053.109] (-1054.584) * (-1056.339) [-1055.249] (-1055.842) (-1058.303) -- 0:01:51
      355000 -- (-1053.909) (-1054.853) [-1052.781] (-1058.265) * (-1055.476) (-1052.542) (-1055.913) [-1057.088] -- 0:01:50

      Average standard deviation of split frequencies: 0.000000

      355500 -- (-1055.063) (-1055.681) [-1052.598] (-1065.268) * (-1055.596) (-1053.116) (-1051.024) [-1054.966] -- 0:01:50
      356000 -- (-1056.959) (-1059.764) (-1051.000) [-1052.823] * (-1059.855) (-1051.121) (-1058.460) [-1054.018] -- 0:01:50
      356500 -- (-1056.585) (-1059.229) (-1056.912) [-1053.753] * [-1054.540] (-1053.866) (-1057.453) (-1058.628) -- 0:01:50
      357000 -- (-1055.271) (-1058.565) [-1053.224] (-1059.358) * (-1062.758) [-1051.548] (-1061.053) (-1052.393) -- 0:01:49
      357500 -- (-1059.529) (-1053.690) [-1051.953] (-1051.837) * (-1053.740) (-1054.331) [-1057.508] (-1054.000) -- 0:01:49
      358000 -- (-1061.996) (-1051.990) (-1054.268) [-1055.285] * (-1053.188) [-1052.566] (-1056.711) (-1053.864) -- 0:01:49
      358500 -- (-1057.669) [-1050.476] (-1057.429) (-1053.582) * (-1057.967) (-1059.303) (-1051.329) [-1058.904] -- 0:01:49
      359000 -- [-1059.147] (-1055.845) (-1056.727) (-1053.048) * (-1063.787) [-1053.852] (-1061.369) (-1058.798) -- 0:01:48
      359500 -- [-1060.770] (-1061.670) (-1054.214) (-1056.945) * (-1056.476) [-1049.371] (-1054.205) (-1065.497) -- 0:01:48
      360000 -- (-1058.067) [-1054.110] (-1054.739) (-1056.585) * [-1058.065] (-1056.067) (-1051.681) (-1050.830) -- 0:01:50

      Average standard deviation of split frequencies: 0.000000

      360500 -- [-1054.636] (-1061.032) (-1058.811) (-1058.302) * (-1054.897) (-1056.598) (-1056.313) [-1054.434] -- 0:01:49
      361000 -- (-1054.569) (-1056.075) (-1060.294) [-1058.291] * (-1053.426) (-1054.514) [-1050.593] (-1058.635) -- 0:01:49
      361500 -- (-1064.203) (-1051.906) [-1058.361] (-1056.763) * (-1055.648) (-1060.450) [-1052.583] (-1057.163) -- 0:01:49
      362000 -- (-1065.690) (-1054.180) [-1060.369] (-1057.698) * (-1053.618) [-1054.293] (-1066.343) (-1051.232) -- 0:01:49
      362500 -- (-1058.883) (-1054.754) (-1065.225) [-1060.032] * (-1059.235) (-1051.794) [-1056.096] (-1058.435) -- 0:01:49
      363000 -- (-1054.998) (-1051.710) (-1056.826) [-1053.375] * (-1053.612) [-1053.662] (-1053.189) (-1061.343) -- 0:01:48
      363500 -- (-1055.465) (-1058.595) [-1058.011] (-1056.974) * (-1054.260) [-1054.655] (-1053.241) (-1055.510) -- 0:01:48
      364000 -- [-1053.123] (-1061.380) (-1060.862) (-1060.208) * (-1053.773) (-1054.160) [-1052.483] (-1059.369) -- 0:01:48
      364500 -- [-1058.461] (-1061.733) (-1060.152) (-1059.194) * (-1052.634) (-1056.188) (-1056.387) [-1055.706] -- 0:01:48
      365000 -- [-1054.437] (-1054.584) (-1056.251) (-1056.048) * (-1053.309) (-1056.583) [-1051.530] (-1053.746) -- 0:01:47

      Average standard deviation of split frequencies: 0.000000

      365500 -- [-1056.117] (-1059.499) (-1053.842) (-1053.284) * [-1055.366] (-1059.891) (-1052.224) (-1061.953) -- 0:01:47
      366000 -- [-1053.906] (-1056.037) (-1052.454) (-1054.313) * (-1057.729) [-1052.152] (-1061.016) (-1053.974) -- 0:01:49
      366500 -- (-1052.382) [-1056.655] (-1057.149) (-1057.128) * [-1053.063] (-1051.860) (-1054.822) (-1051.257) -- 0:01:48
      367000 -- (-1059.145) (-1051.982) [-1059.827] (-1050.722) * (-1051.161) (-1051.756) [-1050.522] (-1058.593) -- 0:01:48
      367500 -- [-1055.752] (-1058.939) (-1052.879) (-1055.044) * (-1055.649) (-1056.651) [-1052.724] (-1055.150) -- 0:01:48
      368000 -- (-1055.364) (-1053.263) [-1055.714] (-1056.145) * (-1056.368) [-1058.698] (-1054.950) (-1056.904) -- 0:01:48
      368500 -- [-1052.718] (-1053.937) (-1064.705) (-1067.840) * (-1055.215) (-1057.699) [-1053.149] (-1058.293) -- 0:01:47
      369000 -- [-1056.745] (-1053.520) (-1058.589) (-1063.753) * (-1058.057) [-1055.340] (-1056.864) (-1060.922) -- 0:01:47
      369500 -- (-1059.501) (-1056.069) [-1055.732] (-1060.839) * (-1057.136) [-1052.637] (-1057.110) (-1060.008) -- 0:01:47
      370000 -- (-1064.667) [-1054.110] (-1056.722) (-1067.304) * (-1055.056) (-1053.107) (-1059.084) [-1055.590] -- 0:01:47

      Average standard deviation of split frequencies: 0.000000

      370500 -- (-1059.685) (-1053.266) [-1049.127] (-1055.361) * [-1052.696] (-1055.928) (-1055.742) (-1059.066) -- 0:01:47
      371000 -- (-1054.673) (-1054.433) (-1057.868) [-1054.925] * (-1054.966) (-1050.217) [-1054.597] (-1058.876) -- 0:01:46
      371500 -- (-1057.515) [-1056.800] (-1057.916) (-1057.455) * [-1049.477] (-1063.114) (-1059.454) (-1059.632) -- 0:01:46
      372000 -- (-1052.781) (-1055.835) (-1050.906) [-1051.207] * (-1052.313) [-1053.879] (-1068.489) (-1058.446) -- 0:01:46
      372500 -- (-1052.399) (-1055.858) (-1054.132) [-1052.844] * [-1053.039] (-1058.260) (-1061.685) (-1053.878) -- 0:01:47
      373000 -- (-1049.881) [-1053.092] (-1049.884) (-1055.565) * (-1051.733) [-1056.331] (-1052.540) (-1063.998) -- 0:01:47
      373500 -- (-1054.591) (-1054.170) [-1054.781] (-1057.275) * [-1058.502] (-1049.372) (-1052.196) (-1059.737) -- 0:01:47
      374000 -- [-1054.987] (-1051.949) (-1056.662) (-1066.133) * (-1053.296) (-1053.669) (-1053.695) [-1057.216] -- 0:01:47
      374500 -- (-1060.265) [-1054.318] (-1053.940) (-1054.526) * [-1062.266] (-1061.745) (-1056.830) (-1060.200) -- 0:01:46
      375000 -- (-1053.005) (-1053.274) [-1055.863] (-1063.350) * (-1057.962) (-1054.312) [-1052.132] (-1057.245) -- 0:01:46

      Average standard deviation of split frequencies: 0.000000

      375500 -- [-1049.670] (-1061.667) (-1056.828) (-1054.884) * [-1053.486] (-1053.074) (-1056.337) (-1052.640) -- 0:01:46
      376000 -- [-1052.649] (-1056.960) (-1055.936) (-1053.958) * [-1056.636] (-1056.201) (-1057.644) (-1059.542) -- 0:01:46
      376500 -- (-1053.561) (-1059.760) [-1050.275] (-1053.190) * (-1060.080) (-1061.712) (-1059.016) [-1054.376] -- 0:01:45
      377000 -- (-1053.311) (-1056.722) (-1051.267) [-1055.762] * (-1056.785) (-1054.220) [-1052.905] (-1053.329) -- 0:01:45
      377500 -- [-1052.569] (-1056.938) (-1053.656) (-1056.875) * (-1055.263) (-1056.851) [-1054.599] (-1055.705) -- 0:01:45
      378000 -- (-1059.546) [-1059.552] (-1058.135) (-1049.743) * (-1063.367) (-1052.722) [-1053.523] (-1055.467) -- 0:01:45
      378500 -- (-1053.813) (-1052.984) (-1059.381) [-1056.046] * (-1052.984) (-1053.055) (-1050.681) [-1050.630] -- 0:01:46
      379000 -- (-1056.188) (-1057.880) [-1055.714] (-1062.520) * (-1063.410) [-1058.849] (-1049.820) (-1063.586) -- 0:01:46
      379500 -- [-1055.937] (-1049.947) (-1053.314) (-1054.189) * (-1057.821) (-1058.115) (-1055.563) [-1058.143] -- 0:01:46
      380000 -- (-1063.918) (-1057.698) (-1053.798) [-1064.144] * (-1057.963) [-1066.323] (-1055.109) (-1054.186) -- 0:01:46

      Average standard deviation of split frequencies: 0.000000

      380500 -- (-1055.767) [-1056.680] (-1057.944) (-1059.226) * (-1057.713) [-1061.253] (-1051.499) (-1053.186) -- 0:01:45
      381000 -- [-1052.712] (-1058.722) (-1051.899) (-1066.248) * (-1054.743) (-1057.444) (-1059.245) [-1053.013] -- 0:01:45
      381500 -- (-1055.979) [-1051.284] (-1060.917) (-1060.292) * (-1052.247) [-1062.854] (-1061.605) (-1053.302) -- 0:01:45
      382000 -- (-1055.557) (-1053.338) (-1051.157) [-1056.423] * (-1052.459) (-1056.378) (-1055.594) [-1051.824] -- 0:01:45
      382500 -- [-1054.561] (-1062.414) (-1053.310) (-1055.336) * (-1054.689) (-1058.428) (-1058.735) [-1049.926] -- 0:01:44
      383000 -- (-1054.254) (-1054.211) [-1053.559] (-1056.869) * [-1051.331] (-1060.198) (-1056.783) (-1056.607) -- 0:01:44
      383500 -- (-1061.383) (-1056.089) [-1054.287] (-1063.969) * (-1053.258) (-1057.313) (-1054.321) [-1056.962] -- 0:01:44
      384000 -- (-1055.590) (-1062.586) [-1055.761] (-1052.823) * [-1058.340] (-1052.899) (-1052.795) (-1055.992) -- 0:01:44
      384500 -- (-1066.762) [-1058.090] (-1056.111) (-1048.700) * (-1049.868) (-1055.930) (-1065.423) [-1052.662] -- 0:01:45
      385000 -- (-1051.844) (-1057.311) [-1056.120] (-1052.641) * [-1051.803] (-1056.256) (-1055.745) (-1052.599) -- 0:01:45

      Average standard deviation of split frequencies: 0.000000

      385500 -- (-1056.148) (-1059.218) [-1060.626] (-1055.141) * (-1058.079) (-1057.126) (-1057.393) [-1057.503] -- 0:01:45
      386000 -- (-1054.201) (-1056.004) (-1054.625) [-1053.541] * (-1058.804) (-1055.738) [-1055.115] (-1057.228) -- 0:01:44
      386500 -- (-1054.163) (-1052.189) [-1056.997] (-1065.803) * (-1056.726) (-1050.085) [-1058.818] (-1055.339) -- 0:01:44
      387000 -- (-1051.810) [-1055.188] (-1053.539) (-1056.135) * [-1052.153] (-1057.861) (-1058.949) (-1057.552) -- 0:01:44
      387500 -- (-1054.074) [-1055.858] (-1059.196) (-1062.678) * (-1056.538) (-1057.440) (-1061.696) [-1055.120] -- 0:01:44
      388000 -- (-1057.574) (-1063.660) (-1058.581) [-1063.637] * [-1055.230] (-1053.689) (-1060.769) (-1059.929) -- 0:01:44
      388500 -- [-1057.352] (-1060.062) (-1062.196) (-1064.109) * (-1057.059) (-1054.848) (-1059.726) [-1054.392] -- 0:01:43
      389000 -- [-1056.985] (-1060.131) (-1056.829) (-1058.624) * (-1048.925) [-1053.883] (-1065.631) (-1054.395) -- 0:01:43
      389500 -- (-1058.216) (-1063.892) [-1054.469] (-1055.514) * (-1051.624) (-1061.897) (-1057.966) [-1055.974] -- 0:01:43
      390000 -- (-1050.487) (-1061.759) [-1055.385] (-1055.678) * (-1054.850) (-1061.171) [-1056.897] (-1055.573) -- 0:01:43

      Average standard deviation of split frequencies: 0.000000

      390500 -- (-1065.276) (-1064.227) [-1052.602] (-1056.204) * (-1061.009) (-1056.804) (-1060.440) [-1057.490] -- 0:01:43
      391000 -- [-1050.393] (-1060.019) (-1052.161) (-1054.940) * (-1058.636) [-1054.388] (-1057.085) (-1055.051) -- 0:01:44
      391500 -- (-1060.833) (-1059.691) [-1057.589] (-1060.444) * (-1052.661) (-1052.587) [-1057.009] (-1053.666) -- 0:01:44
      392000 -- (-1067.275) [-1056.255] (-1054.479) (-1061.704) * (-1051.974) [-1063.792] (-1064.703) (-1053.756) -- 0:01:43
      392500 -- [-1057.166] (-1052.856) (-1058.498) (-1057.634) * [-1056.324] (-1058.175) (-1057.545) (-1053.347) -- 0:01:43
      393000 -- (-1058.004) (-1058.856) (-1055.111) [-1059.068] * (-1058.848) (-1065.494) (-1065.792) [-1053.442] -- 0:01:43
      393500 -- [-1054.267] (-1056.327) (-1055.018) (-1058.161) * (-1060.186) (-1059.313) (-1054.464) [-1053.823] -- 0:01:43
      394000 -- (-1054.801) [-1053.505] (-1051.682) (-1054.813) * (-1058.147) (-1065.760) [-1053.950] (-1053.447) -- 0:01:43
      394500 -- (-1054.676) (-1053.736) [-1059.554] (-1055.635) * (-1055.878) [-1052.869] (-1062.545) (-1054.289) -- 0:01:42
      395000 -- (-1052.472) (-1054.645) (-1057.585) [-1059.519] * [-1054.945] (-1058.406) (-1059.195) (-1061.927) -- 0:01:42

      Average standard deviation of split frequencies: 0.000000

      395500 -- (-1051.645) [-1058.676] (-1054.064) (-1056.296) * [-1053.230] (-1051.167) (-1060.759) (-1057.837) -- 0:01:42
      396000 -- (-1053.703) (-1055.682) [-1052.921] (-1056.009) * (-1058.390) (-1052.763) [-1054.230] (-1056.687) -- 0:01:42
      396500 -- (-1056.307) [-1051.874] (-1059.902) (-1064.779) * (-1060.487) [-1054.038] (-1057.620) (-1058.975) -- 0:01:41
      397000 -- [-1056.652] (-1056.363) (-1057.637) (-1061.736) * (-1051.927) [-1055.467] (-1052.323) (-1052.090) -- 0:01:43
      397500 -- (-1054.929) (-1055.410) [-1053.868] (-1053.711) * (-1053.979) [-1051.506] (-1055.750) (-1056.273) -- 0:01:43
      398000 -- [-1052.822] (-1058.586) (-1052.757) (-1056.332) * [-1052.055] (-1054.502) (-1055.973) (-1055.884) -- 0:01:42
      398500 -- (-1056.794) [-1049.142] (-1062.366) (-1057.058) * [-1057.547] (-1058.546) (-1062.818) (-1056.462) -- 0:01:42
      399000 -- [-1054.983] (-1055.361) (-1057.091) (-1053.152) * (-1057.388) (-1056.037) [-1052.798] (-1057.769) -- 0:01:42
      399500 -- (-1062.925) (-1054.699) [-1056.313] (-1054.261) * [-1054.179] (-1051.033) (-1053.703) (-1061.667) -- 0:01:42
      400000 -- (-1058.778) (-1054.279) (-1053.196) [-1051.632] * [-1051.474] (-1054.952) (-1051.639) (-1054.849) -- 0:01:42

