--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Tue Nov 22 06:20:27 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/3/Acp32CD-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1506.27         -1514.69
2      -1506.53         -1514.86
--------------------------------------
TOTAL    -1506.39         -1514.78
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.252387    0.003678    0.151895    0.373944    0.243768   1021.00   1142.94    1.000
r(A<->C){all}   0.131809    0.002224    0.045839    0.223297    0.127497    790.78    860.67    1.000
r(A<->G){all}   0.168353    0.002592    0.076695    0.266294    0.163026    901.31    960.42    1.000
r(A<->T){all}   0.084589    0.002439    0.003556    0.175050    0.077775    952.94    955.71    1.000
r(C<->G){all}   0.027743    0.000535    0.000001    0.073973    0.021818    849.71    982.55    1.000
r(C<->T){all}   0.420456    0.006083    0.281410    0.581248    0.418123    663.09    828.14    1.000
r(G<->T){all}   0.167050    0.002576    0.069914    0.259796    0.162658   1011.87   1138.42    1.000
pi(A){all}      0.245924    0.000227    0.217041    0.274699    0.245829   1416.84   1433.73    1.000
pi(C){all}      0.264489    0.000217    0.234881    0.291627    0.264310   1283.26   1365.28    1.000
pi(G){all}      0.333021    0.000263    0.304681    0.366913    0.332981   1297.41   1303.89    1.000
pi(T){all}      0.156566    0.000149    0.132433    0.180000    0.156183   1327.24   1377.41    1.000
alpha{1,2}      0.120116    0.013610    0.000119    0.314541    0.092237   1129.48   1304.32    1.000
alpha{3}        0.991351    0.320546    0.202877    2.166851    0.859633   1003.38   1168.65    1.000
pinvar{all}     0.438533    0.018065    0.162445    0.687206    0.453138   1016.73   1099.08    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1367.619309
Model 2: PositiveSelection	-1361.945148
Model 0: one-ratio	-1384.388692
Model 3: discrete	-1361.945148
Model 7: beta	-1367.73075
Model 8: beta&w>1	-1361.945575


Model 0 vs 1	33.53876600000012

Model 2 vs 1	11.348321999999825

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp32CD-PA)

            Pr(w>1)     post mean +- SE for w

    20 Q      0.564         2.730
    54 G      0.533         2.588
    62 P      0.517         2.510
    65 G      0.766         3.679
    66 T      0.605         2.924
    67 G      0.708         3.406
    69 H      0.983*        4.695
    81 N      0.985*        4.706
   101 I      0.988*        4.720
   105 E      0.999**       4.767
   108 G      0.990*        4.726
   112 G      0.981*        4.687
   113 K      0.973*        4.648
   116 S      0.578         2.797
   147 Q      0.990*        4.726
   148 D      0.999**       4.769
   153 G      0.995**       4.750
   154 Q      0.983*        4.693
   215 D      1.000**       4.772
   219 V      0.552         2.676
   226 Q      0.991**       4.731
   241 E      0.733         3.524

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp32CD-PA)

            Pr(w>1)     post mean +- SE for w

    65 G      0.553         3.600 +- 3.067
    69 H      0.768         4.945 +- 2.864
    81 N      0.811         5.243 +- 2.816
   101 I      0.819         5.272 +- 2.781
   105 E      0.893         5.716 +- 2.574
   108 G      0.860         5.558 +- 2.704
   112 G      0.744         4.779 +- 2.878
   113 K      0.724         4.699 +- 2.935
   147 Q      0.841         5.415 +- 2.741
   148 D      0.966*        6.193 +- 2.297
   153 G      0.915         5.894 +- 2.524
   154 Q      0.762         4.899 +- 2.866
   215 D      0.948         6.078 +- 2.380
   226 Q      0.858         5.534 +- 2.701


Model 8 vs 7	11.570349999999962

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp32CD-PA)

            Pr(w>1)     post mean +- SE for w

    20 Q      0.562         2.730
    54 G      0.532         2.588
    62 P      0.515         2.510
    65 G      0.765         3.679
    66 T      0.604         2.924
    67 G      0.707         3.405
    69 H      0.982*        4.693
    81 N      0.984*        4.704
   101 I      0.987*        4.719
   105 E      0.998**       4.771
   108 G      0.989*        4.726
   112 G      0.980*        4.685
   113 K      0.971*        4.643
   116 S      0.576         2.797
   147 Q      0.989*        4.726
   148 D      0.999**       4.773
   153 G      0.994**       4.752
   154 Q      0.981*        4.691
   215 D      0.999**       4.776
   219 V      0.551         2.675
   226 Q      0.990*        4.731
   241 E      0.731         3.519

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp32CD-PA)

            Pr(w>1)     post mean +- SE for w

    65 G      0.554         3.502 +- 3.219
    69 H      0.819         5.250 +- 2.976
    81 N      0.859         5.548 +- 2.892
   101 I      0.867         5.587 +- 2.853
   105 E      0.940         6.075 +- 2.563
   108 G      0.901         5.844 +- 2.751
   112 G      0.795         5.074 +- 3.010
   113 K      0.774         4.967 +- 3.078
   147 Q      0.886         5.722 +- 2.798
   148 D      0.983*        6.375 +- 2.352
   153 G      0.946         6.141 +- 2.555
   154 Q      0.812         5.198 +- 2.984
   215 D      0.975*        6.321 +- 2.394
   226 Q      0.901         5.830 +- 2.748

>C1
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGTGDSPHSQEGDGSAATDNPNDDHATSADNSLAT
DGDAIGKKESGGGSDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKDR
QDKEEEAGQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSGS
NAGSNQRDNGARESSQENQDAKEVASEAPAQRAGNVPDGPETGAKEDDYE
EMoo
>C2
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGPGDHSQDGDGSAATDSPNDDHATSADNSLATDG
DAIGKKESGNGSDGKSDAKDSSGGNDATPANGHDDDNDDSDSKDAKDRKS
KEEEAGQEGKRNDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSGSNA
GSNQRDNGARESSQENQEAKEVVSEAPAQRAALAAGNVPDGPETGAKDDD
YEEM
>C3
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGPGDRSQDGDGSAATDSPNDDHATSADNSLATDG
DAIGKKESGNGSDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKDRKS
KEEEAVQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSGSNA
GSNQRDNGARESSQENQDAKEVASEAPAQRAALAAGNVPDGPETGAKDDD
YEEM
>C4
MWRMRMRLLTGYLVLLALGHLPEHGALGQKYYMNFAFNNNNPDGEGGTGA
DGGAAGGGPAGAGGATSDRSQEGDGSAATDRPNDDHATSADNSLATDGDA
GDKKSSGDGKSDSDSDSKDSSGGNAATPANGHDDDNDDSDSKDVKDRHSK
EDAAAEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSGSNAGS
NQRDSGARDSSQETQTAKEMASEAPAARAPRVAGNVPDGPETGAKEDDYE
EMoo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=259 

C1              MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
C2              MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
C3              MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
C4              MWRMRMRLLTGYLVLLALGHLPEHGALGQKYYMNFAFNNNNPDGEGGTGA
                *******************:*****************************.

C1              DGGGGGAGGGAAGPGGGTGDSPHSQEGDGSAATDNPNDDHATSADNSLAT
C2              DGGGGGAGGGAAGPGGGPGD--HSQDGDGSAATDSPNDDHATSADNSLAT
C3              DGGGGGAGGGAAGPGGGPGD--RSQDGDGSAATDSPNDDHATSADNSLAT
C4              DG--GAAGGGPAGAGGATSD--RSQEGDGSAATDRPNDDHATSADNSLAT
                **  *.****.**.**...*  :**:******** ***************

C1              DGDAIGKKESGGG-SDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD
C2              DGDAIGKKESGNG-SDGKSDAKDSSGGNDATPANGHDDDNDDSDSKDAKD
C3              DGDAIGKKESGNG-SDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD
C4              DGDAGDKKSSGDGKSDSDSDSKDSSGGNAATPANGHDDDNDDSDSKDVKD
                **** .**.**.* **..**:******* ******************.**

C1              RQDKEEEAGQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
C2              RKSKEEEAGQEGKRNDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
C3              RKSKEEEAVQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
C4              RHSKED-AAAEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
                *:.**: *  ****.***********************************

C1              SNAGSNQRDNGARESSQENQDAKEVASEAPAQR----AGNVPDGPETGAK
C2              SNAGSNQRDNGARESSQENQEAKEVVSEAPAQRAALAAGNVPDGPETGAK
C3              SNAGSNQRDNGARESSQENQDAKEVASEAPAQRAALAAGNVPDGPETGAK
C4              SNAGSNQRDSGARDSSQETQTAKEMASEAPAARAPRVAGNVPDGPETGAK
                *********.***:****.* ***:.***** *    *************

C1              EDDYEEMoo
C2              DDDYEEM--
C3              DDDYEEM--
C4              EDDYEEMoo
                :******  




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  254 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  254 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3286]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [3286]--->[3230]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.228 Mb, Max= 30.475 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGTGDSPHSQEGDGSAATDNPNDDHATSADNSLAT
DGDAIGKKESGGG-SDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD
RQDKEEEAGQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDNGARESSQENQDAKEVASEAPAQR----AGNVPDGPETGAK
EDDYEEMoo
>C2
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGPGD--HSQDGDGSAATDSPNDDHATSADNSLAT
DGDAIGKKESGNG-SDGKSDAKDSSGGNDATPANGHDDDNDDSDSKDAKD
RKSKEEEAGQEGKRNDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDNGARESSQENQEAKEVVSEAPAQRAALAAGNVPDGPETGAK
DDDYEEM--
>C3
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGPGD--RSQDGDGSAATDSPNDDHATSADNSLAT
DGDAIGKKESGNG-SDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD
RKSKEEEAVQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDNGARESSQENQDAKEVASEAPAQRAALAAGNVPDGPETGAK
DDDYEEM--
>C4
MWRMRMRLLTGYLVLLALGHLPEHGALGQKYYMNFAFNNNNPDGEGGTGA
DG--GAAGGGPAGAGGATSD--RSQEGDGSAATDRPNDDHATSADNSLAT
DGDAGDKKSSGDGKSDSDSDSKDSSGGNAATPANGHDDDNDDSDSKDVKD
RHSKED-AAAEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDSGARDSSQETQTAKEMASEAPAARAPRVAGNVPDGPETGAK
EDDYEEMoo

FORMAT of file /tmp/tmp5728493890385587781aln Not Supported[FATAL:T-COFFEE]
>C1
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGTGDSPHSQEGDGSAATDNPNDDHATSADNSLAT
DGDAIGKKESGGG-SDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD
RQDKEEEAGQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDNGARESSQENQDAKEVASEAPAQR----AGNVPDGPETGAK
EDDYEEMoo
>C2
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGPGD--HSQDGDGSAATDSPNDDHATSADNSLAT
DGDAIGKKESGNG-SDGKSDAKDSSGGNDATPANGHDDDNDDSDSKDAKD
RKSKEEEAGQEGKRNDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDNGARESSQENQEAKEVVSEAPAQRAALAAGNVPDGPETGAK
DDDYEEM--
>C3
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGPGD--RSQDGDGSAATDSPNDDHATSADNSLAT
DGDAIGKKESGNG-SDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD
RKSKEEEAVQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDNGARESSQENQDAKEVASEAPAQRAALAAGNVPDGPETGAK
DDDYEEM--
>C4
MWRMRMRLLTGYLVLLALGHLPEHGALGQKYYMNFAFNNNNPDGEGGTGA
DG--GAAGGGPAGAGGATSD--RSQEGDGSAATDRPNDDHATSADNSLAT
DGDAGDKKSSGDGKSDSDSDSKDSSGGNAATPANGHDDDNDDSDSKDVKD
RHSKED-AAAEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDSGARDSSQETQTAKEMASEAPAARAPRVAGNVPDGPETGAK
EDDYEEMoo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:259 S:98 BS:259
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES 
BOT	    0    1	 95.60 C1	 C2	 95.60
TOP	    1    0	 95.60 C2	 C1	 95.60
BOT	    0    2	 96.40 C1	 C3	 96.40
TOP	    2    0	 96.40 C3	 C1	 96.40
BOT	    0    3	 88.76 C1	 C4	 88.76
TOP	    3    0	 88.76 C4	 C1	 88.76
BOT	    1    2	 97.64 C2	 C3	 97.64
TOP	    2    1	 97.64 C3	 C2	 97.64
BOT	    1    3	 85.66 C2	 C4	 85.66
TOP	    3    1	 85.66 C4	 C2	 85.66
BOT	    2    3	 87.25 C3	 C4	 87.25
TOP	    3    2	 87.25 C4	 C3	 87.25
AVG	 0	 C1	  *	 93.58
AVG	 1	 C2	  *	 92.97
AVG	 2	 C3	  *	 93.76
AVG	 3	 C4	  *	 87.22
TOT	 TOT	  *	 91.88
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC
C2              ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC
C3              ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC
C4              ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC
                **************************************************

C1              CCTCGGCCAACTGCCGGAGCATGGCGCTCTGGGCCAGAAGTACTACATGA
C2              CCTCGGCCAACTGCCGGAGCATGGCGCTCTGGGCCAGAAGTATTACATGA
C3              CCTCGGCCAACTGCCGGAGCATGGCGCTCTGGGCCAGAAGTATTACATGA
C4              CCTCGGCCATCTGCCGGAGCATGGCGCTCTGGGCCAGAAGTACTACATGA
                *********:******************************** *******

C1              ACTTTGCCTTCAACAACAATAATCCGGATGGCGAAGGAGGCACCGGCGTC
C2              ACTTTGCCTTCAACAACAATAATCCGGATGGCGAAGGAGGCACCGGCGTC
C3              ACTTTGCCTTCAACAACAATAATCCGGATGGCGAAGGAGGCACCGGCGTC
C4              ACTTCGCCTTCAACAACAATAATCCGGATGGAGAAGGAGGCACCGGCGCC
                **** **************************.**************** *