      Average standard deviation of split frequencies: 0.000000

      400500 -- (-1053.509) [-1058.585] (-1055.261) (-1053.332) * (-1054.837) [-1049.022] (-1056.270) (-1056.437) -- 0:01:41
      401000 -- [-1052.157] (-1056.667) (-1058.184) (-1051.015) * (-1059.175) [-1049.837] (-1054.202) (-1056.451) -- 0:01:41
      401500 -- (-1052.118) (-1059.319) [-1055.992] (-1052.830) * (-1058.959) (-1049.440) (-1056.702) [-1054.066] -- 0:01:41
      402000 -- (-1064.376) [-1054.586] (-1057.508) (-1054.834) * (-1055.926) (-1055.010) (-1054.283) [-1055.961] -- 0:01:41
      402500 -- (-1063.061) (-1054.448) [-1063.432] (-1058.787) * (-1057.977) [-1056.052] (-1052.044) (-1055.078) -- 0:01:40
      403000 -- (-1062.670) [-1050.601] (-1071.713) (-1054.624) * (-1058.158) [-1054.744] (-1057.090) (-1056.646) -- 0:01:40
      403500 -- [-1054.382] (-1061.975) (-1060.490) (-1071.117) * (-1059.450) (-1056.764) (-1055.139) [-1050.052] -- 0:01:42
      404000 -- (-1054.283) (-1056.497) (-1057.569) [-1055.509] * [-1054.651] (-1058.846) (-1051.856) (-1053.684) -- 0:01:41
      404500 -- (-1052.888) [-1051.795] (-1058.530) (-1053.837) * (-1055.876) (-1063.314) [-1054.443] (-1049.536) -- 0:01:41
      405000 -- (-1055.142) (-1055.741) (-1053.777) [-1063.435] * (-1060.918) (-1056.845) [-1053.188] (-1051.890) -- 0:01:41

      Average standard deviation of split frequencies: 0.000000

      405500 -- (-1055.171) (-1057.660) [-1051.451] (-1061.671) * (-1059.252) [-1056.354] (-1057.873) (-1057.209) -- 0:01:41
      406000 -- (-1054.427) [-1057.333] (-1055.579) (-1059.269) * (-1063.635) (-1057.596) [-1058.342] (-1058.756) -- 0:01:40
      406500 -- (-1053.712) (-1066.696) (-1056.168) [-1057.573] * (-1059.950) (-1062.999) [-1055.952] (-1052.597) -- 0:01:40
      407000 -- [-1051.633] (-1064.574) (-1057.637) (-1054.361) * (-1055.774) [-1059.906] (-1054.831) (-1051.949) -- 0:01:40
      407500 -- (-1050.850) (-1062.461) (-1059.922) [-1051.306] * (-1055.531) [-1054.046] (-1054.228) (-1055.485) -- 0:01:40
      408000 -- (-1057.003) [-1060.858] (-1055.585) (-1053.437) * (-1051.734) (-1053.144) (-1055.990) [-1053.707] -- 0:01:40
      408500 -- (-1053.717) (-1059.298) [-1051.528] (-1055.792) * (-1050.674) [-1053.887] (-1059.525) (-1056.949) -- 0:01:39
      409000 -- (-1053.351) (-1059.356) [-1049.739] (-1057.404) * (-1059.629) [-1056.491] (-1058.738) (-1061.855) -- 0:01:39
      409500 -- [-1052.268] (-1052.699) (-1053.536) (-1058.960) * (-1052.696) (-1055.024) (-1063.290) [-1052.616] -- 0:01:40
      410000 -- (-1058.659) [-1053.358] (-1053.370) (-1052.391) * [-1052.643] (-1060.518) (-1054.531) (-1056.601) -- 0:01:40

      Average standard deviation of split frequencies: 0.000000

      410500 -- [-1053.727] (-1051.795) (-1053.397) (-1050.349) * [-1052.877] (-1056.953) (-1054.722) (-1053.020) -- 0:01:40
      411000 -- (-1055.061) [-1053.556] (-1058.983) (-1052.542) * (-1054.556) [-1052.099] (-1057.738) (-1054.287) -- 0:01:40
      411500 -- [-1056.636] (-1057.799) (-1051.153) (-1055.157) * (-1055.778) (-1056.442) [-1051.884] (-1055.829) -- 0:01:40
      412000 -- (-1058.407) (-1053.952) [-1052.840] (-1054.418) * (-1052.565) [-1054.747] (-1060.650) (-1056.876) -- 0:01:39
      412500 -- [-1055.730] (-1058.650) (-1059.792) (-1054.079) * [-1053.150] (-1059.637) (-1057.324) (-1053.446) -- 0:01:39
      413000 -- (-1055.904) (-1059.501) [-1051.984] (-1058.378) * (-1060.108) (-1052.478) [-1050.703] (-1059.295) -- 0:01:39
      413500 -- (-1052.631) (-1055.917) (-1058.266) [-1056.299] * (-1051.941) [-1059.671] (-1055.491) (-1051.025) -- 0:01:39
      414000 -- (-1057.847) [-1049.549] (-1054.256) (-1054.713) * (-1052.793) (-1058.867) [-1053.765] (-1055.775) -- 0:01:39
      414500 -- (-1058.774) (-1056.341) (-1058.265) [-1056.300] * (-1053.725) (-1056.002) [-1052.256] (-1049.680) -- 0:01:38
      415000 -- (-1055.428) (-1056.940) (-1060.045) [-1053.517] * (-1059.400) [-1054.053] (-1053.234) (-1060.493) -- 0:01:38

      Average standard deviation of split frequencies: 0.000000

      415500 -- (-1055.378) (-1053.506) (-1058.640) [-1055.500] * (-1055.662) [-1061.385] (-1053.261) (-1053.700) -- 0:01:39
      416000 -- (-1055.255) (-1055.708) (-1054.644) [-1055.473] * [-1053.127] (-1061.782) (-1053.218) (-1056.861) -- 0:01:39
      416500 -- (-1062.417) (-1056.244) [-1056.523] (-1051.328) * (-1060.571) (-1059.882) [-1055.572] (-1055.363) -- 0:01:39
      417000 -- [-1057.577] (-1052.336) (-1055.350) (-1057.443) * [-1049.227] (-1059.245) (-1055.624) (-1055.204) -- 0:01:39
      417500 -- [-1054.088] (-1054.611) (-1051.270) (-1053.007) * (-1063.732) (-1055.220) (-1052.235) [-1054.681] -- 0:01:39
      418000 -- (-1055.062) (-1056.410) [-1052.496] (-1056.811) * (-1056.985) (-1052.003) [-1055.343] (-1060.036) -- 0:01:38
      418500 -- [-1052.074] (-1054.747) (-1053.581) (-1057.986) * [-1057.945] (-1055.158) (-1060.844) (-1057.359) -- 0:01:38
      419000 -- (-1052.285) (-1056.188) [-1052.191] (-1054.921) * (-1058.864) [-1051.965] (-1059.093) (-1053.710) -- 0:01:38
      419500 -- (-1052.828) [-1056.991] (-1061.047) (-1056.953) * [-1054.576] (-1055.284) (-1057.262) (-1053.956) -- 0:01:38
      420000 -- (-1052.807) (-1055.675) (-1054.584) [-1050.476] * [-1060.631] (-1055.312) (-1053.650) (-1056.749) -- 0:01:38

      Average standard deviation of split frequencies: 0.000000

      420500 -- (-1052.537) [-1052.336] (-1052.616) (-1054.917) * (-1055.792) (-1049.228) [-1056.233] (-1055.281) -- 0:01:37
      421000 -- (-1061.403) [-1054.686] (-1055.507) (-1054.582) * (-1060.337) [-1055.243] (-1061.899) (-1057.797) -- 0:01:37
      421500 -- (-1053.812) (-1057.468) (-1056.541) [-1053.751] * (-1056.529) [-1052.341] (-1058.441) (-1058.432) -- 0:01:37
      422000 -- (-1057.190) (-1056.446) (-1053.484) [-1051.965] * (-1059.594) [-1055.374] (-1055.766) (-1052.033) -- 0:01:38
      422500 -- (-1052.727) [-1056.329] (-1054.966) (-1056.361) * [-1057.134] (-1055.731) (-1055.372) (-1055.873) -- 0:01:38
      423000 -- (-1053.742) (-1051.797) (-1054.071) [-1054.832] * [-1052.962] (-1061.787) (-1059.515) (-1053.735) -- 0:01:38
      423500 -- (-1059.276) [-1057.091] (-1056.363) (-1052.864) * (-1060.568) (-1052.908) [-1056.771] (-1055.202) -- 0:01:38
      424000 -- [-1054.534] (-1057.356) (-1064.683) (-1055.928) * (-1057.481) (-1056.021) (-1054.638) [-1058.431] -- 0:01:37
      424500 -- [-1053.967] (-1061.663) (-1055.285) (-1058.229) * (-1057.245) (-1048.499) [-1053.994] (-1058.139) -- 0:01:37
      425000 -- (-1059.236) (-1054.211) (-1055.188) [-1054.563] * (-1056.242) (-1054.889) (-1057.945) [-1052.761] -- 0:01:37

      Average standard deviation of split frequencies: 0.000000

      425500 -- (-1055.862) (-1051.437) (-1053.237) [-1055.098] * (-1057.769) (-1051.292) [-1050.935] (-1054.601) -- 0:01:37
      426000 -- [-1051.251] (-1055.945) (-1052.086) (-1059.866) * [-1055.608] (-1058.153) (-1053.810) (-1061.111) -- 0:01:37
      426500 -- [-1053.747] (-1056.011) (-1052.596) (-1062.559) * (-1060.398) [-1059.102] (-1049.653) (-1057.333) -- 0:01:36
      427000 -- (-1053.510) (-1055.584) [-1054.503] (-1059.382) * (-1057.531) (-1057.503) (-1052.721) [-1051.430] -- 0:01:36
      427500 -- (-1057.190) [-1051.095] (-1052.745) (-1051.160) * (-1055.226) (-1053.043) (-1058.518) [-1054.468] -- 0:01:36
      428000 -- (-1060.960) (-1058.161) (-1051.750) [-1055.865] * (-1050.528) (-1055.370) [-1051.332] (-1055.790) -- 0:01:37
      428500 -- (-1060.348) (-1056.373) [-1052.884] (-1053.833) * (-1055.173) [-1054.650] (-1052.893) (-1054.814) -- 0:01:37
      429000 -- (-1064.155) (-1054.309) (-1051.617) [-1053.516] * [-1053.638] (-1057.910) (-1057.009) (-1057.834) -- 0:01:37
      429500 -- (-1059.702) (-1057.359) (-1053.951) [-1054.413] * (-1052.912) (-1064.420) (-1052.741) [-1052.813] -- 0:01:36
      430000 -- (-1055.937) (-1055.649) [-1053.795] (-1053.205) * (-1050.065) (-1066.510) (-1059.360) [-1051.229] -- 0:01:36

      Average standard deviation of split frequencies: 0.000000

      430500 -- (-1054.253) (-1060.969) [-1053.363] (-1052.546) * [-1052.124] (-1059.254) (-1054.664) (-1059.858) -- 0:01:36
      431000 -- [-1055.062] (-1054.591) (-1051.483) (-1055.916) * (-1053.525) (-1062.742) [-1051.768] (-1052.127) -- 0:01:36
      431500 -- [-1051.671] (-1054.891) (-1051.571) (-1052.798) * [-1050.902] (-1060.148) (-1060.273) (-1050.894) -- 0:01:36
      432000 -- (-1049.414) (-1053.529) (-1056.379) [-1051.416] * (-1053.034) (-1057.915) (-1064.521) [-1052.011] -- 0:01:35
      432500 -- (-1058.751) (-1050.032) (-1053.346) [-1053.511] * (-1052.487) [-1054.484] (-1062.308) (-1051.190) -- 0:01:35
      433000 -- (-1063.031) [-1052.687] (-1054.387) (-1051.772) * [-1052.586] (-1053.317) (-1066.340) (-1052.975) -- 0:01:35
      433500 -- (-1054.825) [-1050.543] (-1055.636) (-1055.038) * (-1059.283) (-1054.506) (-1062.634) [-1055.468] -- 0:01:35
      434000 -- [-1052.885] (-1049.869) (-1063.644) (-1053.907) * (-1055.071) (-1061.846) (-1055.026) [-1055.577] -- 0:01:36
      434500 -- (-1055.112) [-1050.313] (-1068.368) (-1059.613) * [-1054.015] (-1053.464) (-1064.081) (-1059.103) -- 0:01:36
      435000 -- (-1063.245) [-1051.981] (-1056.959) (-1057.689) * (-1057.675) [-1055.881] (-1052.687) (-1060.039) -- 0:01:36

      Average standard deviation of split frequencies: 0.000000

      435500 -- (-1057.565) (-1054.024) [-1055.469] (-1053.620) * (-1062.407) (-1055.693) [-1050.188] (-1057.156) -- 0:01:35
      436000 -- [-1055.857] (-1050.064) (-1051.267) (-1050.806) * (-1055.505) (-1056.980) (-1055.844) [-1054.224] -- 0:01:35
      436500 -- (-1057.153) [-1053.464] (-1054.484) (-1055.777) * (-1059.767) [-1056.663] (-1053.045) (-1058.223) -- 0:01:35
      437000 -- [-1053.953] (-1052.191) (-1058.996) (-1054.796) * (-1053.354) (-1062.456) [-1054.925] (-1056.760) -- 0:01:35
      437500 -- (-1053.664) (-1056.090) (-1054.183) [-1048.636] * [-1051.953] (-1061.314) (-1053.113) (-1054.299) -- 0:01:35
      438000 -- (-1054.675) (-1059.095) [-1056.572] (-1051.422) * [-1054.925] (-1053.206) (-1055.972) (-1060.635) -- 0:01:34
      438500 -- (-1066.104) (-1058.355) (-1058.857) [-1055.096] * [-1052.221] (-1055.035) (-1062.119) (-1060.440) -- 0:01:34
      439000 -- (-1055.435) [-1059.190] (-1058.970) (-1056.167) * (-1052.582) (-1054.388) [-1055.067] (-1056.171) -- 0:01:34
      439500 -- (-1055.264) (-1054.963) (-1054.199) [-1055.643] * (-1059.986) [-1055.694] (-1063.781) (-1054.543) -- 0:01:34
      440000 -- (-1056.560) (-1052.715) [-1052.526] (-1051.361) * (-1061.849) [-1053.455] (-1056.514) (-1055.744) -- 0:01:35

      Average standard deviation of split frequencies: 0.000000

      440500 -- (-1054.924) (-1054.979) (-1057.043) [-1053.039] * [-1059.488] (-1057.279) (-1052.514) (-1052.889) -- 0:01:35
      441000 -- (-1058.701) (-1053.043) (-1052.776) [-1053.192] * (-1053.320) (-1060.305) (-1057.430) [-1052.482] -- 0:01:35
      441500 -- (-1051.909) [-1052.023] (-1057.247) (-1052.229) * (-1060.067) (-1051.837) (-1052.111) [-1058.016] -- 0:01:34
      442000 -- (-1054.764) (-1052.158) (-1057.103) [-1056.287] * (-1060.309) [-1054.834] (-1054.266) (-1054.460) -- 0:01:34
      442500 -- [-1051.741] (-1050.137) (-1057.439) (-1059.698) * (-1054.759) (-1057.390) (-1062.286) [-1051.456] -- 0:01:34
      443000 -- (-1055.644) (-1056.299) [-1057.031] (-1053.007) * (-1053.286) (-1060.324) [-1056.526] (-1055.262) -- 0:01:34
      443500 -- [-1053.520] (-1053.779) (-1053.609) (-1055.730) * (-1057.890) (-1067.435) (-1057.839) [-1055.214] -- 0:01:34
      444000 -- (-1053.948) (-1053.050) [-1053.586] (-1056.177) * [-1054.424] (-1053.779) (-1053.979) (-1051.989) -- 0:01:33
      444500 -- (-1057.520) (-1056.953) (-1052.650) [-1051.794] * (-1058.346) [-1054.574] (-1058.013) (-1055.260) -- 0:01:33
      445000 -- (-1062.540) [-1052.637] (-1061.920) (-1061.081) * [-1059.703] (-1056.778) (-1052.901) (-1051.714) -- 0:01:33

      Average standard deviation of split frequencies: 0.000000

      445500 -- (-1057.933) (-1053.238) [-1056.602] (-1055.741) * (-1064.903) (-1053.844) [-1054.259] (-1052.079) -- 0:01:33
      446000 -- (-1055.253) (-1051.767) (-1061.712) [-1052.874] * (-1059.469) (-1052.344) [-1053.335] (-1062.028) -- 0:01:34
      446500 -- (-1057.192) [-1054.585] (-1065.154) (-1054.497) * (-1058.865) [-1056.284] (-1055.725) (-1055.139) -- 0:01:34
      447000 -- (-1053.725) [-1051.095] (-1056.605) (-1057.510) * (-1053.408) (-1051.145) [-1055.870] (-1060.544) -- 0:01:34
      447500 -- (-1054.086) (-1051.038) (-1059.016) [-1052.966] * (-1062.222) (-1055.858) [-1052.294] (-1059.758) -- 0:01:33
      448000 -- (-1054.682) [-1055.270] (-1060.766) (-1052.656) * (-1056.074) (-1055.289) [-1055.901] (-1058.824) -- 0:01:33
      448500 -- (-1051.549) (-1056.789) [-1053.990] (-1055.415) * (-1055.783) [-1056.957] (-1052.584) (-1058.309) -- 0:01:33
      449000 -- (-1054.601) [-1057.986] (-1059.075) (-1052.924) * [-1054.781] (-1054.776) (-1059.011) (-1055.855) -- 0:01:33
      449500 -- (-1053.461) (-1055.734) [-1057.378] (-1058.358) * [-1055.312] (-1062.262) (-1054.611) (-1055.881) -- 0:01:33
      450000 -- (-1056.981) (-1061.230) (-1056.122) [-1061.431] * (-1056.742) [-1054.496] (-1057.165) (-1055.772) -- 0:01:32

      Average standard deviation of split frequencies: 0.000000

      450500 -- (-1052.505) (-1059.183) [-1057.217] (-1060.006) * (-1065.708) [-1055.196] (-1057.566) (-1056.559) -- 0:01:32
      451000 -- [-1051.512] (-1057.626) (-1053.206) (-1057.790) * (-1054.949) (-1053.335) (-1055.169) [-1054.918] -- 0:01:32
      451500 -- (-1054.110) (-1052.364) (-1052.005) [-1053.877] * (-1053.923) (-1057.265) [-1056.173] (-1054.659) -- 0:01:32
      452000 -- (-1052.103) [-1051.670] (-1057.923) (-1055.006) * [-1055.258] (-1058.167) (-1052.296) (-1058.382) -- 0:01:32
      452500 -- (-1052.448) [-1049.634] (-1057.452) (-1055.478) * (-1055.183) [-1055.830] (-1054.442) (-1054.604) -- 0:01:33
      453000 -- (-1054.690) (-1053.171) [-1054.839] (-1057.467) * [-1053.974] (-1052.198) (-1053.624) (-1062.149) -- 0:01:32
      453500 -- (-1054.241) (-1054.115) [-1048.791] (-1050.077) * (-1057.719) (-1054.677) (-1059.941) [-1058.532] -- 0:01:32
      454000 -- (-1057.260) [-1053.560] (-1053.650) (-1054.502) * (-1061.803) (-1055.938) [-1055.089] (-1058.228) -- 0:01:32
      454500 -- (-1058.511) [-1054.015] (-1055.736) (-1050.693) * (-1052.570) [-1054.945] (-1053.335) (-1058.220) -- 0:01:32
      455000 -- (-1058.974) [-1054.655] (-1062.130) (-1056.264) * [-1056.557] (-1060.366) (-1058.125) (-1059.524) -- 0:01:32

      Average standard deviation of split frequencies: 0.000000

      455500 -- [-1054.603] (-1055.678) (-1054.089) (-1052.605) * (-1052.791) [-1051.290] (-1057.142) (-1057.718) -- 0:01:32
      456000 -- (-1051.200) [-1051.999] (-1053.405) (-1057.939) * (-1055.813) (-1050.660) (-1058.047) [-1058.288] -- 0:01:31
      456500 -- (-1051.883) [-1058.295] (-1051.255) (-1066.691) * (-1056.616) (-1057.329) (-1064.075) [-1055.408] -- 0:01:31
      457000 -- (-1048.289) [-1053.484] (-1051.025) (-1054.930) * (-1060.158) (-1057.977) (-1056.084) [-1055.354] -- 0:01:31
      457500 -- (-1057.321) [-1052.967] (-1049.105) (-1053.801) * (-1056.026) (-1055.696) [-1053.815] (-1060.615) -- 0:01:31
      458000 -- (-1056.686) (-1051.595) [-1050.897] (-1051.523) * (-1054.556) (-1054.158) (-1060.623) [-1058.996] -- 0:01:31
      458500 -- (-1053.333) (-1051.534) (-1052.220) [-1056.093] * (-1056.349) [-1061.993] (-1057.329) (-1054.154) -- 0:01:32
      459000 -- (-1051.830) [-1057.415] (-1058.800) (-1065.420) * [-1052.216] (-1053.579) (-1055.686) (-1053.976) -- 0:01:31
      459500 -- (-1053.961) [-1054.204] (-1053.305) (-1056.953) * (-1051.731) (-1052.163) [-1054.492] (-1051.744) -- 0:01:31
      460000 -- [-1054.293] (-1050.905) (-1060.388) (-1057.998) * (-1052.874) (-1058.114) (-1055.461) [-1059.074] -- 0:01:31

      Average standard deviation of split frequencies: 0.000000

      460500 -- (-1055.170) (-1054.310) (-1058.673) [-1060.107] * [-1055.201] (-1056.877) (-1056.538) (-1057.986) -- 0:01:31
      461000 -- (-1054.282) (-1056.707) [-1052.057] (-1056.078) * (-1051.355) (-1055.775) [-1057.557] (-1060.832) -- 0:01:31
      461500 -- (-1053.962) (-1056.449) (-1061.289) [-1052.578] * (-1053.632) (-1053.709) [-1052.869] (-1060.140) -- 0:01:31
      462000 -- [-1053.136] (-1052.638) (-1055.102) (-1056.395) * (-1050.445) [-1050.925] (-1061.039) (-1061.211) -- 0:01:30
      462500 -- [-1056.863] (-1053.656) (-1055.372) (-1058.458) * (-1057.124) (-1051.906) (-1058.644) [-1055.236] -- 0:01:30
      463000 -- (-1057.871) (-1055.933) [-1050.923] (-1062.761) * [-1054.172] (-1061.433) (-1055.782) (-1057.331) -- 0:01:30
      463500 -- (-1054.338) (-1056.044) [-1056.213] (-1061.307) * (-1058.965) [-1054.446] (-1055.228) (-1060.585) -- 0:01:30
      464000 -- (-1056.222) (-1052.467) [-1053.044] (-1056.374) * [-1056.025] (-1055.391) (-1060.945) (-1055.729) -- 0:01:30
      464500 -- (-1051.462) [-1048.891] (-1051.696) (-1053.838) * [-1053.220] (-1057.113) (-1054.248) (-1060.774) -- 0:01:29
      465000 -- (-1051.387) (-1057.408) (-1050.732) [-1055.618] * [-1052.924] (-1057.888) (-1051.581) (-1063.163) -- 0:01:30

      Average standard deviation of split frequencies: 0.000000

      465500 -- (-1051.473) [-1053.874] (-1052.811) (-1057.646) * (-1053.291) (-1054.163) (-1052.773) [-1063.781] -- 0:01:30
      466000 -- (-1055.393) (-1054.241) [-1051.875] (-1057.823) * (-1051.022) [-1057.327] (-1063.021) (-1054.243) -- 0:01:30
      466500 -- (-1052.851) (-1065.165) [-1052.047] (-1055.650) * (-1060.590) (-1055.159) (-1053.850) [-1049.773] -- 0:01:30
      467000 -- (-1054.429) (-1060.267) [-1050.263] (-1066.281) * (-1052.848) (-1059.408) [-1052.482] (-1056.260) -- 0:01:30
      467500 -- (-1054.294) (-1059.562) (-1059.108) [-1056.224] * (-1055.768) [-1054.981] (-1056.318) (-1054.244) -- 0:01:29
      468000 -- (-1059.085) [-1054.543] (-1052.255) (-1054.131) * (-1052.862) [-1055.845] (-1050.966) (-1061.652) -- 0:01:29
      468500 -- (-1054.074) (-1059.309) (-1057.159) [-1058.596] * [-1056.681] (-1058.664) (-1055.249) (-1065.268) -- 0:01:29
      469000 -- [-1058.746] (-1062.341) (-1054.704) (-1053.150) * [-1051.298] (-1055.766) (-1052.960) (-1060.156) -- 0:01:29
      469500 -- [-1056.853] (-1057.813) (-1057.346) (-1056.299) * [-1053.995] (-1061.247) (-1054.950) (-1058.814) -- 0:01:29
      470000 -- (-1061.174) (-1052.184) [-1057.129] (-1056.959) * [-1054.911] (-1060.238) (-1053.648) (-1052.798) -- 0:01:29

      Average standard deviation of split frequencies: 0.000000

      470500 -- (-1052.686) [-1051.723] (-1052.627) (-1059.378) * (-1056.034) (-1059.862) [-1057.497] (-1059.101) -- 0:01:30
      471000 -- [-1051.906] (-1056.302) (-1059.639) (-1053.671) * [-1053.778] (-1058.580) (-1054.299) (-1054.978) -- 0:01:29
      471500 -- (-1057.033) (-1053.528) (-1060.049) [-1054.502] * [-1054.240] (-1060.262) (-1055.951) (-1055.478) -- 0:01:29
      472000 -- [-1052.361] (-1049.911) (-1058.704) (-1051.170) * (-1053.680) (-1057.560) (-1057.144) [-1054.553] -- 0:01:29
      472500 -- [-1054.628] (-1055.291) (-1054.438) (-1058.071) * [-1054.965] (-1060.204) (-1056.584) (-1052.324) -- 0:01:29
      473000 -- [-1051.484] (-1051.953) (-1053.428) (-1055.272) * [-1057.060] (-1060.945) (-1055.746) (-1055.842) -- 0:01:29
      473500 -- [-1050.426] (-1061.321) (-1057.400) (-1054.187) * (-1058.234) (-1064.069) (-1061.824) [-1055.030] -- 0:01:28
      474000 -- (-1055.503) [-1052.599] (-1063.645) (-1062.052) * [-1051.075] (-1058.542) (-1060.459) (-1060.270) -- 0:01:28
      474500 -- (-1053.181) (-1056.975) [-1052.577] (-1058.248) * (-1052.537) (-1057.433) (-1052.024) [-1053.295] -- 0:01:28
      475000 -- (-1062.019) [-1054.054] (-1057.065) (-1061.819) * (-1059.490) (-1059.527) (-1057.924) [-1053.469] -- 0:01:28

      Average standard deviation of split frequencies: 0.000000

      475500 -- (-1053.638) (-1051.107) [-1064.312] (-1054.869) * [-1052.194] (-1059.342) (-1056.584) (-1051.211) -- 0:01:28
      476000 -- [-1059.796] (-1058.842) (-1056.112) (-1055.455) * (-1057.307) [-1051.795] (-1058.173) (-1066.537) -- 0:01:28
      476500 -- (-1057.038) [-1052.537] (-1057.150) (-1054.169) * (-1057.042) [-1055.226] (-1066.289) (-1055.288) -- 0:01:28
      477000 -- (-1055.965) (-1054.426) (-1054.943) [-1055.326] * (-1055.087) (-1054.798) [-1057.308] (-1057.692) -- 0:01:28
      477500 -- (-1068.298) [-1055.866] (-1056.414) (-1053.752) * [-1051.789] (-1055.353) (-1059.901) (-1063.683) -- 0:01:28
      478000 -- (-1054.109) [-1066.391] (-1058.874) (-1057.486) * [-1057.313] (-1052.099) (-1054.598) (-1057.050) -- 0:01:28
      478500 -- (-1052.871) (-1057.984) [-1054.594] (-1055.561) * (-1057.598) (-1052.655) (-1053.256) [-1060.939] -- 0:01:28
      479000 -- [-1053.212] (-1056.841) (-1061.778) (-1055.796) * (-1061.226) (-1052.032) (-1054.707) [-1059.278] -- 0:01:28
      479500 -- (-1064.905) [-1050.585] (-1065.095) (-1062.713) * (-1069.449) [-1050.309] (-1059.807) (-1056.941) -- 0:01:27
      480000 -- (-1052.184) [-1054.377] (-1057.625) (-1060.351) * [-1060.639] (-1056.293) (-1054.638) (-1055.639) -- 0:01:27

      Average standard deviation of split frequencies: 0.000000

      480500 -- (-1056.273) (-1052.200) [-1052.319] (-1060.227) * (-1056.097) (-1059.097) [-1055.179] (-1054.435) -- 0:01:27
      481000 -- (-1052.325) (-1057.514) [-1053.496] (-1055.706) * (-1063.652) (-1053.109) [-1053.473] (-1054.221) -- 0:01:27
      481500 -- (-1052.522) (-1053.953) (-1052.467) [-1053.330] * [-1058.358] (-1053.079) (-1054.278) (-1056.094) -- 0:01:27
      482000 -- [-1052.492] (-1057.764) (-1056.507) (-1049.947) * (-1054.278) (-1064.271) (-1054.723) [-1050.357] -- 0:01:27
      482500 -- (-1058.497) (-1064.629) (-1056.016) [-1051.895] * (-1055.715) [-1056.554] (-1055.693) (-1050.587) -- 0:01:27
      483000 -- (-1057.019) (-1053.832) [-1060.443] (-1056.459) * (-1059.735) [-1054.298] (-1056.322) (-1054.136) -- 0:01:27
      483500 -- (-1052.977) (-1059.598) (-1055.654) [-1052.776] * (-1055.581) (-1058.727) (-1055.804) [-1054.158] -- 0:01:27
      484000 -- (-1053.000) [-1052.276] (-1060.723) (-1058.296) * (-1058.770) (-1053.574) (-1056.179) [-1051.282] -- 0:01:27
      484500 -- (-1054.736) (-1055.563) [-1056.492] (-1061.265) * (-1062.443) [-1055.351] (-1062.685) (-1053.802) -- 0:01:27
      485000 -- (-1057.677) [-1053.564] (-1051.860) (-1061.636) * (-1057.516) [-1059.335] (-1064.110) (-1056.099) -- 0:01:27

      Average standard deviation of split frequencies: 0.000000

      485500 -- (-1052.735) [-1056.610] (-1055.690) (-1063.816) * (-1060.094) (-1053.018) [-1056.565] (-1051.922) -- 0:01:26
      486000 -- [-1051.903] (-1058.468) (-1052.153) (-1061.836) * (-1057.788) (-1053.355) [-1055.018] (-1055.286) -- 0:01:26
      486500 -- (-1051.722) (-1064.233) (-1049.195) [-1062.970] * (-1054.125) (-1057.246) [-1052.796] (-1054.718) -- 0:01:26
      487000 -- (-1059.547) (-1054.521) [-1049.216] (-1060.495) * (-1060.184) (-1054.980) [-1053.062] (-1058.862) -- 0:01:26
      487500 -- [-1052.452] (-1054.762) (-1054.308) (-1053.460) * [-1054.474] (-1053.407) (-1052.970) (-1053.977) -- 0:01:26
      488000 -- (-1058.026) (-1057.801) [-1054.606] (-1053.528) * (-1055.050) (-1056.285) [-1053.788] (-1063.644) -- 0:01:27
      488500 -- (-1057.138) (-1048.840) [-1057.623] (-1053.685) * (-1061.145) [-1053.629] (-1059.428) (-1054.751) -- 0:01:26
      489000 -- (-1054.565) (-1053.116) [-1055.515] (-1058.899) * (-1053.880) (-1052.580) [-1054.256] (-1058.841) -- 0:01:26
      489500 -- (-1050.771) (-1052.484) (-1054.440) [-1053.310] * (-1052.486) (-1055.610) (-1053.311) [-1055.486] -- 0:01:26
      490000 -- (-1055.911) (-1055.475) [-1055.209] (-1059.236) * [-1053.585] (-1061.381) (-1055.821) (-1054.732) -- 0:01:26

      Average standard deviation of split frequencies: 0.000000

      490500 -- (-1055.285) [-1053.898] (-1061.546) (-1059.333) * (-1051.309) [-1055.751] (-1054.277) (-1052.401) -- 0:01:26
      491000 -- (-1054.747) (-1056.805) [-1056.481] (-1053.820) * (-1058.744) (-1056.725) [-1059.114] (-1057.031) -- 0:01:26
      491500 -- (-1053.984) (-1059.673) [-1052.349] (-1052.306) * (-1055.657) [-1053.058] (-1058.578) (-1058.908) -- 0:01:25
      492000 -- [-1052.375] (-1055.442) (-1048.814) (-1059.854) * (-1055.642) (-1061.102) [-1052.127] (-1053.918) -- 0:01:25
      492500 -- (-1057.186) [-1053.678] (-1056.099) (-1064.401) * (-1062.236) (-1059.818) [-1052.358] (-1056.110) -- 0:01:25
      493000 -- [-1057.433] (-1050.653) (-1053.297) (-1061.529) * (-1056.110) [-1055.415] (-1055.360) (-1057.295) -- 0:01:25
      493500 -- (-1052.087) [-1053.455] (-1054.957) (-1061.949) * (-1054.883) (-1059.608) (-1058.748) [-1051.583] -- 0:01:25
      494000 -- (-1058.537) [-1051.268] (-1050.738) (-1056.723) * (-1054.124) [-1053.228] (-1053.990) (-1055.030) -- 0:01:26
      494500 -- [-1058.736] (-1052.272) (-1052.639) (-1058.508) * (-1051.211) [-1051.056] (-1054.723) (-1060.924) -- 0:01:25
      495000 -- (-1058.646) (-1059.037) [-1050.885] (-1063.180) * (-1055.888) (-1052.336) [-1056.622] (-1056.554) -- 0:01:25