C1              GATGGTGGCGGTGGTGGTGCTGGTGGTGGTGCCGCTGGTCCCGGCGGTGG
C2              GATGGTGGCGGTGGTGGTGCTGGTGGTGGTGCCGCTGGTCCCGGCGGTGG
C3              GATGGTGGCGGTGGTGGTGCTGGCGGTGGTGCCGCTGGTCCCGGCGGTGG
C4              GATGGT------GGCGCTGCTGGTGGTGGTCCCGCTGGTGCCGGTGGTGC
                ******      ** * ****** ****** ******** **** **** 

C1              AACCGGGGATTCGCCTCATTCACAAGAAGGTGACGGTAGTGCTGCGACGG
C2              ACCCGGGGAT------CATTCACAAGATGGTGACGGTAGTGCTGCGACGG
C3              ACCCGGTGAT------CGTTCACAAGATGGTGACGGTAGTGCTGCGACGG
C4              AACCAGTGAT------CGTTCACAAGAAGGTGACGGTAGTGCGGCGACGG
                *.**.* ***      *.*********:************** *******

C1              ATAACCCCAATGACGACCACGCTACATCTGCTGATAATAGTTTGGCTACC
C2              ATAGCCCCAATGACGACCACGCTACATCTGCTGATAATAGTTTGGCTACT
C3              ATAGCCCCAATGACGACCACGCTACATCTGCTGATAATAGTTTGGCTACT
C4              ATCGTCCCAATGACGACCACGCTACATCCGCTGATAATAGTTTGGCTACT
                **.. *********************** ******************** 

C1              GATGGCGATGCCATTGGTAAGAAGGAAAGCGGCGGTGGT---AGCGATGG
C2              GATGGCGATGCCATTGGTAAGAAGGAAAGCGGCAATGGT---AGCGATGG
C3              GATGGCGATGCCATTGGTAAGAAGGAAAGCGGCAATGGT---AGCGATGG
C4              GATGGCGATGCCGGTGATAAGAAAAGTAGTGGAGATGGCAAGAGCGACTC
                ************. **.******...:** **...***    *****   

C1              CAAGAGCGACTCCAAAGACTCGAGCGGAGGCAATGATGCCACGCCAGCGA
C2              CAAAAGCGACGCCAAAGACTCGAGCGGAGGCAATGATGCCACGCCAGCGA
C3              CAAAAGCGACTCCAAAGACTCGAGCGGAGGCAATGATGCCACGCCAGCGA
C4              CGACAGCGATTCCAAAGACTCGAGCGGAGGCAATGCTGCCACGCCAGCGA
                *.* *****  ************************.**************

C1              ATGGTCATGACGATGACAACGATGACAGCGACAGCAAGGATGCCAAGGAT
C2              ATGGTCATGACGATGACAACGATGACAGCGACAGCAAGGATGCCAAGGAT
C3              ATGGTCATGACGATGACAACGATGACAGCGACAGCAAGGATGCCAAGGAT
C4              ATGGTCATGACGATGATAACGATGACAGCGACAGCAAGGATGTCAAGGAT
                **************** ************************* *******

C1              CGACAAGATAAGGAAGAGGAGGCCGGACAGGAGGGGAAGCGCACCGATCA
C2              CGAAAATCGAAGGAGGAGGAGGCCGGACAGGAGGGGAAGCGCAACGATCA
C3              CGAAAATCGAAGGAGGAGGAGGCCGTACAGGAGGGGAAGCGCACCGATCA
C4              CGGCATTCGAAGGAGGAT---GCCGCAGCGGAGGGTAAACGCACCGATCA
                **..*: . *****.**    **** * .****** **.****.******

C1              CAGCCATCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC
C2              CAGCCATCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC
C3              CAGCCATCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC
C4              CAGCCACCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC
                ****** *******************************************

C1              GGTACGTGCGGTCCATTTACGAGAGCAGCGAGAGCCACGGACATTCCGGC
C2              GGTACGTGCGGTCCATTTACGAGAGCAGCGAGAGCCACGGACATTCCGGC
C3              GGTACGTGCGGTCCATTTACGAGAGCAGCGAGAGCCACGGACATTCCGGC
C4              GCTACGTGCGCTCCATTTACGAGAGCAGCGAGAGCCACGGCCACTCCGGC
                * ******** *****************************.** ******

C1              AGCAATGCCGGCTCCAATCAGCGGGACAATGGAGCCCGTGAGAGCAGTCA
C2              AGCAATGCCGGCTCCAATCAGCGGGACAACGGAGCCCGTGAGAGCAGTCA
C3              AGCAATGCCGGCTCCAATCAGCGGGACAACGGAGCCCGTGAGAGCAGTCA
C4              AGCAATGCCGGCTCCAATCAGCGGGACAGCGGAGCCCGCGATAGCAGTCA
                ****************************. ******** ** ********

C1              GGAGAACCAGGATGCCAAGGAAGTGGCCAGCGAAGCGCCTGCTCAACGG-
C2              GGAGAACCAGGAGGCCAAGGAAGTGGTTAGCGAAGCGCCTGCTCAACGGG
C3              GGAGAACCAGGATGCCAAGGAAGTGGCCAGCGAAGCGCCTGCTCAACGGG
C4              GGAGACCCAGACCGCCAAGGAAATGGCCAGTGAAGCCCCTGCTGCACGGG
                *****.****.. *********.***  ** ***** ****** .**** 

C1              -----------GCAGGCAACGTGCCAGATGGACCCGAAACTGGAGCCAAG
C2              CAGCTCTCGCCGCTGGCAATGTGCCGGATGGACCCGAAACTGGAGCCAAG
C3              CAGCTCTCGCCGCTGGCAATGTGCCGGATGGACCCGAAACTGGAGCCAAG
C4              CACCTCGCGTCGCTGGCAACGTGCCGGATGGGCCCGAAACTGGAGCCAAG
                           **:***** *****.*****.******************

C1              GAAGATGACTACGAGGAGATG------
C2              GACGATGACTACGAGGAGATG------
C3              GACGATGACTACGAGGAGATG------
C4              GAGGATGACTACGAGGAAATG------
                ** **************.***      



>C1
ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC
CCTCGGCCAACTGCCGGAGCATGGCGCTCTGGGCCAGAAGTACTACATGA
ACTTTGCCTTCAACAACAATAATCCGGATGGCGAAGGAGGCACCGGCGTC
GATGGTGGCGGTGGTGGTGCTGGTGGTGGTGCCGCTGGTCCCGGCGGTGG
AACCGGGGATTCGCCTCATTCACAAGAAGGTGACGGTAGTGCTGCGACGG
ATAACCCCAATGACGACCACGCTACATCTGCTGATAATAGTTTGGCTACC
GATGGCGATGCCATTGGTAAGAAGGAAAGCGGCGGTGGT---AGCGATGG
CAAGAGCGACTCCAAAGACTCGAGCGGAGGCAATGATGCCACGCCAGCGA
ATGGTCATGACGATGACAACGATGACAGCGACAGCAAGGATGCCAAGGAT
CGACAAGATAAGGAAGAGGAGGCCGGACAGGAGGGGAAGCGCACCGATCA
CAGCCATCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC
GGTACGTGCGGTCCATTTACGAGAGCAGCGAGAGCCACGGACATTCCGGC
AGCAATGCCGGCTCCAATCAGCGGGACAATGGAGCCCGTGAGAGCAGTCA
GGAGAACCAGGATGCCAAGGAAGTGGCCAGCGAAGCGCCTGCTCAACGG-
-----------GCAGGCAACGTGCCAGATGGACCCGAAACTGGAGCCAAG
GAAGATGACTACGAGGAGATG------
>C2
ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC
CCTCGGCCAACTGCCGGAGCATGGCGCTCTGGGCCAGAAGTATTACATGA
ACTTTGCCTTCAACAACAATAATCCGGATGGCGAAGGAGGCACCGGCGTC
GATGGTGGCGGTGGTGGTGCTGGTGGTGGTGCCGCTGGTCCCGGCGGTGG
ACCCGGGGAT------CATTCACAAGATGGTGACGGTAGTGCTGCGACGG
ATAGCCCCAATGACGACCACGCTACATCTGCTGATAATAGTTTGGCTACT
GATGGCGATGCCATTGGTAAGAAGGAAAGCGGCAATGGT---AGCGATGG
CAAAAGCGACGCCAAAGACTCGAGCGGAGGCAATGATGCCACGCCAGCGA
ATGGTCATGACGATGACAACGATGACAGCGACAGCAAGGATGCCAAGGAT
CGAAAATCGAAGGAGGAGGAGGCCGGACAGGAGGGGAAGCGCAACGATCA
CAGCCATCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC
GGTACGTGCGGTCCATTTACGAGAGCAGCGAGAGCCACGGACATTCCGGC
AGCAATGCCGGCTCCAATCAGCGGGACAACGGAGCCCGTGAGAGCAGTCA
GGAGAACCAGGAGGCCAAGGAAGTGGTTAGCGAAGCGCCTGCTCAACGGG
CAGCTCTCGCCGCTGGCAATGTGCCGGATGGACCCGAAACTGGAGCCAAG
GACGATGACTACGAGGAGATG------
>C3
ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC
CCTCGGCCAACTGCCGGAGCATGGCGCTCTGGGCCAGAAGTATTACATGA
ACTTTGCCTTCAACAACAATAATCCGGATGGCGAAGGAGGCACCGGCGTC
GATGGTGGCGGTGGTGGTGCTGGCGGTGGTGCCGCTGGTCCCGGCGGTGG
ACCCGGTGAT------CGTTCACAAGATGGTGACGGTAGTGCTGCGACGG
ATAGCCCCAATGACGACCACGCTACATCTGCTGATAATAGTTTGGCTACT
GATGGCGATGCCATTGGTAAGAAGGAAAGCGGCAATGGT---AGCGATGG
CAAAAGCGACTCCAAAGACTCGAGCGGAGGCAATGATGCCACGCCAGCGA
ATGGTCATGACGATGACAACGATGACAGCGACAGCAAGGATGCCAAGGAT
CGAAAATCGAAGGAGGAGGAGGCCGTACAGGAGGGGAAGCGCACCGATCA
CAGCCATCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC
GGTACGTGCGGTCCATTTACGAGAGCAGCGAGAGCCACGGACATTCCGGC
AGCAATGCCGGCTCCAATCAGCGGGACAACGGAGCCCGTGAGAGCAGTCA
GGAGAACCAGGATGCCAAGGAAGTGGCCAGCGAAGCGCCTGCTCAACGGG
CAGCTCTCGCCGCTGGCAATGTGCCGGATGGACCCGAAACTGGAGCCAAG
GACGATGACTACGAGGAGATG------
>C4
ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC
CCTCGGCCATCTGCCGGAGCATGGCGCTCTGGGCCAGAAGTACTACATGA
ACTTCGCCTTCAACAACAATAATCCGGATGGAGAAGGAGGCACCGGCGCC
GATGGT------GGCGCTGCTGGTGGTGGTCCCGCTGGTGCCGGTGGTGC
AACCAGTGAT------CGTTCACAAGAAGGTGACGGTAGTGCGGCGACGG
ATCGTCCCAATGACGACCACGCTACATCCGCTGATAATAGTTTGGCTACT
GATGGCGATGCCGGTGATAAGAAAAGTAGTGGAGATGGCAAGAGCGACTC
CGACAGCGATTCCAAAGACTCGAGCGGAGGCAATGCTGCCACGCCAGCGA
ATGGTCATGACGATGATAACGATGACAGCGACAGCAAGGATGTCAAGGAT
CGGCATTCGAAGGAGGAT---GCCGCAGCGGAGGGTAAACGCACCGATCA
CAGCCACCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC
GCTACGTGCGCTCCATTTACGAGAGCAGCGAGAGCCACGGCCACTCCGGC
AGCAATGCCGGCTCCAATCAGCGGGACAGCGGAGCCCGCGATAGCAGTCA
GGAGACCCAGACCGCCAAGGAAATGGCCAGTGAAGCCCCTGCTGCACGGG
CACCTCGCGTCGCTGGCAACGTGCCGGATGGGCCCGAAACTGGAGCCAAG
GAGGATGACTACGAGGAAATG------
>C1
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGTGDSPHSQEGDGSAATDNPNDDHATSADNSLAT
DGDAIGKKESGGGoSDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD
RQDKEEEAGQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDNGARESSQENQDAKEVASEAPAQRooooAGNVPDGPETGAK
EDDYEEM
>C2
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGPGDooHSQDGDGSAATDSPNDDHATSADNSLAT
DGDAIGKKESGNGoSDGKSDAKDSSGGNDATPANGHDDDNDDSDSKDAKD
RKSKEEEAGQEGKRNDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDNGARESSQENQEAKEVVSEAPAQRAALAAGNVPDGPETGAK
DDDYEEM
>C3
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGPGDooRSQDGDGSAATDSPNDDHATSADNSLAT
DGDAIGKKESGNGoSDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD
RKSKEEEAVQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDNGARESSQENQDAKEVASEAPAQRAALAAGNVPDGPETGAK
DDDYEEM
>C4
MWRMRMRLLTGYLVLLALGHLPEHGALGQKYYMNFAFNNNNPDGEGGTGA
DGooGAAGGGPAGAGGATSDooRSQEGDGSAATDRPNDDHATSADNSLAT
DGDAGDKKSSGDGKSDSDSDSKDSSGGNAATPANGHDDDNDDSDSKDVKD
RHSKEDoAAAEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDSGARDSSQETQTAKEMASEAPAARAPRVAGNVPDGPETGAK
EDDYEEM


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 4 taxa and 777 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1479795438
      Setting output file names to "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 87832147
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 4878404043
      Seed = 2102598681
      Swapseed = 1479795438
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.35 %   Dirichlet(Revmat{all})
            1.35 %   Slider(Revmat{all})
            1.35 %   Dirichlet(Pi{all})
            1.35 %   Slider(Pi{all})
            2.70 %   Multiplier(Alpha{1,2})
            2.70 %   Multiplier(Alpha{3})
            2.70 %   Slider(Pinvar{all})
           13.51 %   NNI(Tau{all},V{all})
           13.51 %   ParsSPR(Tau{all},V{all})
           40.54 %   Multiplier(V{all})
           13.51 %   Nodeslider(V{all})
            5.41 %   TLMultiplier(V{all})