      Average standard deviation of split frequencies: 0.000000

      495500 -- (-1056.372) [-1051.120] (-1054.283) (-1058.800) * (-1057.215) (-1059.878) [-1050.522] (-1058.168) -- 0:01:25
      496000 -- (-1065.163) (-1059.996) (-1060.974) [-1056.258] * (-1057.058) (-1060.776) [-1055.602] (-1053.101) -- 0:01:25
      496500 -- [-1053.715] (-1062.248) (-1068.824) (-1055.244) * (-1061.789) (-1057.356) [-1051.551] (-1051.217) -- 0:01:25
      497000 -- (-1051.327) [-1052.917] (-1068.629) (-1052.282) * (-1052.031) (-1059.155) (-1055.281) [-1060.655] -- 0:01:25
      497500 -- (-1056.531) (-1053.511) [-1060.989] (-1054.538) * [-1053.973] (-1059.325) (-1058.820) (-1053.115) -- 0:01:24
      498000 -- [-1052.323] (-1054.479) (-1054.425) (-1056.326) * (-1065.743) (-1057.862) [-1056.345] (-1060.871) -- 0:01:24
      498500 -- (-1054.369) (-1053.297) (-1057.651) [-1053.024] * (-1060.456) [-1056.912] (-1059.758) (-1057.749) -- 0:01:24
      499000 -- (-1055.021) (-1055.205) [-1055.905] (-1053.173) * (-1058.689) (-1055.644) [-1055.281] (-1060.072) -- 0:01:24
      499500 -- (-1052.324) [-1056.501] (-1064.747) (-1059.433) * [-1061.005] (-1053.326) (-1060.335) (-1062.160) -- 0:01:25
      500000 -- (-1056.202) (-1059.733) (-1053.991) [-1057.863] * [-1051.949] (-1050.277) (-1059.593) (-1061.399) -- 0:01:25

      Average standard deviation of split frequencies: 0.000000

      500500 -- (-1053.387) (-1061.378) (-1053.483) [-1053.933] * (-1062.091) [-1053.951] (-1057.994) (-1057.091) -- 0:01:24
      501000 -- (-1056.218) (-1060.410) (-1059.416) [-1056.140] * [-1054.034] (-1053.619) (-1051.041) (-1061.140) -- 0:01:24
      501500 -- (-1057.527) [-1059.039] (-1059.685) (-1054.531) * (-1050.989) [-1055.697] (-1055.660) (-1061.082) -- 0:01:24
      502000 -- [-1054.047] (-1056.725) (-1062.496) (-1048.651) * (-1053.172) (-1059.915) [-1049.171] (-1059.420) -- 0:01:24
      502500 -- (-1058.100) (-1058.653) (-1054.459) [-1061.228] * [-1056.133] (-1053.543) (-1061.679) (-1058.816) -- 0:01:24
      503000 -- (-1059.132) (-1052.250) [-1056.792] (-1058.219) * (-1051.736) (-1053.527) (-1055.590) [-1053.915] -- 0:01:23
      503500 -- [-1052.263] (-1056.473) (-1060.539) (-1059.785) * (-1056.341) (-1056.760) (-1052.639) [-1057.249] -- 0:01:23
      504000 -- [-1051.980] (-1053.555) (-1057.697) (-1055.219) * [-1060.055] (-1056.396) (-1058.109) (-1054.616) -- 0:01:23
      504500 -- (-1058.329) (-1052.890) (-1055.938) [-1050.935] * (-1061.363) [-1052.971] (-1053.795) (-1053.868) -- 0:01:23
      505000 -- [-1059.164] (-1061.223) (-1055.734) (-1049.753) * (-1055.188) (-1058.534) (-1064.743) [-1050.352] -- 0:01:24

      Average standard deviation of split frequencies: 0.000000

      505500 -- (-1050.586) (-1051.198) [-1050.825] (-1055.573) * (-1052.310) [-1051.341] (-1053.226) (-1058.378) -- 0:01:24
      506000 -- (-1058.656) (-1058.521) [-1052.881] (-1055.740) * (-1055.451) (-1052.239) [-1052.682] (-1056.916) -- 0:01:23
      506500 -- (-1054.792) (-1058.230) (-1060.286) [-1051.599] * [-1056.656] (-1054.886) (-1057.295) (-1050.911) -- 0:01:23
      507000 -- (-1056.578) (-1052.872) [-1057.185] (-1062.288) * (-1054.520) (-1062.387) [-1055.392] (-1052.503) -- 0:01:23
      507500 -- (-1058.587) (-1058.735) (-1059.125) [-1054.526] * [-1054.946] (-1059.911) (-1051.109) (-1050.752) -- 0:01:23
      508000 -- (-1052.672) [-1053.682] (-1057.023) (-1059.506) * [-1057.134] (-1052.957) (-1051.835) (-1053.314) -- 0:01:23
      508500 -- (-1054.860) [-1053.069] (-1053.092) (-1052.826) * (-1054.953) [-1055.662] (-1049.900) (-1057.223) -- 0:01:23
      509000 -- (-1054.403) (-1056.519) [-1053.053] (-1054.336) * (-1054.639) [-1051.115] (-1055.734) (-1055.836) -- 0:01:22
      509500 -- (-1059.351) (-1058.874) (-1055.422) [-1050.997] * (-1057.453) (-1052.907) [-1053.755] (-1058.226) -- 0:01:22
      510000 -- (-1054.666) [-1057.520] (-1053.365) (-1053.421) * [-1051.315] (-1061.303) (-1057.035) (-1056.586) -- 0:01:22

      Average standard deviation of split frequencies: 0.000000

      510500 -- (-1054.254) (-1054.904) [-1050.984] (-1050.585) * (-1053.240) (-1058.410) [-1057.023] (-1051.078) -- 0:01:23
      511000 -- (-1055.601) (-1068.066) [-1051.955] (-1051.120) * [-1049.044] (-1059.945) (-1057.692) (-1051.887) -- 0:01:23
      511500 -- [-1056.630] (-1055.076) (-1055.422) (-1061.836) * [-1052.764] (-1057.507) (-1051.451) (-1054.609) -- 0:01:23
      512000 -- (-1054.683) (-1060.213) [-1059.045] (-1064.538) * (-1055.452) (-1060.396) (-1056.219) [-1052.526] -- 0:01:22
      512500 -- (-1054.706) [-1055.598] (-1069.761) (-1065.061) * [-1055.896] (-1053.377) (-1056.017) (-1053.605) -- 0:01:22
      513000 -- [-1052.763] (-1054.929) (-1061.628) (-1073.524) * (-1052.516) [-1053.937] (-1061.565) (-1051.120) -- 0:01:22
      513500 -- (-1052.565) (-1052.322) (-1050.247) [-1059.150] * (-1057.229) (-1052.005) (-1060.587) [-1053.664] -- 0:01:22
      514000 -- (-1050.721) [-1053.351] (-1053.092) (-1056.547) * (-1054.256) [-1050.162] (-1066.692) (-1054.545) -- 0:01:22
      514500 -- [-1053.403] (-1054.704) (-1057.071) (-1055.544) * [-1051.501] (-1056.342) (-1054.747) (-1051.238) -- 0:01:22
      515000 -- [-1054.927] (-1054.955) (-1053.214) (-1064.302) * (-1055.554) (-1061.266) [-1057.659] (-1056.673) -- 0:01:21

      Average standard deviation of split frequencies: 0.000000

      515500 -- (-1058.044) (-1056.090) (-1054.352) [-1052.339] * (-1052.547) [-1055.792] (-1061.255) (-1051.263) -- 0:01:21
      516000 -- (-1057.352) [-1052.326] (-1054.384) (-1053.884) * (-1059.474) [-1054.163] (-1054.110) (-1054.056) -- 0:01:21
      516500 -- (-1059.480) (-1055.475) [-1052.838] (-1055.874) * (-1050.501) (-1054.348) (-1058.386) [-1051.625] -- 0:01:22
      517000 -- [-1056.017] (-1053.475) (-1051.386) (-1059.126) * (-1053.303) (-1053.243) (-1053.635) [-1056.549] -- 0:01:22
      517500 -- (-1053.878) (-1052.010) [-1054.645] (-1056.630) * (-1055.174) (-1051.664) [-1055.754] (-1055.076) -- 0:01:22
      518000 -- [-1054.959] (-1055.714) (-1053.358) (-1059.337) * [-1051.288] (-1054.567) (-1061.065) (-1056.352) -- 0:01:21
      518500 -- (-1053.550) (-1055.795) (-1052.666) [-1059.559] * (-1051.438) (-1059.069) (-1054.745) [-1057.729] -- 0:01:21
      519000 -- (-1055.204) (-1050.652) [-1053.032] (-1056.516) * (-1054.539) (-1054.546) (-1050.634) [-1052.683] -- 0:01:21
      519500 -- (-1053.405) (-1050.383) (-1054.180) [-1053.105] * (-1061.354) (-1053.814) (-1052.963) [-1051.463] -- 0:01:21
      520000 -- (-1051.053) (-1052.793) [-1051.955] (-1052.632) * (-1058.778) [-1052.667] (-1057.766) (-1055.966) -- 0:01:21

      Average standard deviation of split frequencies: 0.000000

      520500 -- (-1055.886) (-1052.878) [-1052.391] (-1053.801) * (-1061.939) (-1058.430) (-1057.741) [-1051.630] -- 0:01:21
      521000 -- (-1052.708) (-1059.051) [-1052.493] (-1050.797) * (-1055.447) (-1055.751) [-1056.040] (-1050.772) -- 0:01:20
      521500 -- [-1050.956] (-1063.179) (-1052.567) (-1056.297) * (-1058.728) [-1067.530] (-1056.405) (-1055.209) -- 0:01:20
      522000 -- (-1055.092) (-1060.895) [-1052.754] (-1054.190) * (-1055.100) (-1057.980) [-1055.192] (-1058.411) -- 0:01:21
      522500 -- (-1057.939) (-1058.402) (-1062.439) [-1053.889] * [-1056.007] (-1059.051) (-1059.526) (-1055.296) -- 0:01:21
      523000 -- (-1054.259) [-1056.613] (-1052.595) (-1050.124) * (-1058.032) (-1065.687) [-1057.250] (-1058.881) -- 0:01:21
      523500 -- [-1053.700] (-1062.713) (-1056.830) (-1057.743) * (-1057.712) (-1059.668) [-1054.566] (-1059.689) -- 0:01:21
      524000 -- (-1055.759) [-1055.598] (-1054.801) (-1051.884) * [-1054.390] (-1065.068) (-1059.717) (-1054.996) -- 0:01:20
      524500 -- [-1053.542] (-1057.862) (-1052.308) (-1054.116) * (-1053.899) (-1061.309) (-1053.748) [-1055.959] -- 0:01:20
      525000 -- (-1065.503) (-1058.805) (-1053.425) [-1051.412] * (-1054.530) (-1057.663) (-1055.099) [-1055.299] -- 0:01:20

      Average standard deviation of split frequencies: 0.000000

      525500 -- (-1055.995) (-1059.539) (-1054.056) [-1056.371] * (-1053.198) (-1057.550) [-1052.922] (-1058.142) -- 0:01:20
      526000 -- (-1056.754) (-1060.568) (-1053.460) [-1050.591] * (-1054.711) (-1069.912) [-1057.887] (-1056.268) -- 0:01:20
      526500 -- (-1053.104) [-1056.281] (-1053.531) (-1055.350) * (-1055.715) (-1065.321) (-1057.324) [-1054.993] -- 0:01:20
      527000 -- [-1057.268] (-1059.407) (-1054.093) (-1057.504) * (-1057.947) (-1062.049) (-1056.550) [-1052.875] -- 0:01:19
      527500 -- (-1052.405) (-1058.273) [-1056.505] (-1053.742) * (-1058.287) (-1060.779) (-1053.346) [-1052.474] -- 0:01:19
      528000 -- (-1053.198) (-1053.874) [-1055.858] (-1056.642) * (-1060.597) (-1058.408) [-1052.045] (-1057.288) -- 0:01:20
      528500 -- (-1059.266) (-1052.729) (-1059.661) [-1052.272] * (-1055.851) (-1062.361) [-1055.224] (-1051.702) -- 0:01:20
      529000 -- (-1055.545) (-1054.190) [-1050.819] (-1052.783) * [-1054.316] (-1058.679) (-1055.386) (-1056.660) -- 0:01:20
      529500 -- (-1052.386) (-1054.230) (-1051.339) [-1051.137] * (-1052.252) (-1060.838) [-1052.469] (-1059.632) -- 0:01:19
      530000 -- (-1056.984) (-1052.119) (-1057.771) [-1051.901] * [-1050.930] (-1054.929) (-1056.549) (-1056.748) -- 0:01:19

      Average standard deviation of split frequencies: 0.000000

      530500 -- (-1055.474) (-1057.348) (-1053.953) [-1051.600] * (-1051.569) (-1058.288) (-1052.416) [-1058.024] -- 0:01:19
      531000 -- (-1056.662) (-1059.008) [-1049.639] (-1061.277) * (-1057.619) (-1055.182) [-1052.844] (-1073.206) -- 0:01:19
      531500 -- [-1052.344] (-1058.194) (-1050.977) (-1052.161) * (-1050.369) (-1053.029) [-1051.480] (-1063.126) -- 0:01:19
      532000 -- (-1057.953) [-1055.109] (-1053.941) (-1053.021) * [-1052.705] (-1052.596) (-1054.952) (-1061.455) -- 0:01:19
      532500 -- [-1058.593] (-1058.354) (-1062.156) (-1053.188) * (-1057.464) (-1049.212) (-1059.756) [-1051.056] -- 0:01:19
      533000 -- [-1057.166] (-1057.041) (-1061.160) (-1052.238) * [-1056.524] (-1054.973) (-1056.262) (-1054.080) -- 0:01:18
      533500 -- (-1061.742) [-1053.715] (-1057.534) (-1054.077) * [-1056.751] (-1054.194) (-1060.861) (-1055.050) -- 0:01:19
      534000 -- (-1056.019) (-1055.456) [-1058.591] (-1056.502) * [-1051.129] (-1053.876) (-1066.193) (-1050.211) -- 0:01:19
      534500 -- (-1061.772) (-1061.687) (-1055.124) [-1051.638] * [-1050.188] (-1052.379) (-1068.765) (-1064.129) -- 0:01:19
      535000 -- (-1060.367) (-1057.431) [-1054.184] (-1057.012) * (-1058.330) [-1054.058] (-1057.293) (-1055.929) -- 0:01:19

      Average standard deviation of split frequencies: 0.000000

      535500 -- [-1060.045] (-1059.820) (-1059.684) (-1056.068) * (-1058.278) (-1053.503) [-1051.998] (-1061.656) -- 0:01:18
      536000 -- [-1061.892] (-1057.654) (-1052.834) (-1053.451) * (-1051.283) (-1051.668) [-1061.122] (-1053.852) -- 0:01:18
      536500 -- (-1055.989) [-1057.198] (-1052.638) (-1052.473) * (-1053.629) [-1053.804] (-1060.962) (-1056.643) -- 0:01:18
      537000 -- (-1055.023) (-1051.489) (-1058.009) [-1053.812] * [-1053.018] (-1048.906) (-1056.220) (-1060.999) -- 0:01:18
      537500 -- (-1064.018) (-1052.032) [-1048.275] (-1056.934) * (-1053.853) (-1055.271) (-1060.834) [-1056.934] -- 0:01:18
      538000 -- [-1055.986] (-1052.517) (-1053.124) (-1057.261) * (-1058.992) (-1051.438) [-1053.897] (-1056.331) -- 0:01:18
      538500 -- [-1061.287] (-1053.728) (-1061.906) (-1054.105) * (-1053.483) [-1050.608] (-1062.043) (-1053.167) -- 0:01:17
      539000 -- (-1056.754) (-1059.195) (-1053.640) [-1049.128] * [-1049.273] (-1051.586) (-1049.671) (-1059.236) -- 0:01:18
      539500 -- [-1053.369] (-1055.537) (-1056.582) (-1058.655) * [-1057.933] (-1055.682) (-1053.803) (-1056.941) -- 0:01:18
      540000 -- (-1054.569) (-1053.100) [-1050.035] (-1052.984) * [-1047.443] (-1054.393) (-1057.192) (-1064.730) -- 0:01:18

      Average standard deviation of split frequencies: 0.000000

      540500 -- (-1056.884) (-1054.754) [-1051.401] (-1052.241) * [-1053.936] (-1054.274) (-1053.633) (-1054.752) -- 0:01:18
      541000 -- (-1056.535) (-1056.141) [-1053.625] (-1055.272) * (-1049.779) (-1050.800) [-1050.033] (-1054.862) -- 0:01:18
      541500 -- [-1052.408] (-1059.111) (-1061.518) (-1058.519) * (-1054.055) [-1052.878] (-1056.100) (-1055.410) -- 0:01:17
      542000 -- (-1059.783) [-1056.725] (-1051.348) (-1060.227) * [-1054.489] (-1058.406) (-1056.949) (-1058.326) -- 0:01:17
      542500 -- (-1053.449) [-1057.442] (-1050.871) (-1061.001) * [-1054.214] (-1054.671) (-1057.248) (-1056.446) -- 0:01:17
      543000 -- (-1058.424) (-1055.986) [-1053.252] (-1058.444) * (-1057.654) (-1057.479) [-1054.238] (-1057.030) -- 0:01:17
      543500 -- (-1058.805) (-1055.338) [-1058.675] (-1061.266) * [-1053.553] (-1053.051) (-1056.923) (-1053.021) -- 0:01:17
      544000 -- [-1052.020] (-1050.436) (-1062.367) (-1063.360) * (-1057.211) (-1052.207) (-1063.538) [-1050.733] -- 0:01:17
      544500 -- (-1059.807) (-1052.966) [-1059.538] (-1052.692) * [-1052.909] (-1055.838) (-1059.476) (-1055.826) -- 0:01:16
      545000 -- (-1050.491) [-1052.070] (-1055.176) (-1061.069) * (-1052.478) (-1055.729) (-1053.995) [-1056.047] -- 0:01:17

      Average standard deviation of split frequencies: 0.000000

      545500 -- (-1049.770) (-1060.063) (-1051.512) [-1056.151] * (-1055.185) (-1053.644) (-1062.033) [-1056.983] -- 0:01:17
      546000 -- (-1054.341) [-1051.096] (-1057.628) (-1058.430) * (-1053.860) [-1056.077] (-1063.925) (-1051.339) -- 0:01:17
      546500 -- (-1052.477) (-1057.258) (-1052.553) [-1061.591] * [-1058.860] (-1057.258) (-1061.854) (-1054.250) -- 0:01:17
      547000 -- [-1053.696] (-1055.368) (-1051.161) (-1059.030) * [-1058.489] (-1053.576) (-1059.289) (-1052.520) -- 0:01:17
      547500 -- (-1057.598) (-1056.991) [-1050.249] (-1052.724) * (-1060.241) (-1051.508) (-1057.559) [-1056.186] -- 0:01:16
      548000 -- (-1055.183) (-1053.905) (-1047.700) [-1055.174] * (-1060.558) [-1051.282] (-1059.648) (-1061.648) -- 0:01:16
      548500 -- (-1051.397) (-1055.135) [-1053.986] (-1059.384) * (-1059.168) (-1056.146) (-1061.179) [-1063.402] -- 0:01:16
      549000 -- [-1057.376] (-1054.143) (-1054.024) (-1058.408) * (-1055.033) (-1056.758) [-1062.524] (-1060.028) -- 0:01:16
      549500 -- (-1051.419) [-1055.931] (-1057.675) (-1049.707) * (-1057.108) (-1061.594) (-1061.950) [-1058.123] -- 0:01:16
      550000 -- (-1064.339) (-1057.226) (-1057.228) [-1053.653] * [-1057.233] (-1056.061) (-1055.668) (-1059.908) -- 0:01:16

      Average standard deviation of split frequencies: 0.000000

      550500 -- (-1052.998) (-1053.963) [-1056.039] (-1063.898) * [-1058.273] (-1059.171) (-1055.387) (-1057.681) -- 0:01:15
      551000 -- [-1055.135] (-1050.782) (-1055.703) (-1058.928) * (-1055.328) (-1048.704) [-1050.812] (-1056.162) -- 0:01:15
      551500 -- (-1051.841) (-1053.791) [-1049.277] (-1057.768) * [-1055.455] (-1056.380) (-1065.775) (-1053.344) -- 0:01:16
      552000 -- [-1055.826] (-1059.435) (-1051.079) (-1059.715) * (-1057.271) (-1054.065) (-1057.922) [-1053.660] -- 0:01:16
      552500 -- (-1056.588) [-1051.410] (-1053.268) (-1053.922) * (-1058.137) [-1052.001] (-1058.283) (-1056.283) -- 0:01:16
      553000 -- (-1056.972) (-1056.388) [-1054.880] (-1052.875) * (-1056.671) (-1060.490) [-1055.726] (-1054.544) -- 0:01:15
      553500 -- [-1053.785] (-1051.812) (-1054.718) (-1054.077) * [-1056.070] (-1057.663) (-1053.619) (-1057.852) -- 0:01:15
      554000 -- (-1058.780) (-1058.916) [-1055.721] (-1053.416) * (-1053.839) (-1057.077) [-1051.054] (-1052.078) -- 0:01:15
      554500 -- (-1059.048) [-1051.569] (-1056.331) (-1061.263) * [-1058.707] (-1058.270) (-1053.833) (-1059.256) -- 0:01:15
      555000 -- (-1060.388) [-1056.130] (-1050.945) (-1052.188) * (-1061.055) (-1053.220) [-1054.535] (-1054.628) -- 0:01:15

      Average standard deviation of split frequencies: 0.000000

      555500 -- (-1058.745) (-1053.138) [-1057.201] (-1060.535) * (-1055.470) (-1057.992) [-1049.168] (-1056.867) -- 0:01:15
      556000 -- (-1062.585) [-1055.600] (-1050.104) (-1057.378) * (-1055.200) [-1057.946] (-1052.539) (-1057.434) -- 0:01:15
      556500 -- [-1054.713] (-1057.352) (-1054.663) (-1054.491) * [-1055.098] (-1054.058) (-1054.613) (-1053.356) -- 0:01:14
      557000 -- (-1054.905) [-1050.959] (-1054.161) (-1058.038) * [-1062.787] (-1055.033) (-1055.388) (-1055.303) -- 0:01:14
      557500 -- [-1052.639] (-1051.787) (-1062.909) (-1053.928) * (-1059.092) [-1054.556] (-1053.603) (-1057.619) -- 0:01:15
      558000 -- (-1060.500) [-1052.367] (-1053.008) (-1052.982) * (-1052.386) (-1058.036) [-1054.377] (-1052.233) -- 0:01:15
      558500 -- (-1055.489) [-1062.394] (-1053.012) (-1055.115) * [-1055.978] (-1054.559) (-1054.472) (-1053.373) -- 0:01:15
      559000 -- [-1055.587] (-1059.624) (-1049.637) (-1056.782) * [-1049.754] (-1058.802) (-1056.191) (-1050.346) -- 0:01:14
      559500 -- [-1050.829] (-1057.494) (-1056.353) (-1054.752) * [-1052.900] (-1058.673) (-1051.587) (-1056.119) -- 0:01:14
      560000 -- [-1055.871] (-1062.747) (-1063.770) (-1055.536) * (-1058.347) (-1055.110) [-1052.270] (-1055.446) -- 0:01:14

      Average standard deviation of split frequencies: 0.000000

      560500 -- (-1056.669) (-1062.299) (-1059.734) [-1057.356] * (-1065.628) (-1052.147) (-1051.049) [-1058.489] -- 0:01:14
      561000 -- (-1054.499) [-1059.763] (-1055.165) (-1050.923) * (-1061.824) (-1062.893) [-1051.309] (-1053.806) -- 0:01:14
      561500 -- [-1059.200] (-1063.967) (-1051.421) (-1055.443) * [-1054.788] (-1057.349) (-1053.743) (-1052.667) -- 0:01:14
      562000 -- [-1058.199] (-1058.438) (-1060.595) (-1056.138) * (-1058.367) (-1052.532) [-1050.880] (-1055.858) -- 0:01:14
      562500 -- (-1059.634) [-1056.780] (-1060.504) (-1062.203) * (-1056.595) [-1052.621] (-1053.757) (-1054.795) -- 0:01:13
      563000 -- [-1057.993] (-1058.928) (-1058.763) (-1054.676) * (-1061.302) [-1051.682] (-1056.833) (-1055.003) -- 0:01:13
      563500 -- (-1052.301) (-1055.480) (-1057.247) [-1057.065] * (-1052.836) [-1058.435] (-1056.354) (-1050.971) -- 0:01:14
      564000 -- (-1058.253) (-1056.143) (-1051.552) [-1055.630] * (-1051.184) (-1051.126) (-1054.848) [-1056.153] -- 0:01:14
      564500 -- (-1057.435) (-1057.696) (-1052.275) [-1054.858] * [-1052.823] (-1051.433) (-1058.717) (-1052.213) -- 0:01:14
      565000 -- (-1052.714) (-1060.661) [-1054.590] (-1054.046) * [-1055.702] (-1051.159) (-1052.356) (-1058.502) -- 0:01:13

      Average standard deviation of split frequencies: 0.000000

      565500 -- [-1053.557] (-1064.827) (-1062.225) (-1054.920) * (-1052.589) [-1054.707] (-1051.200) (-1057.252) -- 0:01:13
      566000 -- (-1058.974) [-1056.308] (-1059.671) (-1053.241) * [-1061.773] (-1052.297) (-1057.807) (-1055.415) -- 0:01:13
      566500 -- (-1056.796) [-1059.766] (-1057.820) (-1069.943) * (-1066.980) (-1061.551) [-1050.052] (-1051.549) -- 0:01:13
      567000 -- (-1055.114) [-1055.736] (-1060.422) (-1062.325) * [-1062.570] (-1052.304) (-1055.118) (-1056.330) -- 0:01:13
      567500 -- [-1053.771] (-1058.065) (-1063.780) (-1053.962) * [-1054.881] (-1055.810) (-1057.029) (-1055.976) -- 0:01:13
      568000 -- (-1057.855) [-1052.753] (-1061.488) (-1054.348) * (-1057.433) (-1053.761) [-1054.951] (-1058.108) -- 0:01:13
      568500 -- (-1055.430) [-1053.890] (-1053.601) (-1056.832) * [-1051.615] (-1054.240) (-1055.951) (-1057.216) -- 0:01:12
      569000 -- [-1054.044] (-1055.912) (-1056.065) (-1054.530) * (-1053.074) (-1052.958) [-1057.541] (-1057.169) -- 0:01:12
      569500 -- (-1054.070) [-1061.537] (-1058.384) (-1053.618) * [-1052.410] (-1058.748) (-1061.206) (-1055.740) -- 0:01:12
      570000 -- [-1054.191] (-1054.056) (-1052.482) (-1057.646) * [-1058.144] (-1057.814) (-1053.028) (-1053.611) -- 0:01:13

      Average standard deviation of split frequencies: 0.000000

      570500 -- (-1055.875) (-1058.140) (-1058.329) [-1050.719] * (-1064.451) (-1056.896) (-1054.173) [-1054.070] -- 0:01:13
      571000 -- [-1054.435] (-1060.263) (-1054.727) (-1055.161) * (-1055.297) (-1054.082) [-1055.626] (-1053.638) -- 0:01:12
      571500 -- [-1052.360] (-1056.493) (-1066.074) (-1061.573) * (-1056.993) [-1050.424] (-1059.620) (-1052.580) -- 0:01:12
      572000 -- (-1058.092) (-1052.740) [-1055.282] (-1064.526) * (-1052.469) (-1051.866) (-1064.018) [-1055.721] -- 0:01:12
      572500 -- (-1057.559) [-1060.364] (-1054.587) (-1059.595) * [-1052.995] (-1052.712) (-1051.171) (-1056.333) -- 0:01:12
      573000 -- (-1056.352) [-1054.035] (-1058.280) (-1053.858) * (-1055.984) (-1056.273) [-1052.687] (-1060.216) -- 0:01:12
      573500 -- [-1053.234] (-1055.305) (-1055.273) (-1054.022) * (-1056.224) (-1055.001) (-1053.409) [-1056.049] -- 0:01:12
      574000 -- (-1055.356) (-1052.750) [-1056.539] (-1054.158) * [-1057.643] (-1057.814) (-1050.320) (-1055.572) -- 0:01:11
      574500 -- (-1059.396) [-1051.047] (-1051.174) (-1057.035) * [-1052.302] (-1058.128) (-1051.760) (-1053.044) -- 0:01:11
      575000 -- (-1056.468) (-1056.619) (-1055.189) [-1054.101] * (-1051.719) [-1051.218] (-1052.252) (-1062.610) -- 0:01:11

      Average standard deviation of split frequencies: 0.000000

      575500 -- (-1053.004) (-1055.015) (-1052.804) [-1056.300] * [-1055.789] (-1050.734) (-1052.332) (-1052.200) -- 0:01:11
      576000 -- (-1055.426) (-1061.704) (-1058.080) [-1055.538] * [-1053.360] (-1058.672) (-1056.051) (-1060.899) -- 0:01:12
      576500 -- (-1057.831) [-1051.643] (-1059.536) (-1058.134) * [-1052.740] (-1056.863) (-1049.171) (-1056.581) -- 0:01:11
      577000 -- (-1057.077) (-1055.570) (-1055.350) [-1057.402] * (-1057.097) [-1054.580] (-1055.761) (-1054.214) -- 0:01:11
      577500 -- (-1058.713) [-1052.256] (-1064.186) (-1059.173) * (-1051.390) (-1053.656) (-1053.744) [-1053.699] -- 0:01:11
      578000 -- (-1061.409) [-1054.913] (-1057.858) (-1059.588) * (-1055.830) (-1060.058) [-1051.607] (-1054.819) -- 0:01:11
      578500 -- [-1057.542] (-1062.167) (-1061.967) (-1057.234) * (-1054.696) (-1058.842) [-1054.378] (-1059.835) -- 0:01:11
      579000 -- (-1055.262) (-1057.579) [-1058.805] (-1056.537) * (-1055.627) [-1055.513] (-1049.879) (-1048.799) -- 0:01:11
      579500 -- (-1054.821) (-1054.705) (-1057.081) [-1053.630] * (-1057.919) (-1056.200) [-1056.228] (-1055.540) -- 0:01:11
      580000 -- (-1057.916) [-1054.095] (-1057.626) (-1054.673) * (-1064.713) [-1052.566] (-1058.581) (-1049.336) -- 0:01:10

      Average standard deviation of split frequencies: 0.000000

      580500 -- (-1058.375) [-1054.206] (-1056.593) (-1050.811) * [-1051.175] (-1054.980) (-1056.323) (-1050.118) -- 0:01:10
      581000 -- (-1052.788) (-1058.396) (-1057.067) [-1055.065] * (-1054.550) (-1053.392) (-1051.362) [-1051.727] -- 0:01:10
      581500 -- [-1054.393] (-1050.399) (-1051.394) (-1053.916) * (-1052.619) (-1054.180) [-1050.519] (-1054.987) -- 0:01:10
      582000 -- [-1056.959] (-1051.146) (-1048.700) (-1056.784) * (-1056.862) (-1055.866) [-1054.816] (-1054.254) -- 0:01:11
      582500 -- (-1055.576) (-1052.080) (-1050.067) [-1052.534] * (-1060.522) (-1056.190) (-1053.226) [-1055.187] -- 0:01:10
      583000 -- (-1052.101) (-1056.141) (-1055.045) [-1053.102] * (-1066.167) (-1065.456) [-1056.492] (-1053.677) -- 0:01:10
      583500 -- (-1057.527) (-1060.137) [-1053.272] (-1055.059) * (-1051.167) (-1060.270) (-1060.351) [-1052.603] -- 0:01:10
      584000 -- (-1054.412) (-1054.172) [-1053.177] (-1053.668) * [-1054.965] (-1062.375) (-1056.383) (-1053.414) -- 0:01:10
      584500 -- [-1054.282] (-1052.852) (-1061.007) (-1051.395) * (-1053.224) (-1059.157) [-1052.308] (-1069.788) -- 0:01:10
      585000 -- (-1059.192) (-1061.765) (-1054.070) [-1054.412] * (-1059.225) (-1054.340) [-1053.451] (-1058.121) -- 0:01:10