      Division 1 has 23 unique site patterns
      Division 2 has 26 unique site patterns
      Division 3 has 37 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1756.756316 -- -26.620141
         Chain 2 -- -1762.066364 -- -26.620141
         Chain 3 -- -1743.184710 -- -26.620141
         Chain 4 -- -1762.066364 -- -26.620141

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1756.756316 -- -26.620141
         Chain 2 -- -1743.184710 -- -26.620141
         Chain 3 -- -1762.066364 -- -26.620141
         Chain 4 -- -1743.184710 -- -26.620141


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1756.756] (-1762.066) (-1743.185) (-1762.066) * [-1756.756] (-1743.185) (-1762.066) (-1743.185) 
        500 -- [-1520.809] (-1525.637) (-1530.702) (-1522.773) * (-1530.771) (-1521.257) (-1524.513) [-1519.252] -- 0:00:00
       1000 -- [-1513.330] (-1523.451) (-1529.328) (-1517.531) * (-1513.097) (-1519.221) [-1519.136] (-1519.407) -- 0:00:00
       1500 -- [-1514.507] (-1522.262) (-1523.084) (-1513.783) * [-1517.243] (-1522.747) (-1516.125) (-1521.470) -- 0:00:00
       2000 -- (-1515.031) [-1519.908] (-1525.244) (-1509.505) * [-1512.451] (-1511.605) (-1516.491) (-1529.371) -- 0:00:00
       2500 -- [-1512.669] (-1521.519) (-1520.508) (-1507.437) * (-1512.609) (-1513.418) [-1513.859] (-1523.535) -- 0:00:00
       3000 -- [-1514.224] (-1521.806) (-1515.318) (-1513.582) * (-1508.877) [-1507.933] (-1517.487) (-1514.583) -- 0:00:00
       3500 -- [-1515.905] (-1513.358) (-1514.842) (-1514.571) * (-1512.757) (-1515.973) (-1515.634) [-1509.304] -- 0:00:00
       4000 -- (-1511.418) [-1513.228] (-1517.415) (-1516.048) * [-1506.544] (-1514.418) (-1511.607) (-1512.992) -- 0:00:00
       4500 -- (-1512.775) (-1511.210) (-1510.298) [-1508.401] * (-1507.673) (-1515.651) (-1511.162) [-1512.758] -- 0:00:00
       5000 -- [-1505.913] (-1510.620) (-1515.139) (-1507.871) * (-1511.669) (-1510.272) (-1518.466) [-1513.312] -- 0:00:00

      Average standard deviation of split frequencies: 0.078567

       5500 -- (-1509.404) (-1510.020) (-1517.526) [-1514.301] * [-1508.951] (-1514.211) (-1521.849) (-1512.413) -- 0:00:00
       6000 -- (-1505.519) [-1506.828] (-1523.114) (-1509.466) * [-1507.342] (-1511.905) (-1509.833) (-1511.498) -- 0:00:00
       6500 -- (-1511.420) (-1514.892) (-1512.708) [-1507.713] * [-1504.163] (-1519.103) (-1512.961) (-1509.880) -- 0:02:32
       7000 -- (-1509.402) (-1513.097) (-1514.648) [-1508.016] * (-1504.656) (-1514.314) [-1507.535] (-1510.508) -- 0:02:21
       7500 -- (-1510.414) (-1511.092) (-1509.805) [-1507.275] * (-1511.104) (-1511.237) [-1506.917] (-1512.457) -- 0:02:12
       8000 -- (-1508.021) [-1511.213] (-1508.089) (-1507.540) * (-1508.735) (-1508.746) [-1510.273] (-1508.235) -- 0:02:04
       8500 -- (-1512.965) (-1507.901) (-1509.511) [-1511.763] * (-1507.468) [-1505.772] (-1510.948) (-1512.192) -- 0:01:56
       9000 -- (-1509.827) (-1508.944) (-1505.646) [-1507.413] * (-1512.764) (-1509.924) (-1509.680) [-1510.031] -- 0:01:50
       9500 -- (-1509.389) (-1511.440) (-1512.780) [-1505.552] * (-1506.470) [-1508.661] (-1509.980) (-1514.168) -- 0:01:44
      10000 -- (-1511.050) (-1512.777) (-1505.036) [-1504.947] * (-1511.501) (-1513.915) [-1508.323] (-1515.343) -- 0:01:39

      Average standard deviation of split frequencies: 0.088388

      10500 -- [-1507.854] (-1506.455) (-1507.639) (-1509.371) * [-1509.463] (-1517.954) (-1513.332) (-1516.651) -- 0:01:34
      11000 -- [-1503.801] (-1507.371) (-1505.162) (-1508.728) * [-1505.711] (-1508.240) (-1510.486) (-1515.403) -- 0:01:29
      11500 -- (-1509.444) [-1509.241] (-1506.251) (-1508.922) * [-1507.639] (-1506.604) (-1509.618) (-1515.873) -- 0:01:25
      12000 -- [-1507.583] (-1510.077) (-1507.134) (-1509.556) * (-1510.252) (-1509.465) [-1511.421] (-1513.151) -- 0:01:22
      12500 -- (-1513.233) [-1506.928] (-1507.601) (-1509.756) * (-1511.069) [-1505.352] (-1510.179) (-1510.191) -- 0:01:19
      13000 -- (-1509.416) [-1503.572] (-1507.748) (-1510.415) * (-1515.212) (-1505.417) [-1510.157] (-1518.056) -- 0:01:15
      13500 -- (-1509.407) (-1514.417) [-1509.234] (-1510.057) * (-1508.313) (-1510.216) (-1508.961) [-1510.330] -- 0:01:13
      14000 -- (-1510.610) [-1510.918] (-1507.309) (-1507.763) * (-1513.873) (-1509.231) (-1507.946) [-1509.864] -- 0:02:20
      14500 -- [-1505.963] (-1505.725) (-1506.736) (-1510.670) * (-1514.985) (-1512.514) [-1510.820] (-1511.912) -- 0:02:15
      15000 -- (-1512.699) (-1512.326) [-1508.777] (-1509.483) * (-1512.347) [-1509.696] (-1510.285) (-1508.569) -- 0:02:11

      Average standard deviation of split frequencies: 0.103120

      15500 -- [-1508.908] (-1512.663) (-1508.897) (-1513.734) * (-1506.614) (-1510.575) (-1507.619) [-1506.770] -- 0:02:07
      16000 -- [-1505.145] (-1517.465) (-1510.835) (-1513.838) * (-1506.409) [-1509.047] (-1509.890) (-1509.791) -- 0:02:03
      16500 -- (-1507.904) (-1525.156) [-1510.995] (-1512.283) * [-1510.089] (-1514.246) (-1514.279) (-1507.031) -- 0:01:59
      17000 -- [-1508.117] (-1520.519) (-1513.942) (-1507.742) * (-1508.163) [-1509.307] (-1510.756) (-1513.473) -- 0:01:55
      17500 -- (-1510.777) (-1515.390) (-1515.418) [-1505.040] * (-1510.463) [-1506.945] (-1509.471) (-1513.709) -- 0:01:52
      18000 -- (-1508.074) (-1517.363) [-1515.540] (-1510.067) * (-1507.663) [-1508.420] (-1512.372) (-1511.986) -- 0:01:49
      18500 -- (-1516.065) (-1515.916) (-1513.863) [-1509.107] * (-1506.768) (-1508.041) [-1507.774] (-1518.045) -- 0:01:46
      19000 -- (-1515.387) (-1513.530) (-1518.687) [-1507.469] * (-1507.654) (-1508.858) [-1509.259] (-1512.365) -- 0:01:43
      19500 -- (-1519.143) (-1510.781) (-1510.768) [-1508.132] * (-1505.571) (-1505.220) [-1508.282] (-1513.972) -- 0:01:40
      20000 -- (-1517.001) (-1509.245) [-1507.799] (-1509.496) * (-1508.969) (-1512.480) [-1510.980] (-1507.716) -- 0:01:38

      Average standard deviation of split frequencies: 0.102645

      20500 -- (-1510.243) (-1514.789) (-1510.146) [-1510.102] * [-1507.369] (-1507.686) (-1512.024) (-1511.176) -- 0:01:35
      21000 -- (-1507.807) (-1509.032) (-1505.390) [-1509.659] * (-1507.963) (-1509.092) [-1506.672] (-1508.503) -- 0:02:19
      21500 -- [-1508.326] (-1509.380) (-1506.016) (-1509.657) * (-1511.628) (-1505.342) [-1509.252] (-1506.054) -- 0:02:16
      22000 -- (-1515.461) (-1506.248) [-1507.906] (-1508.846) * (-1509.884) [-1506.273] (-1508.980) (-1507.119) -- 0:02:13
      22500 -- (-1510.934) (-1506.028) [-1507.446] (-1515.630) * (-1511.806) (-1515.550) (-1517.104) [-1511.551] -- 0:02:10
      23000 -- [-1510.582] (-1505.447) (-1511.396) (-1520.760) * [-1509.322] (-1512.064) (-1509.348) (-1512.190) -- 0:02:07
      23500 -- (-1511.512) (-1510.350) (-1511.105) [-1510.918] * [-1509.382] (-1524.301) (-1509.722) (-1513.451) -- 0:02:04
      24000 -- (-1507.117) (-1508.151) [-1510.098] (-1509.666) * [-1506.870] (-1515.112) (-1511.426) (-1502.484) -- 0:02:02
      24500 -- (-1512.215) (-1509.191) (-1510.958) [-1507.721] * (-1509.926) [-1511.283] (-1507.998) (-1507.525) -- 0:01:59
      25000 -- (-1510.905) (-1508.087) [-1505.697] (-1506.447) * (-1511.683) (-1510.811) [-1514.168] (-1512.259) -- 0:01:57

      Average standard deviation of split frequencies: 0.036262

      25500 -- [-1507.220] (-1507.475) (-1507.681) (-1515.724) * (-1512.631) (-1507.434) [-1509.024] (-1508.508) -- 0:01:54
      26000 -- [-1513.733] (-1506.858) (-1510.864) (-1507.925) * (-1512.996) (-1509.350) [-1511.396] (-1508.077) -- 0:01:52
      26500 -- [-1510.697] (-1506.960) (-1510.807) (-1513.958) * (-1519.376) (-1509.626) (-1514.245) [-1509.015] -- 0:01:50
      27000 -- [-1507.628] (-1513.584) (-1511.960) (-1511.553) * (-1514.574) (-1508.089) [-1506.328] (-1509.113) -- 0:01:48
      27500 -- (-1516.794) (-1511.468) (-1511.581) [-1511.854] * (-1514.401) (-1511.588) [-1508.243] (-1510.353) -- 0:01:46
      28000 -- (-1513.879) [-1509.911] (-1508.902) (-1509.854) * [-1510.692] (-1512.159) (-1510.286) (-1515.611) -- 0:01:44
      28500 -- (-1506.728) (-1513.929) [-1506.126] (-1507.737) * (-1512.019) (-1508.713) [-1509.942] (-1511.208) -- 0:02:16
      29000 -- (-1510.799) [-1512.765] (-1510.775) (-1509.791) * [-1514.681] (-1508.871) (-1509.078) (-1509.515) -- 0:02:13
      29500 -- (-1513.494) (-1517.131) [-1513.488] (-1505.319) * [-1513.750] (-1512.895) (-1516.002) (-1511.068) -- 0:02:11
      30000 -- [-1512.513] (-1513.978) (-1512.609) (-1510.751) * (-1515.365) (-1515.222) (-1511.997) [-1514.200] -- 0:02:09

      Average standard deviation of split frequencies: 0.053802

      30500 -- (-1508.970) (-1515.198) [-1508.952] (-1511.397) * (-1513.827) [-1504.655] (-1517.025) (-1518.497) -- 0:02:07
      31000 -- (-1515.737) (-1520.622) [-1507.619] (-1511.249) * (-1516.266) (-1512.447) [-1513.548] (-1514.417) -- 0:02:05
      31500 -- [-1507.887] (-1517.640) (-1507.402) (-1512.259) * (-1509.675) (-1513.260) (-1511.638) [-1512.834] -- 0:02:02
      32000 -- [-1508.373] (-1518.832) (-1514.908) (-1505.819) * (-1512.741) (-1512.020) (-1510.567) [-1510.874] -- 0:02:01
      32500 -- (-1511.443) [-1512.399] (-1508.459) (-1510.103) * (-1510.393) (-1509.820) (-1508.976) [-1511.166] -- 0:01:59
      33000 -- (-1513.846) (-1509.899) [-1506.883] (-1506.342) * (-1514.103) (-1505.680) [-1507.600] (-1511.481) -- 0:01:57
      33500 -- (-1514.172) (-1512.372) (-1510.186) [-1506.199] * (-1514.001) (-1505.450) (-1518.066) [-1512.460] -- 0:01:55
      34000 -- (-1509.208) (-1509.833) (-1506.715) [-1507.615] * (-1506.152) [-1507.437] (-1512.752) (-1511.941) -- 0:01:53
      34500 -- (-1511.004) (-1508.028) (-1506.920) [-1506.360] * (-1506.727) (-1511.458) (-1516.354) [-1514.314] -- 0:01:51
      35000 -- (-1509.269) (-1509.016) (-1510.040) [-1506.417] * (-1505.140) [-1511.136] (-1510.121) (-1506.332) -- 0:01:50

      Average standard deviation of split frequencies: 0.052378

      35500 -- (-1512.876) (-1509.192) (-1507.313) [-1511.457] * [-1511.689] (-1511.100) (-1517.154) (-1508.862) -- 0:02:15
      36000 -- (-1513.741) [-1508.965] (-1509.735) (-1508.761) * [-1505.730] (-1513.880) (-1513.124) (-1506.993) -- 0:02:13
      36500 -- (-1515.311) (-1512.448) [-1506.208] (-1513.465) * (-1506.665) [-1510.450] (-1508.942) (-1507.190) -- 0:02:11
      37000 -- (-1519.259) (-1507.690) (-1502.279) [-1513.487] * (-1505.846) [-1510.341] (-1511.530) (-1506.473) -- 0:02:10
      37500 -- (-1507.634) [-1508.089] (-1506.440) (-1508.992) * (-1507.271) (-1516.671) [-1517.636] (-1508.769) -- 0:02:08
      38000 -- [-1505.690] (-1511.365) (-1507.510) (-1509.395) * [-1505.950] (-1508.688) (-1515.133) (-1507.525) -- 0:02:06
      38500 -- (-1508.376) (-1515.911) (-1524.644) [-1507.428] * [-1509.796] (-1509.139) (-1513.422) (-1508.012) -- 0:02:04
      39000 -- [-1505.461] (-1512.177) (-1519.576) (-1504.971) * (-1512.246) (-1506.637) (-1515.358) [-1509.182] -- 0:02:03
      39500 -- (-1506.365) [-1509.710] (-1513.989) (-1506.908) * (-1513.497) (-1511.525) (-1514.655) [-1508.716] -- 0:02:01
      40000 -- (-1505.710) (-1514.817) (-1512.655) [-1506.409] * (-1511.504) [-1508.766] (-1511.191) (-1514.982) -- 0:02:00

      Average standard deviation of split frequencies: 0.046368

      40500 -- (-1503.460) [-1509.719] (-1516.955) (-1510.767) * (-1511.524) [-1506.849] (-1510.453) (-1508.003) -- 0:01:58
      41000 -- (-1510.484) [-1509.531] (-1514.062) (-1515.235) * [-1508.643] (-1505.450) (-1508.847) (-1509.428) -- 0:01:56
      41500 -- [-1509.013] (-1506.819) (-1513.084) (-1511.758) * (-1510.861) (-1507.510) [-1510.288] (-1508.401) -- 0:01:55
      42000 -- (-1507.979) (-1512.792) [-1506.816] (-1511.008) * (-1511.096) [-1508.048] (-1508.154) (-1507.706) -- 0:01:54
      42500 -- (-1516.468) (-1512.645) (-1508.786) [-1508.379] * (-1506.431) (-1509.085) [-1511.255] (-1506.852) -- 0:01:52
      43000 -- (-1515.043) [-1514.999] (-1509.091) (-1506.673) * (-1507.155) (-1512.032) (-1509.031) [-1504.625] -- 0:02:13
      43500 -- (-1511.085) (-1508.682) [-1510.520] (-1507.144) * (-1509.816) [-1508.100] (-1514.278) (-1506.000) -- 0:02:11
      44000 -- (-1513.666) (-1508.152) (-1507.631) [-1504.732] * (-1507.092) (-1512.070) [-1508.784] (-1505.377) -- 0:02:10
      44500 -- (-1516.339) [-1511.202] (-1504.079) (-1506.923) * [-1509.346] (-1509.217) (-1512.136) (-1507.193) -- 0:02:08
      45000 -- (-1512.894) (-1509.003) (-1506.312) [-1510.121] * (-1511.161) (-1506.883) [-1511.785] (-1510.230) -- 0:02:07

      Average standard deviation of split frequencies: 0.010248

      45500 -- [-1507.617] (-1511.333) (-1510.422) (-1511.388) * (-1511.187) (-1510.110) [-1515.743] (-1514.074) -- 0:02:05
      46000 -- [-1505.778] (-1508.717) (-1508.971) (-1514.714) * (-1510.157) (-1516.501) (-1508.199) [-1512.717] -- 0:02:04
      46500 -- [-1505.074] (-1508.212) (-1509.860) (-1515.515) * (-1512.407) (-1507.512) [-1515.434] (-1508.661) -- 0:02:03
      47000 -- (-1506.650) (-1512.752) [-1507.081] (-1509.880) * [-1509.680] (-1507.923) (-1508.771) (-1507.956) -- 0:02:01
      47500 -- (-1507.642) (-1512.749) (-1510.502) [-1514.628] * (-1521.359) [-1504.268] (-1505.998) (-1512.884) -- 0:02:00
      48000 -- (-1514.234) (-1507.876) [-1512.880] (-1512.736) * (-1510.584) [-1503.915] (-1510.940) (-1514.227) -- 0:01:59
      48500 -- (-1504.010) [-1504.353] (-1505.411) (-1510.906) * [-1510.543] (-1505.653) (-1518.639) (-1511.287) -- 0:01:57
      49000 -- [-1507.379] (-1506.380) (-1508.405) (-1511.668) * (-1510.601) (-1515.197) [-1509.379] (-1509.715) -- 0:01:56
      49500 -- (-1509.554) (-1509.280) [-1507.484] (-1509.881) * (-1508.776) (-1512.183) (-1512.316) [-1506.842] -- 0:01:55
      50000 -- [-1508.457] (-1507.173) (-1513.298) (-1514.611) * (-1517.229) (-1512.742) (-1511.320) [-1506.083] -- 0:02:13

      Average standard deviation of split frequencies: 0.013956

      50500 -- (-1507.179) [-1507.395] (-1511.752) (-1508.702) * (-1507.825) [-1506.250] (-1510.744) (-1510.397) -- 0:02:11
      51000 -- [-1515.346] (-1505.179) (-1512.778) (-1509.489) * (-1509.197) [-1509.951] (-1513.599) (-1511.956) -- 0:02:10
      51500 -- (-1514.154) (-1506.962) [-1511.931] (-1509.579) * [-1509.952] (-1506.267) (-1513.738) (-1512.690) -- 0:02:08
      52000 -- (-1509.062) [-1503.854] (-1518.842) (-1509.774) * [-1512.912] (-1510.472) (-1512.395) (-1513.843) -- 0:02:07
      52500 -- [-1511.535] (-1505.702) (-1513.152) (-1514.077) * [-1521.389] (-1510.356) (-1513.464) (-1509.777) -- 0:02:06
      53000 -- (-1509.532) (-1509.222) [-1515.123] (-1514.643) * (-1511.557) (-1507.843) (-1509.754) [-1510.707] -- 0:02:05
      53500 -- [-1511.164] (-1507.774) (-1509.834) (-1510.223) * [-1510.318] (-1507.113) (-1513.315) (-1507.499) -- 0:02:03
      54000 -- (-1510.204) [-1507.925] (-1510.696) (-1505.668) * (-1505.596) [-1511.405] (-1509.666) (-1514.809) -- 0:02:02
      54500 -- [-1508.045] (-1507.429) (-1508.278) (-1505.304) * (-1508.031) (-1506.660) (-1511.748) [-1510.170] -- 0:02:01
      55000 -- (-1508.937) [-1511.278] (-1509.592) (-1511.392) * (-1509.525) [-1509.913] (-1507.874) (-1508.215) -- 0:02:00

      Average standard deviation of split frequencies: 0.029463

      55500 -- (-1512.738) (-1505.299) (-1513.745) [-1512.778] * (-1506.756) [-1506.586] (-1513.300) (-1511.406) -- 0:01:59
      56000 -- (-1505.935) (-1505.157) (-1512.506) [-1506.654] * (-1511.816) (-1511.617) (-1516.956) [-1507.610] -- 0:01:58
      56500 -- (-1508.045) [-1509.039] (-1508.999) (-1514.389) * (-1510.945) [-1509.742] (-1515.882) (-1508.694) -- 0:01:56
      57000 -- (-1508.270) [-1517.788] (-1505.334) (-1513.589) * (-1509.226) (-1513.464) [-1513.355] (-1508.359) -- 0:01:55
      57500 -- (-1510.760) (-1514.896) [-1507.418] (-1512.588) * (-1508.420) (-1509.020) (-1508.668) [-1509.957] -- 0:02:11
      58000 -- (-1510.651) [-1507.828] (-1511.599) (-1507.307) * (-1512.133) (-1507.453) [-1505.792] (-1514.732) -- 0:02:09
      58500 -- [-1506.473] (-1506.428) (-1510.843) (-1514.319) * (-1508.242) [-1508.839] (-1512.087) (-1512.097) -- 0:02:08
      59000 -- [-1506.725] (-1505.500) (-1509.471) (-1515.793) * (-1508.690) [-1509.905] (-1509.378) (-1514.269) -- 0:02:07
      59500 -- [-1505.806] (-1505.039) (-1515.564) (-1513.188) * (-1507.694) [-1508.643] (-1507.464) (-1514.522) -- 0:02:06
      60000 -- (-1506.092) [-1506.897] (-1519.347) (-1511.985) * (-1509.820) [-1509.273] (-1507.309) (-1512.443) -- 0:02:05

      Average standard deviation of split frequencies: 0.011656

      60500 -- [-1509.452] (-1508.870) (-1520.408) (-1506.405) * (-1507.885) [-1505.316] (-1506.372) (-1506.462) -- 0:02:04
      61000 -- (-1511.624) [-1510.812] (-1510.390) (-1514.312) * (-1511.713) (-1511.767) [-1506.621] (-1508.886) -- 0:02:03
      61500 -- [-1506.610] (-1510.716) (-1509.028) (-1509.511) * [-1509.314] (-1509.786) (-1507.738) (-1507.079) -- 0:02:02
      62000 -- [-1508.264] (-1507.469) (-1509.151) (-1506.652) * [-1513.678] (-1507.078) (-1510.648) (-1515.792) -- 0:02:01
      62500 -- [-1508.700] (-1508.197) (-1515.819) (-1507.843) * (-1512.700) [-1508.326] (-1509.424) (-1508.197) -- 0:02:00
      63000 -- [-1504.629] (-1514.623) (-1510.164) (-1511.891) * [-1506.296] (-1509.163) (-1514.008) (-1506.073) -- 0:01:58
      63500 -- (-1508.748) [-1509.259] (-1506.504) (-1511.885) * (-1505.699) (-1507.555) (-1506.540) [-1508.622] -- 0:01:57
      64000 -- (-1510.954) (-1512.675) [-1506.008] (-1511.264) * (-1509.086) (-1517.786) [-1504.743] (-1508.623) -- 0:01:57
      64500 -- (-1513.160) (-1513.906) [-1509.212] (-1511.869) * (-1507.715) (-1514.347) (-1511.884) [-1508.247] -- 0:01:56
      65000 -- (-1512.104) (-1509.200) (-1508.268) [-1509.871] * (-1507.682) (-1512.344) (-1506.731) [-1507.404] -- 0:02:09

      Average standard deviation of split frequencies: 0.000000

      65500 -- (-1508.804) [-1513.567] (-1508.528) (-1510.683) * [-1507.565] (-1515.194) (-1505.064) (-1510.231) -- 0:02:08
      66000 -- [-1509.907] (-1510.583) (-1512.571) (-1512.136) * [-1510.150] (-1505.608) (-1510.341) (-1507.767) -- 0:02:07
      66500 -- [-1507.918] (-1510.011) (-1512.162) (-1511.161) * [-1505.652] (-1505.968) (-1513.855) (-1507.720) -- 0:02:06
      67000 -- [-1507.336] (-1510.288) (-1510.791) (-1511.300) * (-1509.188) (-1504.621) (-1505.057) [-1508.929] -- 0:02:05
      67500 -- (-1510.587) (-1513.355) [-1509.160] (-1509.673) * (-1507.717) (-1515.275) [-1510.331] (-1506.283) -- 0:02:04
      68000 -- [-1514.416] (-1507.876) (-1508.142) (-1511.345) * (-1509.168) (-1510.076) [-1509.517] (-1506.256) -- 0:02:03
      68500 -- (-1507.213) (-1509.164) (-1511.372) [-1507.830] * (-1511.420) (-1509.824) (-1509.735) [-1509.604] -- 0:02:02
      69000 -- [-1505.974] (-1512.220) (-1508.288) (-1508.056) * (-1509.660) (-1511.590) [-1507.884] (-1509.179) -- 0:02:01
      69500 -- [-1512.245] (-1510.811) (-1508.384) (-1508.447) * (-1508.823) (-1517.760) (-1507.029) [-1504.766] -- 0:02:00
      70000 -- [-1507.119] (-1509.171) (-1506.662) (-1510.784) * (-1509.353) (-1511.928) [-1509.344] (-1510.388) -- 0:01:59

      Average standard deviation of split frequencies: 0.010006

      70500 -- (-1506.946) (-1520.480) [-1511.822] (-1510.626) * (-1513.299) (-1508.740) [-1510.674] (-1511.635) -- 0:01:58
      71000 -- [-1507.410] (-1510.319) (-1514.198) (-1508.712) * (-1509.477) (-1509.112) [-1510.651] (-1513.833) -- 0:01:57
      71500 -- (-1507.299) (-1508.552) (-1507.478) [-1511.569] * (-1508.135) (-1518.987) (-1512.921) [-1505.181] -- 0:01:56
      72000 -- (-1507.670) (-1512.189) [-1506.701] (-1506.052) * (-1506.305) (-1513.008) [-1509.000] (-1510.828) -- 0:02:08
      72500 -- (-1512.399) (-1509.530) [-1504.918] (-1505.965) * [-1507.777] (-1508.549) (-1511.360) (-1505.068) -- 0:02:07
      73000 -- [-1510.863] (-1514.471) (-1506.034) (-1515.440) * (-1507.949) [-1511.379] (-1506.028) (-1511.431) -- 0:02:06
      73500 -- (-1510.065) (-1516.260) [-1510.745] (-1514.582) * [-1507.246] (-1511.042) (-1513.105) (-1512.465) -- 0:02:06
      74000 -- (-1511.634) (-1513.763) [-1504.336] (-1514.475) * [-1509.697] (-1505.446) (-1510.340) (-1508.396) -- 0:02:05
      74500 -- [-1508.881] (-1516.360) (-1509.436) (-1516.139) * (-1507.649) [-1509.089] (-1517.030) (-1517.564) -- 0:02:04
      75000 -- [-1507.919] (-1508.143) (-1505.582) (-1509.038) * (-1506.472) (-1511.008) [-1509.134] (-1522.549) -- 0:02:03