      Average standard deviation of split frequencies: 0.000000

      585500 -- (-1061.825) (-1054.025) [-1051.781] (-1058.734) * (-1059.837) (-1056.061) (-1056.175) [-1051.688] -- 0:01:10
      586000 -- (-1064.256) (-1058.889) [-1049.996] (-1057.915) * [-1056.912] (-1057.611) (-1059.266) (-1056.412) -- 0:01:09
      586500 -- (-1062.818) (-1060.909) [-1052.992] (-1057.921) * (-1055.716) [-1055.168] (-1051.569) (-1054.776) -- 0:01:09
      587000 -- (-1063.006) (-1064.334) (-1051.678) [-1057.252] * (-1059.807) [-1055.507] (-1052.570) (-1054.446) -- 0:01:09
      587500 -- (-1053.620) (-1065.828) (-1051.476) [-1050.464] * [-1054.093] (-1059.472) (-1051.201) (-1055.009) -- 0:01:09
      588000 -- (-1056.977) (-1057.700) [-1058.986] (-1056.927) * [-1051.185] (-1057.503) (-1051.586) (-1062.460) -- 0:01:10
      588500 -- [-1061.098] (-1051.535) (-1055.260) (-1051.936) * (-1052.456) (-1055.984) (-1056.404) [-1062.417] -- 0:01:09
      589000 -- [-1053.842] (-1056.370) (-1058.917) (-1058.503) * (-1056.414) [-1060.492] (-1051.501) (-1061.750) -- 0:01:09
      589500 -- (-1056.563) (-1056.709) (-1057.157) [-1052.921] * (-1060.713) (-1053.866) [-1055.026] (-1054.312) -- 0:01:09
      590000 -- (-1050.263) (-1055.067) (-1057.403) [-1050.957] * (-1057.183) [-1055.195] (-1055.802) (-1056.811) -- 0:01:09

      Average standard deviation of split frequencies: 0.000000

      590500 -- (-1053.982) [-1062.206] (-1057.803) (-1057.792) * [-1051.444] (-1060.664) (-1053.944) (-1052.748) -- 0:01:09
      591000 -- (-1052.972) [-1053.395] (-1059.506) (-1065.475) * [-1054.013] (-1062.873) (-1054.818) (-1055.948) -- 0:01:09
      591500 -- (-1057.042) (-1055.253) [-1054.845] (-1058.371) * (-1057.352) (-1061.790) [-1052.408] (-1052.822) -- 0:01:09
      592000 -- (-1058.034) (-1058.268) [-1056.239] (-1060.226) * (-1061.236) [-1062.519] (-1049.891) (-1050.422) -- 0:01:08
      592500 -- [-1058.228] (-1059.708) (-1055.004) (-1054.886) * [-1060.565] (-1057.091) (-1058.231) (-1055.761) -- 0:01:08
      593000 -- [-1053.141] (-1057.856) (-1051.988) (-1056.573) * (-1061.429) (-1054.265) (-1060.828) [-1054.743] -- 0:01:08
      593500 -- (-1058.188) [-1052.408] (-1057.120) (-1053.189) * (-1060.118) [-1056.447] (-1057.126) (-1054.738) -- 0:01:08
      594000 -- (-1060.615) [-1055.151] (-1055.589) (-1055.702) * [-1053.838] (-1053.657) (-1062.175) (-1059.035) -- 0:01:09
      594500 -- (-1049.640) (-1062.080) [-1052.861] (-1055.649) * (-1050.614) [-1049.825] (-1055.179) (-1064.657) -- 0:01:08
      595000 -- (-1059.281) [-1060.092] (-1052.643) (-1055.276) * (-1060.543) (-1051.198) [-1057.793] (-1055.294) -- 0:01:08

      Average standard deviation of split frequencies: 0.000000

      595500 -- (-1053.683) [-1056.645] (-1060.194) (-1057.540) * (-1055.083) [-1056.644] (-1054.233) (-1058.504) -- 0:01:08
      596000 -- (-1051.546) (-1051.493) (-1057.026) [-1050.408] * (-1054.173) (-1054.426) [-1053.017] (-1055.443) -- 0:01:08
      596500 -- [-1052.464] (-1050.878) (-1050.575) (-1055.528) * (-1055.214) (-1054.262) (-1053.427) [-1060.836] -- 0:01:08
      597000 -- (-1055.696) (-1049.047) (-1053.488) [-1057.160] * [-1051.904] (-1056.289) (-1052.356) (-1054.198) -- 0:01:08
      597500 -- (-1054.755) [-1050.870] (-1052.695) (-1058.518) * (-1053.242) (-1059.518) [-1057.901] (-1061.472) -- 0:01:08
      598000 -- (-1056.035) [-1058.229] (-1049.807) (-1055.969) * [-1057.435] (-1058.465) (-1059.155) (-1055.439) -- 0:01:07
      598500 -- [-1054.590] (-1053.784) (-1058.440) (-1052.504) * (-1058.115) (-1059.751) [-1053.269] (-1051.505) -- 0:01:07
      599000 -- (-1056.322) [-1057.198] (-1052.773) (-1057.331) * (-1057.395) (-1057.687) [-1056.060] (-1055.994) -- 0:01:07
      599500 -- (-1054.351) (-1062.886) [-1053.238] (-1053.970) * [-1057.995] (-1059.830) (-1054.475) (-1057.981) -- 0:01:07
      600000 -- [-1051.139] (-1061.971) (-1053.322) (-1055.154) * (-1056.074) (-1055.197) (-1060.030) [-1054.928] -- 0:01:07

      Average standard deviation of split frequencies: 0.000000

      600500 -- [-1052.733] (-1055.307) (-1053.739) (-1057.654) * (-1060.947) (-1056.376) [-1053.877] (-1057.595) -- 0:01:07
      601000 -- [-1053.881] (-1056.485) (-1055.568) (-1054.756) * (-1056.659) (-1051.226) (-1050.734) [-1050.895] -- 0:01:07
      601500 -- (-1050.798) (-1059.904) [-1053.618] (-1055.832) * (-1063.918) [-1053.293] (-1057.376) (-1052.753) -- 0:01:07
      602000 -- (-1054.141) (-1060.356) [-1053.947] (-1057.346) * (-1054.345) (-1061.801) (-1060.251) [-1051.492] -- 0:01:07
      602500 -- (-1055.062) (-1058.991) [-1058.454] (-1050.818) * (-1050.733) (-1060.645) (-1055.806) [-1051.731] -- 0:01:07
      603000 -- (-1054.431) [-1057.678] (-1057.786) (-1051.631) * (-1052.902) [-1053.631] (-1054.212) (-1057.329) -- 0:01:07
      603500 -- (-1057.550) [-1053.127] (-1059.126) (-1056.376) * (-1061.487) [-1052.784] (-1051.972) (-1057.321) -- 0:01:07
      604000 -- (-1057.608) [-1050.946] (-1056.463) (-1053.718) * (-1053.576) [-1050.917] (-1053.203) (-1059.333) -- 0:01:06
      604500 -- (-1057.090) (-1051.847) [-1054.877] (-1058.157) * (-1057.054) (-1054.828) (-1052.304) [-1056.960] -- 0:01:06
      605000 -- (-1048.323) [-1054.832] (-1059.138) (-1056.987) * [-1054.824] (-1057.243) (-1053.969) (-1055.122) -- 0:01:06

      Average standard deviation of split frequencies: 0.000000

      605500 -- [-1053.268] (-1058.458) (-1052.829) (-1050.270) * [-1050.706] (-1055.407) (-1059.436) (-1054.711) -- 0:01:06
      606000 -- (-1052.080) [-1055.268] (-1051.948) (-1056.383) * [-1052.685] (-1051.969) (-1053.867) (-1057.195) -- 0:01:06
      606500 -- (-1056.977) [-1054.728] (-1054.954) (-1051.260) * (-1057.915) [-1051.022] (-1052.025) (-1049.838) -- 0:01:06
      607000 -- (-1053.810) [-1052.480] (-1056.855) (-1050.599) * (-1051.825) (-1061.189) [-1051.469] (-1050.898) -- 0:01:06
      607500 -- (-1054.277) (-1052.766) (-1050.209) [-1055.331] * (-1052.982) (-1054.093) [-1054.722] (-1053.883) -- 0:01:06
      608000 -- (-1053.161) [-1057.596] (-1054.945) (-1053.870) * (-1051.891) [-1051.007] (-1054.395) (-1054.565) -- 0:01:06
      608500 -- (-1051.820) [-1061.333] (-1053.698) (-1062.709) * (-1051.063) (-1052.493) (-1059.535) [-1060.195] -- 0:01:06
      609000 -- [-1054.588] (-1059.262) (-1061.683) (-1068.056) * [-1055.078] (-1054.137) (-1052.621) (-1055.648) -- 0:01:06
      609500 -- (-1053.943) (-1053.656) [-1054.305] (-1060.923) * [-1052.129] (-1061.520) (-1052.965) (-1054.001) -- 0:01:05
      610000 -- (-1056.684) (-1058.251) (-1058.816) [-1057.147] * (-1053.431) (-1059.476) (-1054.051) [-1057.457] -- 0:01:05

      Average standard deviation of split frequencies: 0.000000

      610500 -- (-1066.684) [-1056.061] (-1051.197) (-1052.283) * (-1058.548) (-1062.397) (-1049.352) [-1053.472] -- 0:01:05
      611000 -- (-1062.858) (-1055.640) [-1052.027] (-1053.774) * (-1049.812) (-1061.022) [-1058.027] (-1059.976) -- 0:01:05
      611500 -- [-1053.558] (-1052.117) (-1051.849) (-1060.422) * (-1051.944) (-1060.265) [-1051.166] (-1055.349) -- 0:01:05
      612000 -- (-1056.184) (-1053.259) [-1051.074] (-1058.934) * [-1050.966] (-1057.876) (-1056.332) (-1055.915) -- 0:01:05
      612500 -- [-1051.829] (-1055.045) (-1052.393) (-1057.117) * (-1056.413) [-1057.458] (-1055.156) (-1054.517) -- 0:01:05
      613000 -- [-1052.075] (-1059.437) (-1058.398) (-1051.266) * (-1052.307) [-1056.002] (-1058.899) (-1053.118) -- 0:01:05
      613500 -- (-1050.792) (-1051.242) [-1056.896] (-1050.541) * (-1051.461) (-1061.064) [-1060.155] (-1050.806) -- 0:01:05
      614000 -- (-1054.059) (-1054.273) [-1058.036] (-1055.608) * (-1054.479) (-1055.771) [-1054.467] (-1054.183) -- 0:01:05
      614500 -- (-1059.415) [-1052.690] (-1059.297) (-1055.785) * (-1057.788) (-1057.089) (-1059.314) [-1059.613] -- 0:01:05
      615000 -- (-1060.463) (-1054.254) (-1055.964) [-1051.728] * (-1055.729) [-1054.147] (-1058.121) (-1053.449) -- 0:01:05

      Average standard deviation of split frequencies: 0.000000

      615500 -- (-1058.329) [-1055.846] (-1063.160) (-1057.810) * (-1059.091) (-1059.839) (-1057.253) [-1054.397] -- 0:01:04
      616000 -- (-1057.911) (-1060.564) [-1052.226] (-1057.198) * (-1054.939) (-1054.619) [-1061.715] (-1056.794) -- 0:01:04
      616500 -- [-1052.961] (-1063.493) (-1050.161) (-1056.433) * (-1053.249) (-1059.048) (-1052.111) [-1055.499] -- 0:01:04
      617000 -- (-1057.979) (-1056.413) [-1055.151] (-1058.464) * [-1052.897] (-1064.920) (-1057.381) (-1059.109) -- 0:01:04
      617500 -- [-1055.659] (-1050.078) (-1058.236) (-1058.827) * (-1056.809) (-1051.875) (-1062.784) [-1056.773] -- 0:01:04
      618000 -- [-1058.744] (-1053.253) (-1055.412) (-1056.672) * [-1060.557] (-1054.769) (-1059.637) (-1060.656) -- 0:01:04
      618500 -- (-1052.324) (-1058.221) (-1054.114) [-1052.674] * (-1065.264) (-1056.232) (-1057.725) [-1053.682] -- 0:01:04
      619000 -- [-1053.337] (-1060.057) (-1060.871) (-1056.090) * (-1053.951) (-1055.512) [-1057.432] (-1050.795) -- 0:01:04
      619500 -- (-1057.810) (-1059.258) (-1058.067) [-1056.998] * [-1050.359] (-1055.412) (-1057.054) (-1055.371) -- 0:01:04
      620000 -- (-1055.099) (-1060.785) [-1057.874] (-1053.757) * (-1053.797) [-1056.841] (-1060.281) (-1057.369) -- 0:01:04

      Average standard deviation of split frequencies: 0.000000

      620500 -- (-1056.113) (-1061.383) [-1060.362] (-1061.277) * (-1051.286) [-1051.398] (-1051.939) (-1052.917) -- 0:01:04
      621000 -- (-1054.107) (-1058.185) (-1048.508) [-1050.319] * (-1052.325) (-1054.250) (-1053.383) [-1052.012] -- 0:01:04
      621500 -- (-1053.524) (-1065.324) [-1056.261] (-1058.481) * (-1051.417) [-1053.276] (-1052.484) (-1059.088) -- 0:01:03
      622000 -- (-1055.116) [-1051.541] (-1054.918) (-1060.855) * (-1053.179) (-1054.393) (-1055.186) [-1058.985] -- 0:01:03
      622500 -- (-1055.756) (-1054.138) [-1057.528] (-1054.083) * (-1050.888) (-1053.572) (-1053.646) [-1054.901] -- 0:01:03
      623000 -- [-1053.096] (-1065.723) (-1060.347) (-1053.317) * (-1059.612) (-1059.914) (-1054.200) [-1049.947] -- 0:01:03
      623500 -- (-1052.106) (-1063.832) (-1057.967) [-1054.440] * (-1054.927) [-1054.290] (-1055.904) (-1056.270) -- 0:01:03
      624000 -- (-1052.627) (-1061.814) (-1057.752) [-1054.754] * (-1056.663) (-1054.847) (-1058.941) [-1049.140] -- 0:01:03
      624500 -- [-1057.370] (-1054.970) (-1057.119) (-1064.553) * (-1053.132) (-1051.995) (-1062.516) [-1051.583] -- 0:01:03
      625000 -- (-1060.218) [-1058.283] (-1054.485) (-1060.247) * [-1055.680] (-1057.909) (-1056.077) (-1059.697) -- 0:01:03

      Average standard deviation of split frequencies: 0.000000

      625500 -- (-1054.138) (-1062.544) [-1052.406] (-1060.013) * (-1054.393) (-1054.408) [-1054.396] (-1053.535) -- 0:01:03
      626000 -- [-1054.702] (-1058.820) (-1052.515) (-1059.181) * (-1050.701) (-1058.318) [-1053.116] (-1056.003) -- 0:01:03
      626500 -- [-1059.436] (-1056.952) (-1056.870) (-1062.226) * (-1062.136) (-1059.044) (-1051.372) [-1054.266] -- 0:01:03
      627000 -- (-1063.765) (-1055.696) (-1052.950) [-1056.497] * (-1057.682) [-1054.736] (-1056.293) (-1055.226) -- 0:01:03
      627500 -- (-1055.676) (-1063.070) (-1053.111) [-1052.344] * (-1051.108) [-1050.503] (-1055.122) (-1062.002) -- 0:01:02
      628000 -- (-1057.190) (-1061.522) [-1051.626] (-1053.010) * [-1056.637] (-1052.811) (-1059.109) (-1057.948) -- 0:01:02
      628500 -- [-1059.365] (-1059.670) (-1056.677) (-1057.590) * (-1052.094) (-1058.873) (-1050.391) [-1054.567] -- 0:01:02
      629000 -- (-1054.948) (-1056.674) (-1053.034) [-1055.095] * (-1054.878) (-1057.701) [-1063.198] (-1055.391) -- 0:01:02
      629500 -- (-1051.309) [-1054.879] (-1060.362) (-1057.498) * (-1060.540) (-1055.431) (-1055.388) [-1054.337] -- 0:01:02
      630000 -- [-1052.571] (-1053.220) (-1053.384) (-1054.003) * (-1056.684) (-1053.975) [-1058.924] (-1056.580) -- 0:01:02