      Average standard deviation of split frequencies: 0.031013

      75500 -- (-1507.940) (-1505.957) [-1508.203] (-1512.166) * (-1519.069) [-1508.084] (-1508.497) (-1513.760) -- 0:02:02
      76000 -- [-1513.354] (-1507.507) (-1506.254) (-1511.181) * [-1515.497] (-1514.978) (-1511.432) (-1508.201) -- 0:02:01
      76500 -- (-1510.305) [-1506.697] (-1512.069) (-1507.921) * (-1513.375) (-1519.700) (-1510.522) [-1506.441] -- 0:02:00
      77000 -- (-1512.451) [-1510.063] (-1505.331) (-1508.208) * [-1504.195] (-1514.322) (-1512.980) (-1513.865) -- 0:01:59
      77500 -- [-1512.624] (-1515.401) (-1512.211) (-1516.483) * (-1508.158) (-1509.009) [-1511.119] (-1508.678) -- 0:01:59
      78000 -- (-1513.905) (-1505.673) [-1508.661] (-1511.128) * (-1508.896) (-1507.784) [-1506.814] (-1511.253) -- 0:01:58
      78500 -- (-1511.834) (-1508.296) (-1505.260) [-1506.926] * (-1514.217) [-1508.186] (-1514.584) (-1515.539) -- 0:01:57
      79000 -- (-1511.454) [-1509.067] (-1513.071) (-1514.954) * (-1510.153) (-1510.610) (-1508.172) [-1504.218] -- 0:02:08
      79500 -- (-1504.452) [-1509.211] (-1505.960) (-1511.035) * (-1509.408) [-1509.290] (-1508.635) (-1506.551) -- 0:02:07
      80000 -- (-1508.207) (-1515.036) [-1508.186] (-1506.482) * (-1508.739) [-1509.433] (-1512.799) (-1506.378) -- 0:02:06

      Average standard deviation of split frequencies: 0.035063

      80500 -- [-1508.457] (-1510.781) (-1511.812) (-1507.273) * (-1512.114) (-1505.973) (-1506.543) [-1506.801] -- 0:02:05
      81000 -- (-1503.824) [-1510.742] (-1509.079) (-1516.287) * (-1505.538) (-1508.952) [-1509.235] (-1506.284) -- 0:02:04
      81500 -- (-1504.799) (-1511.289) (-1512.610) [-1510.086] * (-1509.355) [-1504.531] (-1511.061) (-1507.568) -- 0:02:03
      82000 -- (-1508.272) (-1513.077) [-1506.922] (-1520.724) * [-1507.083] (-1507.200) (-1510.031) (-1508.377) -- 0:02:03
      82500 -- (-1510.841) (-1509.393) [-1504.846] (-1515.182) * (-1511.744) [-1507.357] (-1511.736) (-1506.386) -- 0:02:02
      83000 -- (-1507.042) [-1506.402] (-1510.672) (-1511.015) * (-1513.030) [-1512.169] (-1513.666) (-1510.039) -- 0:02:01
      83500 -- [-1512.054] (-1508.634) (-1507.744) (-1512.665) * (-1509.638) (-1507.160) [-1506.896] (-1505.596) -- 0:02:00
      84000 -- [-1510.538] (-1511.552) (-1506.855) (-1512.296) * (-1507.837) (-1511.678) (-1510.289) [-1506.746] -- 0:01:59
      84500 -- (-1507.782) (-1506.019) (-1507.979) [-1509.282] * (-1508.571) (-1511.057) [-1507.459] (-1508.390) -- 0:01:59
      85000 -- (-1508.363) [-1510.343] (-1508.272) (-1512.121) * (-1504.805) (-1510.623) (-1506.997) [-1504.559] -- 0:01:58

      Average standard deviation of split frequencies: 0.049333

      85500 -- (-1505.019) (-1511.102) [-1507.801] (-1510.580) * (-1505.116) [-1507.900] (-1506.707) (-1509.200) -- 0:01:57
      86000 -- (-1504.949) (-1511.749) (-1508.842) [-1505.113] * (-1509.522) [-1511.309] (-1507.697) (-1508.341) -- 0:01:56
      86500 -- (-1507.203) (-1506.993) [-1509.168] (-1510.659) * (-1506.196) (-1512.414) [-1510.576] (-1509.274) -- 0:02:06
      87000 -- [-1508.479] (-1507.461) (-1507.631) (-1511.292) * [-1506.604] (-1507.624) (-1516.882) (-1511.858) -- 0:02:05
      87500 -- [-1507.836] (-1514.078) (-1505.373) (-1507.633) * (-1510.989) [-1513.070] (-1512.718) (-1512.785) -- 0:02:05
      88000 -- (-1512.350) [-1510.368] (-1508.952) (-1509.631) * [-1507.052] (-1513.125) (-1506.194) (-1516.249) -- 0:02:04
      88500 -- (-1508.344) (-1507.073) (-1508.613) [-1513.134] * [-1509.704] (-1514.222) (-1510.941) (-1508.214) -- 0:02:03
      89000 -- (-1506.166) [-1510.187] (-1507.637) (-1512.475) * (-1510.595) (-1509.740) [-1505.979] (-1508.019) -- 0:02:02
      89500 -- (-1508.744) [-1506.779] (-1507.348) (-1505.816) * (-1507.607) (-1511.464) [-1507.144] (-1508.814) -- 0:02:02
      90000 -- (-1513.975) [-1506.679] (-1509.277) (-1506.152) * (-1505.368) (-1507.881) (-1510.271) [-1511.894] -- 0:02:01

      Average standard deviation of split frequencies: 0.041595

      90500 -- (-1510.333) (-1504.779) [-1506.831] (-1508.737) * (-1510.631) [-1509.767] (-1510.445) (-1512.054) -- 0:02:00
      91000 -- (-1510.402) [-1507.451] (-1507.652) (-1509.817) * (-1506.901) (-1510.296) (-1516.057) [-1513.311] -- 0:01:59
      91500 -- [-1511.069] (-1509.556) (-1512.339) (-1510.275) * (-1512.929) [-1508.627] (-1510.545) (-1511.356) -- 0:01:59
      92000 -- (-1509.853) [-1514.905] (-1513.595) (-1513.226) * (-1511.042) (-1505.970) (-1509.890) [-1506.041] -- 0:01:58
      92500 -- [-1507.883] (-1508.151) (-1509.874) (-1506.649) * (-1510.495) [-1512.593] (-1508.972) (-1507.747) -- 0:01:57
      93000 -- (-1506.218) (-1508.151) (-1506.621) [-1508.414] * (-1514.682) (-1514.080) [-1507.007] (-1508.775) -- 0:01:57
      93500 -- (-1508.962) (-1505.420) [-1509.198] (-1507.157) * (-1509.602) (-1511.840) [-1510.351] (-1511.585) -- 0:01:56
      94000 -- (-1506.177) [-1507.225] (-1510.085) (-1509.619) * (-1508.336) (-1512.494) (-1511.563) [-1509.495] -- 0:02:05
      94500 -- [-1503.948] (-1507.305) (-1509.164) (-1511.456) * (-1511.358) (-1514.150) (-1510.623) [-1513.831] -- 0:02:04
      95000 -- (-1512.516) [-1507.914] (-1513.746) (-1509.027) * [-1508.667] (-1510.704) (-1515.823) (-1508.706) -- 0:02:03

      Average standard deviation of split frequencies: 0.041739

      95500 -- (-1509.891) (-1510.702) [-1511.241] (-1516.438) * [-1514.894] (-1507.465) (-1506.338) (-1507.612) -- 0:02:03
      96000 -- [-1510.391] (-1507.643) (-1508.287) (-1510.648) * (-1515.177) (-1508.440) (-1507.818) [-1507.679] -- 0:02:02
      96500 -- (-1507.520) (-1506.706) (-1505.596) [-1509.585] * [-1514.091] (-1510.939) (-1506.522) (-1511.156) -- 0:02:01
      97000 -- (-1509.156) (-1505.509) [-1506.760] (-1507.927) * (-1510.055) (-1507.853) [-1513.421] (-1506.353) -- 0:02:01
      97500 -- (-1508.827) [-1514.910] (-1507.911) (-1510.728) * [-1509.254] (-1505.903) (-1511.534) (-1509.292) -- 0:02:00
      98000 -- (-1506.757) (-1511.776) (-1513.181) [-1507.926] * (-1508.998) (-1506.672) [-1507.289] (-1510.605) -- 0:01:59
      98500 -- [-1508.665] (-1505.742) (-1507.935) (-1510.610) * (-1510.295) [-1507.512] (-1511.838) (-1509.359) -- 0:01:58
      99000 -- (-1507.614) (-1506.760) (-1508.414) [-1506.826] * [-1510.273] (-1509.088) (-1509.997) (-1506.690) -- 0:01:58
      99500 -- [-1507.041] (-1510.571) (-1512.518) (-1509.747) * (-1507.766) [-1507.359] (-1505.296) (-1510.948) -- 0:01:57
      100000 -- (-1509.198) [-1505.107] (-1509.934) (-1510.052) * (-1515.795) (-1511.953) [-1507.356] (-1507.691) -- 0:01:56

      Average standard deviation of split frequencies: 0.042145

      100500 -- (-1515.847) (-1511.798) (-1506.606) [-1508.841] * [-1506.505] (-1516.223) (-1512.753) (-1509.065) -- 0:02:05
      101000 -- (-1517.275) (-1513.314) (-1506.229) [-1508.117] * (-1514.145) (-1517.391) (-1510.625) [-1506.624] -- 0:02:04
      101500 -- (-1510.380) (-1515.453) [-1507.304] (-1506.282) * [-1507.726] (-1512.147) (-1510.120) (-1508.665) -- 0:02:03
      102000 -- [-1520.426] (-1510.799) (-1508.771) (-1507.243) * [-1510.926] (-1513.033) (-1514.504) (-1510.023) -- 0:02:03
      102500 -- (-1509.768) (-1510.703) [-1508.073] (-1509.657) * [-1510.683] (-1508.538) (-1512.149) (-1512.813) -- 0:02:02
      103000 -- (-1516.735) [-1509.381] (-1506.174) (-1512.562) * [-1508.839] (-1507.000) (-1516.405) (-1508.379) -- 0:02:01
      103500 -- (-1514.247) (-1514.444) (-1514.030) [-1506.928] * (-1516.811) (-1510.291) (-1512.371) [-1505.897] -- 0:02:01
      104000 -- (-1518.440) (-1509.524) [-1508.329] (-1507.490) * (-1513.897) (-1514.201) [-1509.705] (-1519.032) -- 0:02:00
      104500 -- (-1510.077) (-1511.993) (-1511.371) [-1504.428] * [-1506.098] (-1512.072) (-1514.320) (-1514.009) -- 0:01:59
      105000 -- (-1512.038) (-1512.221) [-1510.442] (-1511.094) * (-1505.735) (-1511.044) [-1508.235] (-1516.180) -- 0:01:59

      Average standard deviation of split frequencies: 0.033354

      105500 -- (-1508.083) [-1511.175] (-1514.354) (-1507.420) * (-1510.134) (-1509.933) [-1505.855] (-1507.928) -- 0:01:58
      106000 -- [-1506.253] (-1506.180) (-1506.179) (-1512.205) * (-1507.897) (-1514.962) [-1505.370] (-1517.198) -- 0:01:58
      106500 -- (-1510.486) (-1507.648) (-1506.790) [-1507.681] * (-1507.489) (-1509.486) (-1508.485) [-1513.859] -- 0:01:57
      107000 -- (-1511.306) [-1510.623] (-1505.086) (-1513.438) * (-1508.682) (-1507.804) (-1505.634) [-1508.916] -- 0:01:56
      107500 -- (-1509.802) [-1505.525] (-1509.714) (-1509.371) * (-1517.151) [-1506.653] (-1505.426) (-1517.185) -- 0:01:56
      108000 -- (-1514.877) (-1510.803) (-1507.242) [-1507.875] * [-1513.440] (-1516.364) (-1509.091) (-1511.887) -- 0:02:03
      108500 -- (-1514.235) (-1516.536) [-1509.777] (-1507.677) * [-1510.747] (-1514.785) (-1505.422) (-1509.631) -- 0:02:03
      109000 -- [-1509.598] (-1510.350) (-1505.271) (-1510.986) * (-1510.853) [-1507.591] (-1507.887) (-1507.682) -- 0:02:02
      109500 -- (-1509.461) (-1510.139) [-1505.024] (-1505.304) * [-1513.980] (-1511.013) (-1516.940) (-1513.840) -- 0:02:01
      110000 -- [-1511.002] (-1516.284) (-1509.122) (-1515.968) * (-1514.277) (-1504.855) [-1508.598] (-1509.367) -- 0:02:01

      Average standard deviation of split frequencies: 0.044727

      110500 -- (-1510.616) (-1511.831) (-1509.707) [-1515.603] * (-1513.861) [-1505.342] (-1508.160) (-1515.231) -- 0:02:00
      111000 -- (-1511.463) (-1515.699) [-1514.752] (-1508.881) * (-1509.192) [-1510.292] (-1504.647) (-1509.448) -- 0:02:00
      111500 -- [-1505.726] (-1513.117) (-1528.455) (-1514.138) * (-1511.167) (-1511.509) (-1506.667) [-1511.520] -- 0:01:59
      112000 -- (-1509.167) [-1506.903] (-1509.753) (-1507.680) * (-1507.584) (-1513.152) (-1505.856) [-1510.422] -- 0:01:58
      112500 -- (-1510.855) (-1506.041) [-1509.467] (-1507.504) * (-1509.813) (-1510.566) (-1507.258) [-1512.309] -- 0:01:58
      113000 -- (-1513.821) (-1506.526) [-1509.396] (-1511.832) * (-1514.808) (-1513.326) (-1505.691) [-1508.277] -- 0:01:57
      113500 -- (-1505.859) [-1508.995] (-1510.900) (-1506.607) * (-1511.345) (-1505.215) (-1509.244) [-1504.997] -- 0:01:57
      114000 -- (-1508.845) [-1508.413] (-1512.714) (-1508.463) * (-1503.420) (-1508.002) [-1516.108] (-1509.268) -- 0:01:56
      114500 -- [-1511.716] (-1505.961) (-1508.346) (-1507.003) * (-1507.123) (-1505.656) (-1508.689) [-1506.069] -- 0:01:56
      115000 -- [-1506.574] (-1509.829) (-1514.301) (-1506.687) * [-1510.625] (-1518.315) (-1508.375) (-1508.466) -- 0:02:03