      Average standard deviation of split frequencies: 0.000000

      630500 -- (-1052.839) (-1054.046) [-1053.131] (-1063.868) * (-1049.762) (-1054.961) [-1055.724] (-1057.277) -- 0:01:02
      631000 -- [-1053.289] (-1053.440) (-1055.193) (-1052.640) * (-1055.831) [-1054.165] (-1061.878) (-1055.321) -- 0:01:01
      631500 -- (-1058.386) [-1055.444] (-1060.528) (-1054.824) * [-1055.505] (-1052.250) (-1060.122) (-1057.280) -- 0:01:02
      632000 -- (-1050.047) (-1057.229) (-1053.993) [-1058.281] * (-1054.154) (-1057.624) [-1056.766] (-1053.509) -- 0:01:02
      632500 -- (-1052.043) (-1055.521) (-1052.543) [-1054.875] * (-1061.964) (-1052.363) (-1054.606) [-1052.720] -- 0:01:02
      633000 -- (-1052.391) (-1056.670) (-1058.039) [-1055.108] * (-1052.873) (-1052.930) (-1062.009) [-1051.873] -- 0:01:02
      633500 -- (-1053.697) [-1049.533] (-1057.699) (-1053.016) * (-1055.060) (-1058.421) (-1055.282) [-1054.612] -- 0:01:01
      634000 -- (-1057.626) (-1050.832) (-1053.290) [-1054.492] * (-1054.686) (-1059.190) [-1056.037] (-1059.106) -- 0:01:01
      634500 -- (-1052.012) (-1053.942) (-1054.326) [-1053.717] * [-1055.293] (-1057.193) (-1058.010) (-1056.747) -- 0:01:01
      635000 -- (-1052.568) (-1055.558) (-1051.237) [-1056.174] * (-1055.961) (-1060.287) (-1056.090) [-1053.696] -- 0:01:01

      Average standard deviation of split frequencies: 0.000000

      635500 -- [-1057.488] (-1051.493) (-1054.311) (-1053.546) * (-1053.101) [-1058.028] (-1055.500) (-1059.029) -- 0:01:01
      636000 -- (-1059.304) (-1064.801) [-1057.085] (-1056.667) * (-1054.935) [-1054.231] (-1057.039) (-1051.465) -- 0:01:01
      636500 -- (-1056.092) (-1053.560) [-1058.215] (-1057.942) * [-1056.585] (-1052.162) (-1052.147) (-1056.784) -- 0:01:01
      637000 -- (-1054.281) (-1052.163) [-1056.916] (-1055.124) * [-1055.048] (-1051.743) (-1059.803) (-1057.857) -- 0:01:00
      637500 -- [-1055.374] (-1050.886) (-1061.360) (-1057.387) * (-1052.941) (-1055.144) (-1053.522) [-1054.882] -- 0:01:01
      638000 -- (-1054.640) (-1054.507) [-1051.067] (-1053.461) * (-1058.228) (-1055.930) [-1051.820] (-1065.494) -- 0:01:01
      638500 -- (-1053.615) [-1049.847] (-1053.628) (-1051.543) * (-1056.418) (-1057.749) [-1053.914] (-1060.910) -- 0:01:01
      639000 -- (-1056.596) [-1055.991] (-1053.574) (-1058.556) * [-1056.440] (-1055.318) (-1055.817) (-1055.347) -- 0:01:01
      639500 -- (-1056.210) (-1055.578) (-1060.277) [-1050.425] * (-1056.076) [-1053.694] (-1054.958) (-1062.475) -- 0:01:00
      640000 -- (-1053.139) [-1052.648] (-1059.791) (-1052.584) * (-1053.457) [-1057.640] (-1053.768) (-1054.494) -- 0:01:00

      Average standard deviation of split frequencies: 0.000000

      640500 -- (-1058.017) (-1054.822) (-1067.481) [-1053.222] * [-1053.805] (-1051.079) (-1054.079) (-1050.787) -- 0:01:00
      641000 -- (-1065.637) (-1052.566) (-1057.862) [-1051.446] * (-1059.472) [-1056.180] (-1051.057) (-1055.841) -- 0:01:00
      641500 -- (-1056.051) (-1049.565) (-1060.567) [-1055.509] * (-1061.214) (-1052.384) (-1056.259) [-1051.730] -- 0:01:00
      642000 -- (-1057.789) (-1053.287) (-1059.768) [-1057.068] * (-1057.943) (-1057.711) [-1054.877] (-1059.133) -- 0:01:00
      642500 -- (-1054.150) (-1059.338) [-1058.038] (-1052.207) * (-1058.172) [-1053.827] (-1052.842) (-1060.338) -- 0:01:00
      643000 -- [-1056.688] (-1059.835) (-1056.294) (-1052.878) * (-1059.714) [-1054.110] (-1058.674) (-1061.039) -- 0:00:59
      643500 -- (-1054.397) (-1055.993) (-1055.246) [-1052.382] * (-1057.001) [-1051.450] (-1055.579) (-1064.305) -- 0:01:00
      644000 -- (-1054.212) [-1052.709] (-1057.112) (-1051.103) * (-1051.460) [-1052.794] (-1058.703) (-1060.565) -- 0:01:00
      644500 -- (-1053.576) [-1057.748] (-1060.737) (-1051.162) * (-1059.577) (-1051.366) (-1054.895) [-1053.273] -- 0:01:00
      645000 -- [-1056.259] (-1055.875) (-1051.236) (-1050.805) * (-1054.953) (-1056.367) (-1054.832) [-1054.612] -- 0:00:59

      Average standard deviation of split frequencies: 0.000000

      645500 -- (-1058.218) (-1066.885) (-1057.375) [-1050.881] * (-1057.167) (-1054.303) (-1059.218) [-1054.565] -- 0:00:59
      646000 -- (-1053.659) (-1059.518) (-1054.689) [-1056.434] * (-1051.136) (-1053.088) [-1057.961] (-1058.939) -- 0:00:59
      646500 -- (-1058.294) (-1060.660) [-1054.345] (-1051.715) * (-1054.015) [-1060.310] (-1057.426) (-1055.611) -- 0:00:59
      647000 -- (-1060.761) (-1063.128) (-1059.099) [-1051.684] * (-1058.779) [-1055.572] (-1056.345) (-1058.437) -- 0:00:59
      647500 -- [-1051.297] (-1057.154) (-1051.038) (-1056.396) * (-1054.717) (-1060.462) [-1056.323] (-1053.517) -- 0:00:59
      648000 -- (-1052.113) [-1056.932] (-1051.564) (-1056.570) * [-1050.821] (-1055.526) (-1057.623) (-1056.542) -- 0:00:59
      648500 -- (-1058.777) [-1056.356] (-1052.904) (-1056.790) * (-1057.789) (-1055.403) (-1054.374) [-1055.751] -- 0:00:59
      649000 -- (-1055.621) [-1052.559] (-1062.472) (-1059.152) * [-1052.957] (-1051.038) (-1054.509) (-1053.089) -- 0:00:58
      649500 -- (-1051.973) [-1053.596] (-1063.810) (-1052.465) * (-1058.331) [-1052.379] (-1053.411) (-1057.221) -- 0:00:59
      650000 -- [-1055.503] (-1054.607) (-1060.698) (-1051.456) * (-1057.473) (-1057.176) (-1051.831) [-1051.748] -- 0:00:59

      Average standard deviation of split frequencies: 0.000000

      650500 -- [-1060.170] (-1055.971) (-1062.106) (-1050.006) * [-1057.368] (-1049.958) (-1066.193) (-1053.382) -- 0:00:59
      651000 -- (-1057.303) [-1051.187] (-1059.328) (-1055.719) * [-1053.952] (-1055.262) (-1062.088) (-1058.029) -- 0:00:58
      651500 -- [-1054.828] (-1055.063) (-1055.576) (-1054.965) * (-1054.257) (-1053.628) [-1048.130] (-1057.879) -- 0:00:58
      652000 -- (-1050.534) (-1060.175) (-1059.008) [-1053.624] * [-1054.188] (-1055.481) (-1051.139) (-1054.550) -- 0:00:58
      652500 -- [-1056.288] (-1060.651) (-1052.114) (-1057.340) * (-1050.581) [-1056.380] (-1055.899) (-1052.154) -- 0:00:58
      653000 -- [-1061.969] (-1063.455) (-1055.303) (-1061.280) * (-1052.762) (-1060.120) (-1055.116) [-1057.790] -- 0:00:58
      653500 -- (-1057.609) (-1055.650) [-1056.680] (-1056.988) * (-1058.354) (-1062.101) (-1053.277) [-1054.308] -- 0:00:58
      654000 -- (-1059.056) (-1050.713) [-1055.898] (-1052.177) * [-1050.006] (-1054.216) (-1051.941) (-1054.573) -- 0:00:58
      654500 -- [-1060.113] (-1049.914) (-1062.594) (-1062.396) * (-1055.184) (-1060.416) (-1054.025) [-1053.476] -- 0:00:58
      655000 -- (-1057.461) (-1058.125) (-1055.886) [-1064.493] * (-1055.602) (-1064.060) (-1054.862) [-1054.677] -- 0:00:57

      Average standard deviation of split frequencies: 0.000000

      655500 -- (-1055.373) [-1050.712] (-1063.588) (-1060.143) * (-1058.316) (-1054.998) (-1058.733) [-1052.406] -- 0:00:58
      656000 -- (-1054.693) [-1054.234] (-1060.897) (-1060.004) * (-1063.413) (-1054.871) (-1054.279) [-1056.664] -- 0:00:58
      656500 -- (-1056.508) (-1053.682) [-1053.362] (-1056.690) * (-1059.634) (-1063.304) (-1056.687) [-1055.270] -- 0:00:58
      657000 -- (-1052.294) (-1056.158) [-1052.060] (-1053.115) * (-1052.279) (-1056.014) (-1052.964) [-1057.008] -- 0:00:57
      657500 -- (-1060.380) (-1059.321) (-1053.618) [-1052.209] * [-1056.563] (-1057.161) (-1052.914) (-1051.473) -- 0:00:57
      658000 -- (-1056.460) (-1055.192) [-1052.881] (-1053.158) * [-1053.837] (-1054.120) (-1053.873) (-1057.051) -- 0:00:57
      658500 -- (-1060.436) (-1054.291) [-1054.117] (-1052.434) * [-1059.370] (-1067.230) (-1061.030) (-1052.217) -- 0:00:57
      659000 -- (-1057.899) (-1057.324) (-1060.682) [-1053.308] * (-1057.512) (-1059.894) [-1052.371] (-1055.988) -- 0:00:57
      659500 -- (-1059.518) (-1056.109) (-1054.515) [-1050.141] * [-1059.109] (-1058.007) (-1052.929) (-1052.396) -- 0:00:57
      660000 -- (-1055.611) (-1055.059) (-1052.319) [-1052.968] * (-1050.803) [-1054.837] (-1056.521) (-1051.519) -- 0:00:57

      Average standard deviation of split frequencies: 0.000000

      660500 -- [-1058.443] (-1053.547) (-1051.534) (-1055.783) * (-1056.205) (-1049.940) (-1054.616) [-1052.462] -- 0:00:57
      661000 -- (-1054.557) (-1056.131) [-1052.301] (-1053.978) * [-1058.520] (-1054.338) (-1055.557) (-1066.206) -- 0:00:56
      661500 -- (-1052.762) (-1058.853) [-1053.313] (-1054.189) * [-1051.739] (-1055.836) (-1052.187) (-1054.316) -- 0:00:57
      662000 -- [-1051.465] (-1061.423) (-1053.255) (-1058.334) * (-1057.496) [-1059.491] (-1054.012) (-1055.439) -- 0:00:57
      662500 -- [-1050.198] (-1049.908) (-1056.973) (-1054.818) * (-1052.225) (-1059.440) (-1053.592) [-1055.460] -- 0:00:57
      663000 -- (-1049.972) [-1051.258] (-1054.890) (-1053.736) * (-1055.195) [-1061.184] (-1055.285) (-1056.220) -- 0:00:56
      663500 -- [-1058.429] (-1058.737) (-1054.839) (-1055.696) * [-1051.739] (-1059.351) (-1057.430) (-1058.982) -- 0:00:56
      664000 -- (-1051.534) (-1060.591) (-1060.427) [-1056.260] * (-1052.601) (-1060.896) [-1054.125] (-1054.593) -- 0:00:56
      664500 -- (-1055.570) (-1052.567) (-1063.215) [-1052.719] * [-1054.029] (-1055.215) (-1061.078) (-1053.469) -- 0:00:56
      665000 -- (-1054.675) (-1058.999) (-1059.180) [-1052.280] * (-1056.045) [-1058.989] (-1057.404) (-1054.015) -- 0:00:56

      Average standard deviation of split frequencies: 0.000000

      665500 -- (-1056.833) (-1053.947) [-1052.492] (-1057.565) * [-1053.532] (-1054.496) (-1052.915) (-1051.692) -- 0:00:56
      666000 -- (-1053.701) (-1058.346) [-1059.745] (-1053.926) * (-1053.531) [-1049.921] (-1055.067) (-1057.750) -- 0:00:56
      666500 -- (-1054.282) (-1055.116) [-1056.358] (-1053.341) * (-1054.611) (-1054.750) [-1056.578] (-1050.477) -- 0:00:56
      667000 -- (-1054.325) [-1053.713] (-1064.704) (-1054.876) * (-1059.112) [-1052.952] (-1055.212) (-1053.830) -- 0:00:55
      667500 -- (-1055.842) (-1056.094) (-1054.934) [-1054.857] * [-1058.792] (-1055.968) (-1055.846) (-1051.063) -- 0:00:55
      668000 -- (-1052.739) (-1058.725) (-1050.510) [-1050.607] * (-1058.156) (-1057.741) [-1056.309] (-1049.579) -- 0:00:56
      668500 -- (-1053.946) (-1058.925) (-1054.234) [-1051.746] * (-1053.572) (-1059.367) (-1057.296) [-1056.581] -- 0:00:56
      669000 -- (-1054.699) (-1055.402) (-1055.819) [-1055.081] * (-1053.187) (-1055.008) (-1056.432) [-1051.844] -- 0:00:55
      669500 -- (-1051.585) (-1051.017) [-1053.866] (-1051.722) * (-1059.148) [-1054.102] (-1054.321) (-1053.988) -- 0:00:55
      670000 -- (-1054.281) (-1052.859) [-1049.306] (-1056.756) * (-1054.062) [-1057.318] (-1056.412) (-1067.618) -- 0:00:55

      Average standard deviation of split frequencies: 0.000000

      670500 -- (-1052.154) [-1053.938] (-1052.474) (-1055.285) * (-1058.715) [-1054.892] (-1059.074) (-1054.398) -- 0:00:55
      671000 -- (-1055.392) (-1056.951) [-1059.646] (-1061.143) * [-1054.141] (-1055.544) (-1066.015) (-1048.114) -- 0:00:55
      671500 -- (-1054.191) (-1059.550) [-1054.333] (-1063.568) * (-1055.343) (-1055.875) (-1059.624) [-1053.924] -- 0:00:55
      672000 -- (-1055.321) (-1054.649) [-1054.644] (-1058.347) * (-1052.321) (-1055.613) [-1059.011] (-1054.227) -- 0:00:55
      672500 -- (-1055.341) [-1064.092] (-1051.655) (-1061.879) * (-1051.020) (-1055.226) (-1051.988) [-1051.069] -- 0:00:55
      673000 -- (-1058.269) (-1054.305) [-1050.676] (-1059.548) * (-1055.099) (-1053.613) [-1050.117] (-1053.293) -- 0:00:54
      673500 -- [-1057.627] (-1060.618) (-1055.468) (-1057.567) * [-1057.377] (-1051.600) (-1054.798) (-1057.776) -- 0:00:54
      674000 -- (-1051.729) (-1059.581) [-1052.322] (-1052.990) * [-1055.638] (-1050.674) (-1060.124) (-1056.220) -- 0:00:55
      674500 -- (-1055.535) (-1059.203) [-1053.829] (-1053.984) * [-1056.140] (-1052.219) (-1058.591) (-1053.164) -- 0:00:55
      675000 -- [-1053.635] (-1064.706) (-1063.509) (-1055.417) * (-1064.267) (-1055.678) [-1056.061] (-1062.672) -- 0:00:54

      Average standard deviation of split frequencies: 0.000000

      675500 -- (-1057.661) [-1060.713] (-1054.272) (-1057.877) * (-1059.584) (-1053.135) (-1055.779) [-1054.260] -- 0:00:54
      676000 -- (-1063.288) (-1064.259) [-1054.006] (-1054.760) * (-1057.647) (-1055.059) (-1060.367) [-1051.940] -- 0:00:54
      676500 -- [-1055.395] (-1059.375) (-1051.978) (-1065.935) * (-1051.026) (-1056.347) (-1055.583) [-1054.814] -- 0:00:54
      677000 -- [-1056.299] (-1051.781) (-1051.775) (-1055.898) * (-1061.333) [-1057.028] (-1055.019) (-1062.885) -- 0:00:54
      677500 -- [-1055.573] (-1053.855) (-1056.106) (-1054.728) * [-1050.165] (-1056.319) (-1055.629) (-1054.807) -- 0:00:54
      678000 -- (-1054.531) [-1059.920] (-1057.019) (-1054.599) * (-1059.825) [-1052.180] (-1055.374) (-1052.836) -- 0:00:54
      678500 -- (-1062.426) [-1056.470] (-1051.986) (-1057.473) * (-1053.971) (-1056.546) [-1054.453] (-1057.952) -- 0:00:54
      679000 -- (-1056.736) (-1060.960) [-1060.122] (-1056.375) * [-1055.346] (-1056.740) (-1053.853) (-1051.799) -- 0:00:53
      679500 -- (-1055.626) [-1057.968] (-1067.463) (-1066.270) * (-1054.785) [-1053.825] (-1051.726) (-1053.755) -- 0:00:53
      680000 -- [-1056.316] (-1059.801) (-1069.548) (-1066.426) * [-1059.234] (-1057.757) (-1064.506) (-1051.906) -- 0:00:54