      Average standard deviation of split frequencies: 0.048766

      115500 -- [-1509.958] (-1507.085) (-1508.956) (-1508.589) * (-1504.054) (-1513.329) [-1506.689] (-1508.637) -- 0:02:02
      116000 -- [-1511.064] (-1505.248) (-1507.925) (-1506.893) * (-1510.312) [-1507.462] (-1511.398) (-1507.010) -- 0:02:01
      116500 -- (-1511.025) (-1511.493) [-1504.098] (-1504.186) * (-1512.017) (-1508.359) [-1507.912] (-1514.285) -- 0:02:01
      117000 -- [-1506.333] (-1506.096) (-1508.092) (-1508.435) * [-1506.211] (-1507.446) (-1506.746) (-1507.712) -- 0:02:00
      117500 -- (-1504.952) [-1504.510] (-1510.005) (-1504.556) * (-1508.331) [-1508.465] (-1512.272) (-1512.061) -- 0:02:00
      118000 -- [-1504.668] (-1508.296) (-1509.535) (-1510.970) * (-1507.514) (-1506.784) (-1516.439) [-1505.708] -- 0:01:59
      118500 -- [-1506.043] (-1506.860) (-1509.636) (-1508.177) * [-1506.874] (-1510.237) (-1511.238) (-1509.705) -- 0:01:59
      119000 -- [-1511.265] (-1509.945) (-1514.357) (-1509.495) * (-1509.572) [-1509.252] (-1508.643) (-1513.720) -- 0:01:58
      119500 -- (-1517.858) (-1507.484) (-1507.528) [-1507.035] * (-1512.017) [-1506.013] (-1508.945) (-1509.643) -- 0:01:57
      120000 -- (-1507.985) [-1506.988] (-1513.281) (-1508.148) * [-1504.873] (-1508.308) (-1505.269) (-1506.947) -- 0:01:57

      Average standard deviation of split frequencies: 0.039067

      120500 -- (-1511.298) (-1512.937) [-1510.154] (-1507.983) * (-1510.797) [-1510.011] (-1510.335) (-1515.469) -- 0:01:56
      121000 -- (-1511.499) [-1509.071] (-1511.583) (-1509.105) * (-1511.475) (-1510.721) (-1510.904) [-1511.072] -- 0:01:56
      121500 -- (-1514.444) (-1510.385) [-1511.833] (-1511.122) * (-1506.324) [-1509.009] (-1507.482) (-1512.607) -- 0:01:55
      122000 -- (-1512.935) [-1507.022] (-1516.910) (-1507.394) * (-1514.515) [-1513.439] (-1510.096) (-1507.931) -- 0:02:02
      122500 -- (-1513.335) (-1507.439) (-1511.646) [-1510.076] * (-1511.540) (-1509.002) [-1507.225] (-1509.315) -- 0:02:01
      123000 -- [-1512.407] (-1506.230) (-1508.881) (-1510.839) * [-1507.696] (-1516.735) (-1508.233) (-1510.652) -- 0:02:01
      123500 -- [-1512.335] (-1509.973) (-1512.241) (-1511.992) * (-1507.017) [-1509.312] (-1512.163) (-1509.012) -- 0:02:00
      124000 -- (-1512.833) [-1506.093] (-1512.494) (-1509.586) * [-1503.563] (-1515.371) (-1517.074) (-1510.567) -- 0:02:00
      124500 -- (-1519.015) (-1507.609) [-1507.857] (-1511.087) * (-1508.028) [-1507.491] (-1513.478) (-1508.133) -- 0:01:59
      125000 -- (-1510.159) (-1512.139) [-1508.321] (-1510.572) * [-1507.558] (-1512.098) (-1509.252) (-1511.336) -- 0:01:59

      Average standard deviation of split frequencies: 0.037413

      125500 -- (-1514.523) [-1511.512] (-1507.798) (-1512.122) * (-1508.739) (-1512.312) (-1511.504) [-1508.929] -- 0:01:58
      126000 -- (-1507.861) [-1512.999] (-1509.917) (-1512.205) * (-1506.446) (-1510.411) (-1508.235) [-1507.666] -- 0:01:57
      126500 -- (-1509.572) (-1513.963) [-1510.189] (-1511.994) * [-1506.167] (-1512.788) (-1508.742) (-1509.710) -- 0:01:57
      127000 -- [-1510.251] (-1506.730) (-1514.063) (-1507.617) * (-1518.240) (-1511.012) [-1506.156] (-1513.153) -- 0:01:56
      127500 -- (-1512.695) (-1510.757) (-1523.575) [-1509.073] * (-1511.356) (-1510.612) (-1509.023) [-1507.635] -- 0:01:56
      128000 -- (-1507.811) (-1507.258) [-1509.034] (-1506.287) * (-1506.879) (-1508.179) (-1509.976) [-1508.402] -- 0:01:55
      128500 -- [-1509.402] (-1510.230) (-1512.120) (-1512.872) * (-1506.545) [-1508.458] (-1511.067) (-1504.069) -- 0:01:55
      129000 -- [-1508.307] (-1508.922) (-1508.509) (-1512.930) * (-1508.993) (-1516.883) (-1507.088) [-1506.912] -- 0:01:54
      129500 -- (-1513.241) [-1509.807] (-1510.646) (-1507.857) * (-1505.525) (-1506.424) [-1507.805] (-1509.720) -- 0:02:00
      130000 -- (-1507.697) (-1507.480) (-1506.210) [-1509.723] * [-1505.897] (-1507.442) (-1507.418) (-1509.429) -- 0:02:00

      Average standard deviation of split frequencies: 0.032469

      130500 -- (-1508.379) (-1506.861) [-1506.356] (-1506.528) * (-1515.798) [-1508.691] (-1509.796) (-1508.684) -- 0:01:59
      131000 -- (-1509.115) (-1510.642) [-1507.807] (-1510.934) * (-1512.948) (-1515.385) [-1505.680] (-1512.359) -- 0:01:59
      131500 -- (-1513.582) (-1507.161) (-1508.797) [-1503.627] * [-1509.303] (-1509.174) (-1511.690) (-1507.720) -- 0:01:58
      132000 -- (-1511.435) (-1512.184) [-1510.807] (-1505.132) * [-1507.264] (-1516.590) (-1509.947) (-1513.860) -- 0:01:58
      132500 -- (-1511.208) [-1508.165] (-1504.409) (-1512.609) * [-1509.021] (-1520.678) (-1510.787) (-1511.722) -- 0:01:57
      133000 -- (-1507.730) (-1507.583) [-1504.797] (-1508.846) * (-1518.345) [-1513.288] (-1509.735) (-1513.036) -- 0:01:57
      133500 -- (-1512.373) [-1506.968] (-1511.905) (-1510.096) * (-1510.672) [-1509.686] (-1511.577) (-1506.914) -- 0:01:56
      134000 -- (-1506.600) (-1506.264) (-1508.229) [-1507.375] * [-1509.188] (-1514.600) (-1507.589) (-1504.016) -- 0:01:56
      134500 -- (-1509.363) (-1508.355) [-1509.168] (-1503.675) * (-1507.305) (-1514.696) (-1508.448) [-1503.283] -- 0:01:55
      135000 -- (-1510.336) [-1503.709] (-1513.297) (-1510.555) * (-1512.334) (-1511.369) (-1505.841) [-1507.509] -- 0:01:55

      Average standard deviation of split frequencies: 0.031196

      135500 -- (-1510.614) (-1509.688) (-1510.693) [-1507.102] * (-1510.945) (-1517.817) [-1507.253] (-1510.399) -- 0:01:54
      136000 -- (-1514.888) (-1513.727) [-1507.274] (-1505.176) * (-1518.749) (-1509.845) (-1511.084) [-1506.819] -- 0:01:54
      136500 -- (-1507.533) [-1507.926] (-1515.764) (-1511.933) * (-1512.504) [-1507.043] (-1508.407) (-1511.904) -- 0:02:00
      137000 -- (-1510.793) (-1507.797) (-1507.255) [-1509.247] * (-1516.070) (-1506.844) (-1510.910) [-1504.210] -- 0:01:59
      137500 -- (-1508.575) (-1508.951) [-1508.741] (-1509.004) * (-1509.782) [-1505.251] (-1508.756) (-1511.214) -- 0:01:59
      138000 -- (-1507.783) (-1511.053) (-1509.032) [-1508.006] * (-1510.166) (-1509.292) [-1507.142] (-1508.842) -- 0:01:58
      138500 -- (-1507.302) [-1507.690] (-1516.021) (-1508.757) * (-1507.663) (-1513.383) (-1508.982) [-1509.334] -- 0:01:58
      139000 -- [-1510.465] (-1512.249) (-1511.411) (-1507.788) * [-1506.157] (-1511.764) (-1512.459) (-1506.972) -- 0:01:57
      139500 -- [-1509.603] (-1512.993) (-1512.713) (-1508.138) * (-1505.228) (-1508.326) [-1509.044] (-1512.336) -- 0:01:57
      140000 -- [-1510.916] (-1510.975) (-1516.539) (-1511.847) * [-1510.411] (-1509.253) (-1513.593) (-1510.915) -- 0:01:56

      Average standard deviation of split frequencies: 0.025134

      140500 -- (-1507.810) [-1513.100] (-1515.885) (-1507.780) * (-1508.462) (-1508.115) [-1506.124] (-1512.239) -- 0:01:56
      141000 -- (-1506.808) (-1508.509) (-1515.362) [-1508.284] * (-1506.997) (-1512.988) (-1509.432) [-1506.725] -- 0:01:55
      141500 -- [-1505.654] (-1509.248) (-1513.974) (-1515.816) * [-1512.696] (-1514.121) (-1517.705) (-1514.867) -- 0:01:55
      142000 -- (-1509.211) (-1510.967) (-1508.050) [-1505.613] * [-1509.337] (-1509.597) (-1512.739) (-1513.674) -- 0:01:54
      142500 -- (-1516.277) (-1519.550) (-1506.737) [-1510.792] * (-1506.423) (-1509.356) [-1506.591] (-1508.774) -- 0:01:54
      143000 -- (-1506.179) (-1513.576) (-1511.834) [-1511.250] * (-1511.478) (-1509.827) (-1514.488) [-1511.861] -- 0:01:53
      143500 -- (-1509.406) (-1507.567) [-1509.290] (-1510.957) * [-1504.646] (-1513.798) (-1510.252) (-1508.716) -- 0:01:53
      144000 -- (-1507.954) (-1515.077) [-1505.546] (-1514.208) * (-1506.216) (-1509.272) (-1504.682) [-1507.042] -- 0:01:58
      144500 -- [-1509.166] (-1509.061) (-1511.530) (-1508.487) * (-1510.526) (-1508.236) [-1510.214] (-1508.047) -- 0:01:58
      145000 -- (-1507.763) (-1511.034) (-1507.523) [-1510.097] * (-1507.508) [-1511.865] (-1513.826) (-1507.277) -- 0:01:57

      Average standard deviation of split frequencies: 0.038746

      145500 -- [-1505.031] (-1512.199) (-1513.002) (-1506.809) * [-1507.734] (-1511.034) (-1508.162) (-1505.336) -- 0:01:57
      146000 -- (-1510.515) (-1511.436) [-1506.523] (-1506.293) * (-1509.446) [-1507.271] (-1510.214) (-1505.759) -- 0:01:56
      146500 -- (-1509.761) (-1517.393) [-1505.688] (-1511.545) * (-1514.159) (-1511.702) (-1508.001) [-1503.738] -- 0:01:56
      147000 -- (-1509.184) (-1514.471) (-1506.721) [-1507.561] * (-1515.812) (-1509.602) (-1506.658) [-1507.213] -- 0:01:56
      147500 -- (-1512.463) (-1511.471) (-1509.240) [-1504.755] * (-1513.470) (-1509.737) [-1506.088] (-1507.596) -- 0:01:55
      148000 -- (-1511.625) [-1512.072] (-1511.333) (-1507.750) * (-1518.843) (-1509.682) [-1511.427] (-1508.949) -- 0:01:55
      148500 -- (-1511.574) [-1515.783] (-1510.019) (-1515.267) * (-1517.794) (-1513.494) (-1512.148) [-1513.063] -- 0:01:54
      149000 -- (-1507.853) (-1511.263) [-1510.995] (-1512.325) * (-1524.225) [-1515.578] (-1512.928) (-1505.802) -- 0:01:54
      149500 -- (-1509.342) [-1511.243] (-1518.586) (-1508.717) * (-1521.347) (-1514.693) [-1511.601] (-1509.737) -- 0:01:53
      150000 -- (-1512.019) [-1516.636] (-1511.474) (-1504.807) * (-1523.788) [-1517.227] (-1506.862) (-1510.568) -- 0:01:53