      Average standard deviation of split frequencies: 0.000000

      680500 -- (-1053.274) [-1059.688] (-1063.537) (-1058.159) * (-1057.488) (-1055.244) [-1058.095] (-1053.806) -- 0:00:53
      681000 -- (-1057.489) (-1056.202) (-1052.853) [-1059.413] * (-1060.052) [-1052.352] (-1063.447) (-1056.218) -- 0:00:53
      681500 -- (-1058.251) (-1058.084) [-1052.212] (-1061.558) * [-1050.690] (-1052.565) (-1057.565) (-1055.752) -- 0:00:53
      682000 -- (-1057.661) (-1055.177) [-1052.420] (-1054.496) * (-1061.566) [-1051.640] (-1056.605) (-1053.163) -- 0:00:53
      682500 -- (-1069.136) (-1053.644) (-1058.961) [-1052.618] * [-1057.538] (-1054.849) (-1058.337) (-1059.085) -- 0:00:53
      683000 -- (-1062.037) (-1058.065) [-1054.745] (-1058.677) * (-1058.184) [-1052.560] (-1061.679) (-1051.684) -- 0:00:53
      683500 -- (-1058.918) [-1055.181] (-1058.581) (-1061.723) * (-1059.324) [-1056.145] (-1055.719) (-1052.932) -- 0:00:53
      684000 -- (-1056.064) [-1052.921] (-1056.470) (-1057.435) * [-1052.019] (-1065.555) (-1060.126) (-1054.602) -- 0:00:53
      684500 -- [-1051.142] (-1050.178) (-1057.753) (-1059.630) * [-1051.390] (-1052.128) (-1059.072) (-1060.324) -- 0:00:53
      685000 -- (-1056.686) [-1049.868] (-1057.134) (-1054.700) * (-1055.890) (-1057.737) [-1058.932] (-1057.442) -- 0:00:52

      Average standard deviation of split frequencies: 0.000000

      685500 -- (-1061.318) [-1054.298] (-1054.902) (-1050.047) * (-1054.636) (-1057.074) (-1054.308) [-1053.684] -- 0:00:52
      686000 -- [-1057.106] (-1052.250) (-1057.421) (-1055.660) * (-1056.021) (-1056.190) (-1057.374) [-1056.564] -- 0:00:53
      686500 -- (-1053.910) (-1052.072) (-1055.486) [-1059.698] * (-1059.200) (-1050.992) (-1056.863) [-1054.253] -- 0:00:52
      687000 -- (-1057.572) (-1051.949) (-1055.164) [-1054.300] * (-1057.894) (-1055.327) [-1050.903] (-1051.971) -- 0:00:52
      687500 -- (-1055.493) [-1054.098] (-1057.229) (-1050.959) * (-1057.614) [-1058.812] (-1057.460) (-1060.365) -- 0:00:52
      688000 -- [-1055.195] (-1056.901) (-1057.399) (-1057.958) * (-1056.865) (-1054.950) (-1055.998) [-1057.075] -- 0:00:52
      688500 -- [-1054.681] (-1055.534) (-1056.350) (-1051.763) * (-1055.899) (-1055.391) (-1055.259) [-1055.114] -- 0:00:52
      689000 -- (-1053.429) (-1053.930) [-1051.343] (-1051.280) * (-1053.549) [-1056.496] (-1062.932) (-1059.728) -- 0:00:52
      689500 -- [-1056.727] (-1055.249) (-1063.676) (-1057.921) * (-1055.946) (-1057.858) [-1054.938] (-1054.003) -- 0:00:52
      690000 -- (-1058.730) (-1058.263) (-1060.511) [-1051.510] * (-1049.184) [-1048.794] (-1060.680) (-1053.592) -- 0:00:52

      Average standard deviation of split frequencies: 0.000000

      690500 -- [-1058.540] (-1057.360) (-1051.904) (-1053.002) * (-1056.221) [-1051.909] (-1060.938) (-1064.274) -- 0:00:51
      691000 -- (-1054.524) [-1055.830] (-1056.060) (-1056.892) * [-1054.549] (-1058.988) (-1052.357) (-1055.349) -- 0:00:51
      691500 -- (-1053.454) (-1058.083) (-1061.026) [-1051.738] * (-1059.331) (-1064.756) (-1053.834) [-1049.248] -- 0:00:51
      692000 -- (-1051.948) (-1058.621) (-1052.415) [-1050.290] * (-1052.861) (-1067.084) [-1058.669] (-1056.325) -- 0:00:52
      692500 -- (-1057.252) (-1068.193) (-1057.413) [-1048.840] * (-1052.801) (-1052.761) [-1054.506] (-1057.068) -- 0:00:51
      693000 -- (-1059.584) [-1056.826] (-1054.276) (-1060.731) * [-1052.641] (-1049.925) (-1054.219) (-1053.513) -- 0:00:51
      693500 -- [-1053.146] (-1052.523) (-1053.837) (-1057.091) * (-1052.777) [-1052.637] (-1050.411) (-1058.917) -- 0:00:51
      694000 -- (-1052.515) (-1050.471) [-1053.489] (-1059.662) * (-1058.087) (-1056.169) (-1052.901) [-1055.418] -- 0:00:51
      694500 -- [-1052.368] (-1052.456) (-1052.774) (-1059.373) * [-1053.444] (-1055.813) (-1051.676) (-1055.621) -- 0:00:51
      695000 -- (-1052.369) (-1051.717) (-1053.424) [-1052.734] * [-1056.283] (-1053.308) (-1055.439) (-1061.114) -- 0:00:51

      Average standard deviation of split frequencies: 0.000000

      695500 -- (-1052.527) (-1053.180) (-1055.982) [-1053.168] * (-1056.678) [-1058.108] (-1056.429) (-1059.971) -- 0:00:51
      696000 -- (-1058.018) [-1057.517] (-1055.104) (-1059.528) * (-1052.290) (-1053.089) [-1051.094] (-1064.718) -- 0:00:51
      696500 -- (-1056.594) (-1056.832) [-1058.087] (-1057.550) * (-1051.804) (-1049.988) [-1055.518] (-1060.518) -- 0:00:50
      697000 -- (-1062.552) (-1057.936) [-1057.318] (-1053.654) * (-1059.614) (-1055.179) [-1056.707] (-1060.165) -- 0:00:50
      697500 -- (-1051.666) (-1055.634) (-1051.234) [-1051.469] * (-1054.897) [-1056.808] (-1057.994) (-1055.578) -- 0:00:50
      698000 -- (-1053.049) (-1056.994) [-1051.862] (-1051.736) * (-1052.202) (-1050.181) (-1054.948) [-1057.688] -- 0:00:51
      698500 -- [-1050.876] (-1065.959) (-1051.313) (-1056.162) * (-1053.833) [-1051.627] (-1053.932) (-1058.125) -- 0:00:50
      699000 -- (-1057.668) (-1056.040) [-1055.598] (-1054.987) * (-1055.992) (-1056.212) (-1053.708) [-1055.396] -- 0:00:50
      699500 -- (-1051.516) (-1049.340) (-1059.392) [-1053.224] * (-1056.048) [-1053.101] (-1054.456) (-1058.144) -- 0:00:50
      700000 -- (-1054.384) [-1051.977] (-1050.910) (-1059.444) * (-1053.475) [-1052.356] (-1060.055) (-1053.237) -- 0:00:50

      Average standard deviation of split frequencies: 0.000000

      700500 -- (-1056.178) [-1054.149] (-1052.935) (-1055.320) * (-1051.541) [-1054.150] (-1059.427) (-1060.323) -- 0:00:50
      701000 -- (-1059.030) (-1059.795) (-1049.491) [-1056.925] * [-1052.641] (-1063.112) (-1058.059) (-1059.009) -- 0:00:50
      701500 -- [-1051.627] (-1058.047) (-1055.764) (-1062.964) * (-1051.295) (-1058.740) (-1060.998) [-1054.869] -- 0:00:50
      702000 -- (-1055.106) [-1056.208] (-1051.057) (-1065.982) * [-1053.014] (-1055.844) (-1052.411) (-1054.655) -- 0:00:50
      702500 -- (-1061.788) [-1051.052] (-1053.644) (-1050.244) * [-1059.907] (-1057.242) (-1052.268) (-1055.366) -- 0:00:49
      703000 -- (-1055.434) [-1053.482] (-1060.222) (-1058.393) * [-1054.950] (-1057.773) (-1056.374) (-1054.446) -- 0:00:49
      703500 -- (-1050.592) (-1055.469) (-1063.380) [-1054.961] * (-1054.636) (-1062.947) [-1055.817] (-1053.320) -- 0:00:49
      704000 -- [-1053.122] (-1052.000) (-1055.328) (-1059.551) * [-1051.236] (-1057.745) (-1054.850) (-1058.741) -- 0:00:50
      704500 -- (-1055.746) (-1054.503) [-1053.062] (-1056.330) * [-1051.924] (-1058.141) (-1054.700) (-1059.091) -- 0:00:49
      705000 -- (-1057.231) (-1058.653) (-1057.586) [-1058.653] * (-1056.385) (-1051.838) [-1054.037] (-1053.684) -- 0:00:49

      Average standard deviation of split frequencies: 0.000000

      705500 -- (-1056.426) (-1053.207) (-1054.224) [-1054.390] * [-1053.188] (-1059.300) (-1053.679) (-1052.003) -- 0:00:49
      706000 -- (-1058.056) (-1056.138) [-1061.919] (-1057.103) * (-1052.014) [-1054.615] (-1060.086) (-1057.390) -- 0:00:49
      706500 -- (-1054.848) (-1058.856) [-1066.068] (-1059.498) * (-1055.193) (-1051.197) [-1055.464] (-1052.104) -- 0:00:49
      707000 -- (-1049.749) [-1054.510] (-1061.649) (-1052.841) * [-1052.609] (-1054.401) (-1050.630) (-1058.800) -- 0:00:49
      707500 -- (-1060.818) (-1054.790) (-1062.234) [-1053.456] * [-1056.297] (-1056.569) (-1055.399) (-1062.787) -- 0:00:49
      708000 -- (-1060.056) [-1051.805] (-1061.156) (-1057.035) * (-1054.297) (-1063.208) [-1054.558] (-1063.912) -- 0:00:49
      708500 -- (-1058.071) [-1053.294] (-1055.261) (-1058.029) * (-1056.731) (-1058.100) [-1055.396] (-1056.062) -- 0:00:48
      709000 -- (-1056.696) (-1055.038) [-1053.560] (-1055.738) * (-1060.685) (-1054.763) (-1054.250) [-1051.234] -- 0:00:48
      709500 -- (-1056.252) [-1061.170] (-1051.674) (-1052.298) * (-1050.880) (-1053.778) [-1062.429] (-1056.438) -- 0:00:48
      710000 -- (-1052.764) (-1056.559) [-1052.184] (-1062.552) * [-1059.896] (-1052.749) (-1060.542) (-1055.921) -- 0:00:48

      Average standard deviation of split frequencies: 0.000000

      710500 -- [-1053.302] (-1053.952) (-1052.905) (-1052.814) * (-1059.273) (-1055.894) [-1054.130] (-1054.213) -- 0:00:48
      711000 -- (-1054.467) (-1058.250) [-1057.854] (-1056.726) * (-1058.977) (-1058.336) [-1055.666] (-1052.424) -- 0:00:48
      711500 -- (-1055.850) (-1054.843) [-1052.508] (-1060.945) * (-1056.820) [-1056.492] (-1055.088) (-1055.932) -- 0:00:48
      712000 -- (-1052.992) [-1053.547] (-1052.226) (-1057.929) * (-1054.705) [-1054.039] (-1061.036) (-1054.795) -- 0:00:48
      712500 -- [-1054.286] (-1059.284) (-1054.443) (-1059.353) * (-1061.141) (-1054.394) (-1053.474) [-1049.649] -- 0:00:48
      713000 -- (-1058.229) (-1061.120) (-1056.080) [-1056.070] * (-1056.205) (-1058.591) [-1052.873] (-1054.347) -- 0:00:48
      713500 -- [-1052.302] (-1055.904) (-1050.570) (-1053.628) * [-1053.414] (-1063.802) (-1054.886) (-1054.751) -- 0:00:48
      714000 -- [-1059.088] (-1052.769) (-1057.698) (-1051.514) * (-1054.947) (-1052.784) (-1063.684) [-1052.573] -- 0:00:48
      714500 -- (-1062.177) (-1064.711) [-1054.695] (-1054.483) * (-1058.166) [-1051.378] (-1056.131) (-1055.304) -- 0:00:47
      715000 -- (-1062.634) (-1052.807) (-1054.528) [-1050.590] * (-1056.633) (-1050.789) [-1049.250] (-1050.466) -- 0:00:47

      Average standard deviation of split frequencies: 0.000000

      715500 -- (-1053.119) (-1053.210) [-1057.100] (-1050.687) * (-1061.917) [-1052.655] (-1053.686) (-1054.091) -- 0:00:47
      716000 -- (-1056.571) (-1050.492) (-1053.157) [-1054.038] * [-1056.743] (-1054.652) (-1050.609) (-1064.928) -- 0:00:47
      716500 -- [-1055.783] (-1055.160) (-1058.798) (-1058.299) * [-1060.120] (-1065.987) (-1049.202) (-1057.507) -- 0:00:47
      717000 -- [-1054.740] (-1055.337) (-1051.727) (-1063.009) * (-1057.818) (-1056.315) [-1056.686] (-1052.309) -- 0:00:47
      717500 -- (-1055.886) (-1050.641) (-1056.367) [-1049.068] * (-1061.592) (-1059.706) (-1051.076) [-1050.349] -- 0:00:47
      718000 -- (-1054.088) [-1056.324] (-1054.831) (-1056.824) * (-1049.745) (-1052.743) [-1050.830] (-1056.363) -- 0:00:47
      718500 -- [-1055.258] (-1053.626) (-1058.449) (-1056.787) * (-1057.122) (-1055.355) (-1049.803) [-1054.905] -- 0:00:47
      719000 -- (-1055.087) (-1054.999) (-1055.057) [-1056.098] * [-1054.084] (-1054.512) (-1055.423) (-1054.943) -- 0:00:47
      719500 -- (-1055.630) (-1055.280) (-1059.153) [-1053.867] * (-1052.946) (-1055.366) (-1053.381) [-1053.622] -- 0:00:47
      720000 -- (-1055.007) (-1057.185) [-1061.345] (-1063.754) * (-1058.915) (-1055.352) (-1052.966) [-1053.075] -- 0:00:47

      Average standard deviation of split frequencies: 0.000000

      720500 -- (-1054.567) (-1054.276) (-1057.287) [-1052.711] * (-1055.415) (-1054.370) [-1056.553] (-1058.016) -- 0:00:46
      721000 -- (-1058.132) (-1050.090) [-1054.442] (-1054.398) * [-1051.916] (-1065.595) (-1051.885) (-1068.236) -- 0:00:46
      721500 -- (-1064.282) (-1055.269) (-1053.520) [-1050.466] * [-1050.099] (-1060.988) (-1055.293) (-1063.189) -- 0:00:46
      722000 -- (-1061.790) (-1059.532) [-1051.945] (-1059.045) * (-1055.521) (-1065.540) (-1051.450) [-1054.785] -- 0:00:46
      722500 -- (-1057.559) [-1051.820] (-1055.387) (-1055.575) * [-1052.116] (-1057.525) (-1053.687) (-1057.791) -- 0:00:46
      723000 -- [-1056.550] (-1050.861) (-1057.280) (-1058.845) * (-1052.146) (-1057.024) [-1052.925] (-1052.425) -- 0:00:46
      723500 -- (-1056.719) [-1053.652] (-1059.141) (-1060.659) * [-1054.130] (-1058.785) (-1053.426) (-1057.910) -- 0:00:46
      724000 -- (-1057.521) [-1056.518] (-1062.471) (-1055.391) * [-1056.048] (-1057.991) (-1054.175) (-1053.577) -- 0:00:46
      724500 -- (-1054.995) [-1053.720] (-1056.022) (-1054.760) * (-1052.654) (-1056.565) (-1058.610) [-1058.175] -- 0:00:46
      725000 -- [-1055.481] (-1058.616) (-1056.241) (-1058.736) * (-1053.652) (-1058.414) (-1054.251) [-1054.678] -- 0:00:46

      Average standard deviat