      Average standard deviation of split frequencies: 0.028159

      150500 -- (-1515.308) [-1515.126] (-1514.236) (-1512.624) * (-1517.696) (-1518.692) (-1513.673) [-1509.124] -- 0:01:52
      151000 -- [-1511.092] (-1519.935) (-1510.667) (-1508.938) * [-1513.633] (-1512.204) (-1509.909) (-1510.447) -- 0:01:52
      151500 -- (-1510.816) (-1514.013) [-1508.674] (-1503.924) * (-1520.898) (-1512.889) (-1510.102) [-1507.251] -- 0:01:57
      152000 -- [-1508.172] (-1511.309) (-1510.850) (-1508.234) * (-1514.423) (-1514.649) [-1505.591] (-1506.544) -- 0:01:57
      152500 -- (-1511.360) (-1510.275) (-1508.524) [-1505.828] * (-1518.358) (-1512.900) (-1511.537) [-1505.721] -- 0:01:56
      153000 -- (-1510.869) (-1508.041) [-1507.222] (-1513.191) * (-1513.230) [-1507.518] (-1511.954) (-1513.033) -- 0:01:56
      153500 -- (-1507.768) (-1510.412) (-1508.175) [-1505.479] * [-1514.823] (-1509.584) (-1508.086) (-1509.304) -- 0:01:55
      154000 -- (-1510.586) (-1510.045) [-1508.815] (-1509.269) * (-1516.059) (-1510.543) [-1505.708] (-1508.922) -- 0:01:55
      154500 -- [-1507.338] (-1511.438) (-1516.728) (-1515.823) * (-1516.110) (-1508.134) (-1503.474) [-1504.085] -- 0:01:54
      155000 -- (-1516.078) (-1510.613) [-1509.943] (-1507.672) * [-1507.950] (-1508.795) (-1507.502) (-1510.675) -- 0:01:54

      Average standard deviation of split frequencies: 0.034751

      155500 -- (-1515.515) (-1511.744) [-1506.639] (-1507.051) * (-1509.439) (-1511.609) [-1507.981] (-1510.166) -- 0:01:54
      156000 -- (-1513.089) (-1513.948) [-1512.099] (-1510.358) * (-1508.383) (-1511.132) [-1505.321] (-1512.162) -- 0:01:53
      156500 -- (-1513.191) (-1508.682) (-1508.203) [-1508.295] * [-1505.853] (-1511.978) (-1509.019) (-1515.133) -- 0:01:53
      157000 -- (-1507.221) [-1508.774] (-1513.022) (-1510.972) * [-1505.467] (-1511.026) (-1504.427) (-1504.838) -- 0:01:52
      157500 -- (-1508.334) (-1508.814) (-1514.728) [-1511.758] * (-1508.870) (-1509.709) (-1507.173) [-1510.483] -- 0:01:52
      158000 -- (-1508.436) (-1510.009) (-1512.664) [-1517.624] * (-1512.591) (-1514.845) [-1505.701] (-1510.172) -- 0:01:51
      158500 -- (-1506.946) (-1507.154) [-1507.836] (-1519.380) * (-1516.062) (-1509.093) (-1510.850) [-1513.735] -- 0:01:56
      159000 -- (-1508.530) [-1510.772] (-1511.142) (-1517.728) * (-1509.581) (-1512.869) (-1508.512) [-1509.381] -- 0:01:56
      159500 -- (-1508.335) (-1506.036) (-1511.578) [-1511.660] * (-1511.312) (-1511.073) (-1507.385) [-1504.809] -- 0:01:55
      160000 -- [-1511.801] (-1510.116) (-1510.921) (-1510.432) * (-1511.515) (-1506.907) (-1513.048) [-1505.620] -- 0:01:55

      Average standard deviation of split frequencies: 0.035209

      160500 -- (-1511.727) (-1518.585) [-1508.725] (-1509.943) * [-1514.511] (-1506.598) (-1511.137) (-1507.763) -- 0:01:55
      161000 -- (-1506.320) (-1510.240) [-1505.858] (-1512.810) * [-1512.730] (-1512.058) (-1509.746) (-1507.152) -- 0:01:54
      161500 -- (-1505.468) (-1513.326) [-1505.929] (-1514.779) * [-1508.274] (-1507.830) (-1514.787) (-1510.637) -- 0:01:54
      162000 -- (-1509.978) [-1512.165] (-1512.250) (-1508.065) * (-1506.729) (-1511.156) [-1510.429] (-1508.037) -- 0:01:53
      162500 -- [-1508.310] (-1512.794) (-1515.391) (-1510.479) * [-1504.330] (-1515.931) (-1510.188) (-1510.378) -- 0:01:53
      163000 -- (-1503.816) (-1517.278) [-1508.592] (-1507.207) * (-1521.981) (-1510.201) (-1514.244) [-1506.091] -- 0:01:52
      163500 -- (-1510.279) (-1510.506) (-1507.737) [-1507.328] * (-1509.018) (-1508.547) [-1509.962] (-1509.195) -- 0:01:52
      164000 -- (-1511.076) (-1509.262) (-1510.031) [-1511.959] * [-1508.197] (-1511.114) (-1509.566) (-1510.708) -- 0:01:52
      164500 -- (-1517.905) [-1508.373] (-1510.014) (-1506.602) * [-1506.869] (-1510.279) (-1509.218) (-1509.209) -- 0:01:51
      165000 -- (-1508.860) (-1511.014) (-1510.722) [-1504.729] * [-1508.625] (-1507.104) (-1508.979) (-1504.738) -- 0:01:51

      Average standard deviation of split frequencies: 0.046856

      165500 -- (-1511.161) [-1508.474] (-1508.791) (-1510.275) * (-1515.161) (-1510.816) [-1515.804] (-1509.172) -- 0:01:50
      166000 -- (-1505.624) (-1510.724) (-1511.713) [-1512.060] * (-1515.342) (-1510.082) [-1510.892] (-1506.903) -- 0:01:55
      166500 -- [-1505.696] (-1506.668) (-1512.620) (-1510.198) * (-1507.925) [-1509.643] (-1509.505) (-1512.483) -- 0:01:55
      167000 -- (-1507.972) [-1507.837] (-1513.033) (-1510.717) * [-1510.647] (-1509.879) (-1513.547) (-1509.064) -- 0:01:54
      167500 -- (-1515.153) (-1507.694) (-1513.014) [-1510.160] * [-1508.952] (-1511.860) (-1513.366) (-1509.213) -- 0:01:54
      168000 -- (-1506.612) (-1509.719) (-1511.293) [-1506.923] * (-1505.592) (-1515.334) (-1507.469) [-1507.541] -- 0:01:53
      168500 -- [-1509.731] (-1510.728) (-1515.418) (-1506.297) * (-1510.247) (-1512.248) [-1511.418] (-1507.901) -- 0:01:53
      169000 -- [-1509.637] (-1510.525) (-1520.437) (-1509.257) * [-1507.256] (-1515.420) (-1514.896) (-1505.277) -- 0:01:53
      169500 -- [-1506.155] (-1510.941) (-1509.313) (-1508.706) * (-1512.540) (-1515.113) (-1512.922) [-1510.341] -- 0:01:52
      170000 -- (-1507.840) (-1508.441) [-1507.746] (-1511.642) * [-1513.221] (-1505.250) (-1510.397) (-1507.835) -- 0:01:52

      Average standard deviation of split frequencies: 0.049718

      170500 -- (-1510.024) [-1508.612] (-1512.497) (-1507.004) * (-1518.238) (-1508.463) (-1507.689) [-1507.993] -- 0:01:51
      171000 -- (-1508.963) (-1513.223) [-1510.606] (-1510.587) * (-1508.948) [-1510.068] (-1511.820) (-1512.839) -- 0:01:51
      171500 -- (-1510.706) [-1510.741] (-1510.334) (-1505.431) * [-1507.315] (-1508.942) (-1510.758) (-1505.847) -- 0:01:51
      172000 -- (-1509.498) [-1511.266] (-1510.516) (-1508.804) * (-1513.390) (-1506.651) (-1510.752) [-1508.566] -- 0:01:50
      172500 -- (-1507.036) (-1510.334) (-1507.057) [-1508.404] * (-1514.172) (-1506.382) (-1509.625) [-1512.628] -- 0:01:50
      173000 -- (-1514.517) (-1514.450) [-1508.283] (-1506.998) * (-1511.776) (-1505.951) (-1507.998) [-1511.995] -- 0:01:49
      173500 -- [-1508.563] (-1516.710) (-1513.153) (-1506.546) * (-1510.000) [-1504.921] (-1512.725) (-1508.826) -- 0:01:54
      174000 -- (-1513.996) [-1508.470] (-1512.343) (-1507.317) * (-1514.049) (-1508.258) [-1505.665] (-1513.956) -- 0:01:53
      174500 -- (-1509.179) (-1511.607) [-1507.654] (-1512.234) * [-1508.375] (-1510.374) (-1506.133) (-1509.370) -- 0:01:53
      175000 -- (-1513.184) [-1514.847] (-1508.616) (-1513.548) * (-1506.879) (-1511.737) [-1507.505] (-1509.320) -- 0:01:53

      Average standard deviation of split frequencies: 0.040177

      175500 -- (-1514.466) [-1505.335] (-1512.558) (-1509.637) * [-1508.403] (-1516.818) (-1506.500) (-1513.847) -- 0:01:52
      176000 -- (-1510.253) (-1507.978) (-1510.503) [-1506.591] * (-1511.552) (-1511.174) [-1509.554] (-1510.708) -- 0:01:52
      176500 -- (-1511.352) (-1508.835) (-1509.738) [-1507.488] * [-1511.379] (-1508.649) (-1508.919) (-1512.394) -- 0:01:51
      177000 -- (-1515.859) [-1508.165] (-1503.276) (-1517.259) * (-1509.677) (-1508.396) [-1508.391] (-1515.978) -- 0:01:51
      177500 -- (-1510.290) (-1508.739) [-1506.855] (-1518.528) * [-1507.319] (-1510.767) (-1506.223) (-1510.332) -- 0:01:51
      178000 -- (-1509.190) (-1507.567) [-1508.912] (-1508.468) * (-1512.274) (-1508.970) (-1513.619) [-1508.079] -- 0:01:50
      178500 -- (-1505.335) (-1513.396) [-1507.074] (-1510.101) * (-1511.700) (-1505.904) (-1507.223) [-1512.126] -- 0:01:50
      179000 -- (-1510.056) (-1512.031) (-1505.679) [-1506.929] * [-1507.927] (-1504.261) (-1507.856) (-1511.977) -- 0:01:50
      179500 -- (-1509.245) (-1509.731) [-1503.718] (-1510.212) * (-1512.594) [-1509.158] (-1515.242) (-1512.843) -- 0:01:49
      180000 -- [-1506.720] (-1508.595) (-1505.411) (-1507.504) * (-1514.062) [-1510.765] (-1508.772) (-1509.995) -- 0:01:49

      Average standard deviation of split frequencies: 0.039139

      180500 -- (-1506.288) (-1515.448) (-1515.399) [-1506.161] * (-1513.651) (-1508.592) [-1507.160] (-1507.708) -- 0:01:53
      181000 -- (-1508.252) [-1511.104] (-1509.553) (-1509.580) * (-1511.752) (-1507.947) [-1508.406] (-1508.206) -- 0:01:53
      181500 -- (-1510.205) (-1508.471) [-1509.008] (-1511.371) * (-1508.863) (-1511.289) (-1519.445) [-1509.596] -- 0:01:52
      182000 -- (-1508.130) (-1512.034) [-1507.241] (-1504.601) * [-1513.546] (-1511.460) (-1516.046) (-1511.635) -- 0:01:52
      182500 -- (-1507.664) (-1513.012) (-1508.199) [-1507.154] * (-1513.119) (-1508.409) (-1512.682) [-1511.572] -- 0:01:51
      183000 -- (-1509.383) (-1509.253) (-1505.316) [-1510.081] * (-1510.132) [-1510.597] (-1507.325) (-1513.400) -- 0:01:51
      183500 -- (-1511.604) (-1508.763) (-1507.899) [-1505.796] * (-1513.149) [-1513.024] (-1510.724) (-1514.324) -- 0:01:51
      184000 -- (-1505.880) (-1508.158) [-1509.268] (-1514.959) * (-1510.002) [-1508.437] (-1508.497) (-1513.581) -- 0:01:50
      184500 -- (-1511.200) (-1507.674) (-1504.675) [-1512.345] * (-1507.833) (-1506.582) [-1514.140] (-1515.846) -- 0:01:50
      185000 -- (-1516.820) (-1507.472) [-1509.428] (-1512.560) * (-1506.807) [-1508.505] (-1507.231) (-1508.265) -- 0:01:50

      Average standard deviation of split frequencies: 0.034215

      185500 -- (-1512.475) [-1509.039] (-1510.049) (-1509.047) * [-1505.360] (-1517.276) (-1510.639) (-1515.677) -- 0:01:49
      186000 -- (-1506.858) [-1509.008] (-1510.240) (-1510.354) * (-1506.596) (-1510.879) [-1506.595] (-1510.597) -- 0:01:49
      186500 -- (-1515.590) (-1507.955) [-1506.247] (-1509.345) * (-1506.211) (-1510.762) (-1510.832) [-1510.676] -- 0:01:49
      187000 -- (-1511.306) (-1511.393) [-1506.591] (-1515.333) * [-1510.109] (-1515.166) (-1515.967) (-1514.809) -- 0:01:48
      187500 -- (-1509.748) (-1509.136) [-1509.592] (-1510.475) * [-1507.958] (-1516.730) (-1512.957) (-1515.871) -- 0:01:48
      188000 -- (-1508.841) [-1507.460] (-1513.196) (-1511.876) * (-1512.509) (-1511.315) [-1510.061] (-1512.480) -- 0:01:52
      188500 -- [-1511.452] (-1512.270) (-1509.352) (-1507.541) * [-1512.225] (-1510.603) (-1507.710) (-1513.505) -- 0:01:51
      189000 -- (-1509.889) (-1506.524) (-1504.822) [-1513.686] * (-1515.032) [-1512.212] (-1513.103) (-1513.859) -- 0:01:51
      189500 -- (-1510.562) (-1512.445) (-1508.753) [-1509.458] * [-1515.494] (-1518.141) (-1509.538) (-1507.384) -- 0:01:51
      190000 -- [-1512.947] (-1507.569) (-1509.559) (-1511.979) * (-1511.765) (-1508.555) [-1503.693] (-1503.944) -- 0:01:50

      Average standard deviation of split frequencies: 0.033377

      190500 -- (-1508.604) [-1506.617] (-1507.427) (-1511.947) * (-1510.238) (-1507.567) [-1507.844] (-1508.269) -- 0:01:50
      191000 -- (-1509.499) (-1510.528) (-1512.346) [-1506.484] * [-1510.344] (-1508.645) (-1508.500) (-1509.977) -- 0:01:50
      191500 -- (-1505.611) (-1512.590) [-1510.274] (-1517.623) * (-1508.507) [-1512.879] (-1505.699) (-1511.426) -- 0:01:49
      192000 -- [-1506.027] (-1513.482) (-1509.103) (-1510.832) * (-1505.664) (-1504.972) (-1515.130) [-1514.004] -- 0:01:49
      192500 -- [-1507.463] (-1509.458) (-1505.912) (-1507.839) * [-1509.088] (-1510.911) (-1517.755) (-1509.433) -- 0:01:49
      193000 -- (-1505.389) [-1508.811] (-1508.305) (-1510.713) * [-1505.880] (-1510.346) (-1509.199) (-1514.569) -- 0:01:48
      193500 -- (-1508.986) (-1511.962) [-1509.846] (-1509.105) * (-1506.064) (-1510.311) (-1515.495) [-1512.210] -- 0:01:48
      194000 -- (-1506.913) [-1508.464] (-1507.793) (-1506.973) * (-1512.440) (-1507.419) (-1512.848) [-1515.791] -- 0:01:48
      194500 -- (-1509.916) [-1518.569] (-1511.881) (-1507.254) * [-1509.950] (-1505.703) (-1512.690) (-1510.070) -- 0:01:47
      195000 -- (-1504.648) (-1508.428) [-1513.568] (-1521.978) * [-1508.178] (-1509.997) (-1509.676) (-1511.250) -- 0:01:47

      Average standard deviation of split frequencies: 0.020444

      195500 -- (-1507.296) (-1515.434) (-1508.214) [-1510.978] * (-1508.923) (-1507.497) (-1508.390) [-1510.841] -- 0:01:51
      196000 -- [-1509.202] (-1509.255) (-1511.428) (-1509.604) * (-1507.144) (-1508.673) [-1507.550] (-1508.305) -- 0:01:50
      196500 -- (-1513.744) [-1506.197] (-1510.044) (-1512.480) * (-1511.729) [-1503.039] (-1508.677) (-1516.972) -- 0:01:50
      197000 -- (-1512.295) [-1503.343] (-1511.411) (-1508.966) * [-1510.279] (-1507.484) (-1509.356) (-1514.113) -- 0:01:50
      197500 -- [-1509.992] (-1505.964) (-1510.359) (-1515.825) * (-1508.029) (-1517.631) [-1508.921] (-1514.896) -- 0:01:49
      198000 -- (-1513.454) (-1509.999) [-1511.623] (-1508.795) * (-1511.378) (-1508.707) [-1506.288] (-1518.210) -- 0:01:49
      198500 -- (-1520.754) [-1509.753] (-1519.100) (-1513.799) * (-1511.821) [-1512.107] (-1508.224) (-1510.292) -- 0:01:49
      199000 -- (-1516.552) (-1507.759) (-1512.896) [-1506.293] * (-1507.572) (-1508.462) [-1505.543] (-1511.731) -- 0:01:48
      199500 -- (-1520.303) (-1508.230) (-1508.211) [-1506.899] * [-1504.803] (-1508.049) (-1506.385) (-1516.965) -- 0:01:48
      200000 -- (-1510.623) [-1504.972] (-1515.240) (-1508.431) * (-1511.795) (-1505.321) [-1506.070] (-1517.099) -- 0:01:48

      Average standard deviation of split frequencies: 0.012921

      200500 -- [-1510.150] (-1507.949) (-1512.864) (-1520.281) * [-1506.969] (-1508.390) (-1509.597) (-1523.963) -- 0:01:47
      201000 -- (-1509.138) [-1506.863] (-1510.862) (-1510.049) * (-1507.007) [-1506.078] (-1509.280) (-1515.001) -- 0:01:47
      201500 -- [-1504.294] (-1504.691) (-1506.034) (-1517.638) * (-1509.278) [-1509.239] (-1511.907) (-1511.732) -- 0:01:46
      202000 -- (-1506.511) [-1509.903] (-1510.251) (-1509.139) * (-1513.398) [-1505.723] (-1514.315) (-1507.454) -- 0:01:46
      202500 -- (-1513.443) (-1510.328) (-1507.242) [-1507.771] * (-1511.172) [-1507.591] (-1517.109) (-1514.300) -- 0:01:50
      203000 -- [-1508.071] (-1509.903) (-1511.225) (-1508.976) * (-1505.265) (-1509.192) (-1511.814) [-1506.086] -- 0:01:49
      203500 -- (-1509.917) (-1511.500) (-1511.048) [-1507.606] * (-1507.007) (-1510.184) (-1510.049) [-1510.810] -- 0:01:49
      204000 -- [-1514.702] (-1506.945) (-1510.509) (-1510.003) * (-1507.121) (-1508.415) (-1509.690) [-1508.354] -- 0:01:49
      204500 -- (-1512.029) (-1506.115) (-1510.354) [-1512.386] * [-1506.959] (-1510.254) (-1513.530) (-1509.939) -- 0:01:48
      205000 -- (-1506.127) [-1506.983] (-1511.531) (-1508.753) * (-1506.533) [-1512.215] (-1512.317) (-1514.608) -- 0:01:48

      Average standard deviation of split frequencies: 0.014874

      205500 -- (-1512.013) (-1512.348) (-1511.732) [-1510.391] * [-1511.676] (-1512.758) (-1512.907) (-1508.185) -- 0:01:48
      206000 -- (-1513.081) [-1510.641] (-1514.076) (-1513.048) * (-1509.079) (-1514.972) (-1509.778) [-1509.246] -- 0:01:47
      206500 -- [-1506.194] (-1511.073) (-1507.041) (-1506.954) * (-1506.740) (-1509.341) (-1510.489) [-1513.639] -- 0:01:47
      207000 -- [-1510.561] (-1509.487) (-1510.910) (-1513.281) * (-1505.491) (-1508.472) [-1511.001] (-1511.401) -- 0:01:47
      207500 -- (-1509.416) (-1516.822) [-1506.780] (-1511.800) * (-1510.540) [-1513.914] (-1514.037) (-1511.658) -- 0:01:46
      208000 -- [-1506.927] (-1505.496) (-1510.522) (-1514.354) * [-1510.213] (-1508.763) (-1515.037) (-1507.871) -- 0:01:46
      208500 -- (-1507.770) [-1509.652] (-1505.642) (-1511.114) * (-1505.420) [-1515.589] (-1506.924) (-1509.057) -- 0:01:46
      209000 -- (-1504.245) [-1509.924] (-1506.999) (-1515.621) * (-1510.559) (-1509.123) [-1504.825] (-1509.334) -- 0:01:45
      209500 -- (-1507.677) (-1506.640) [-1509.942] (-1508.898) * [-1504.802] (-1513.459) (-1507.040) (-1510.990) -- 0:01:45
      210000 -- (-1511.243) [-1508.135] (-1510.596) (-1511.154) * (-1513.172) (-1508.350) [-1502.949] (-1510.739) -- 0:01:49

      Average standard deviation of split frequencies: 0.011188

      210500 -- (-1509.029) [-1508.864] (-1511.013) (-1512.617) * (-1512.246) (-1511.228) [-1507.891] (-1515.527) -- 0:01:48
      211000 -- (-1512.171) [-1507.909] (-1510.244) (-1518.035) * [-1508.846] (-1517.179) (-1509.058) (-1510.529) -- 0:01:48
      211500 -- (-1509.111) [-1509.649] (-1507.480) (-1515.057) * (-1513.905) (-1517.741) [-1508.621] (-1515.339) -- 0:01:48
      212000 -- [-1504.531] (-1508.532) (-1506.647) (-1522.450) * (-1508.282) (-1511.343) (-1504.627) [-1506.138] -- 0:01:47
      212500 -- (-1504.729) [-1508.367] (-1507.595) (-1512.752) * [-1508.807] (-1516.144) (-1509.988) (-1515.940) -- 0:01:47
      213000 -- [-1509.291] (-1509.562) (-1508.668) (-1512.400) * [-1505.977] (-1508.536) (-1509.223) (-1511.467) -- 0:01:47
      213500 -- (-1507.587) [-1506.779] (-1507.168) (-1511.087) * (-1508.350) [-1510.870] (-1507.327) (-1513.186) -- 0:01:46
      214000 -- (-1505.041) (-1513.481) [-1507.647] (-1508.634) * (-1505.021) (-1509.567) [-1509.129] (-1510.075) -- 0:01:46
      214500 -- (-1509.206) (-1508.458) (-1508.543) [-1512.482] * (-1510.193) (-1506.417) (-1506.350) [-1506.209] -- 0:01:46
      215000 -- (-1515.902) (-1509.389) [-1502.923] (-1514.172) * [-1508.625] (-1504.714) (-1510.246) (-1507.126) -- 0:01:45

      Average standard deviation of split frequencies: 0.007638

      215500 -- (-1511.061) (-1507.946) [-1507.015] (-1514.858) * (-1509.316) (-1509.666) (-1511.040) [-1507.051] -- 0:01:45
      216000 -- (-1512.853) (-1508.470) [-1511.393] (-1510.288) * (-1506.714) (-1507.765) [-1508.299] (-1514.681) -- 0:01:45
      216500 -- [-1506.830] (-1512.086) (-1511.923) (-1511.332) * (-1507.055) (-1509.473) (-1513.221) [-1508.361] -- 0:01:44
      217000 -- (-1506.937) (-1511.985) (-1507.213) [-1506.096] * (-1509.957) (-1509.074) (-1505.968) [-1510.195] -- 0:01:48
      217500 -- (-1507.271) [-1509.502] (-1508.047) (-1510.376) * (-1504.835) (-1509.720) (-1510.255) [-1508.549] -- 0:01:47
      218000 -- (-1506.481) (-1508.550) (-1511.678) [-1510.042] * (-1504.088) (-1514.286) [-1510.536] (-1513.542) -- 0:01:47
      218500 -- [-1512.623] (-1512.101) (-1514.389) (-1511.379) * [-1505.275] (-1513.976) (-1509.643) (-1511.283) -- 0:01:47
      219000 -- [-1505.512] (-1514.331) (-1510.453) (-1512.613) * (-1505.485) (-1519.743) [-1506.065] (-1511.723) -- 0:01:46
      219500 -- (-1511.751) (-1509.381) (-1511.721) [-1506.406] * (-1512.470) (-1517.747) [-1507.920] (-1512.240) -- 0:01:46
      220000 -- (-1513.120) (-1506.886) [-1508.697] (-1512.659) * (-1508.337) (-1516.001) (-1506.825) [-1510.913] -- 0:01:46

      Average standard deviation of split frequencies: 0.011750

      220500 -- (-1509.462) (-1516.875) (-1512.150) [-1511.084] * (-1510.241) (-1508.090) [-1506.565] (-1509.160) -- 0:01:46
      221000 -- [-1508.420] (-1508.195) (-1511.005) (-1512.138) * (-1513.685) [-1508.324] (-1509.189) (-1507.391) -- 0:01:45
      221500 -- (-1507.381) (-1506.883) (-1513.797) [-1504.401] * [-1512.832] (-1510.605) (-1513.558) (-1508.669) -- 0:01:45
      222000 -- (-1507.529) (-1507.688) (-1514.719) [-1510.336] * (-1509.449) [-1511.493] (-1518.646) (-1506.341) -- 0:01:45
      222500 -- [-1505.552] (-1507.416) (-1509.355) (-1507.977) * [-1507.782] (-1508.921) (-1521.939) (-1511.813) -- 0:01:44
      223000 -- [-1506.175] (-1506.169) (-1507.582) (-1507.845) * (-1509.972) [-1513.232] (-1516.150) (-1510.200) -- 0:01:44
      223500 -- [-1510.396] (-1513.068) (-1510.675) (-1508.656) * (-1509.120) (-1506.723) (-1520.323) [-1507.541] -- 0:01:44
      224000 -- [-1507.970] (-1505.683) (-1509.302) (-1514.208) * (-1512.826) (-1510.151) (-1511.647) [-1507.494] -- 0:01:43
      224500 -- [-1508.131] (-1507.522) (-1511.960) (-1510.481) * (-1506.990) (-1510.640) (-1507.985) [-1507.265] -- 0:01:47
      225000 -- (-1507.769) (-1505.845) [-1513.024] (-1507.335) * (-1511.773) [-1508.301] (-1512.776) (-1504.850) -- 0:01:46

      Average standard deviation of split frequencies: 0.009386

      225500 -- (-1510.555) (-1508.036) [-1514.858] (-1506.710) * [-1509.636] (-1507.522) (-1515.783) (-1514.586) -- 0:01:46
      226000 -- [-1505.958] (-1511.822) (-1509.094) (-1507.134) * (-1507.946) (-1511.609) [-1507.311] (-1511.165) -- 0:01:46
      226500 -- (-1509.541) (-1506.701) (-1511.558) [-1509.330] * (-1505.073) (-1509.683) (-1509.475) [-1508.387] -- 0:01:45
      227000 -- (-1508.086) (-1508.587) [-1508.826] (-1509.022) * (-1507.853) (-1509.136) (-1508.752) [-1512.781] -- 0:01:45
      227500 -- (-1511.510) (-1505.832) (-1512.685) [-1506.666] * (-1507.847) [-1506.387] (-1505.562) (-1508.602) -- 0:01:45
      228000 -- (-1515.353) (-1504.783) (-1510.164) [-1503.842] * (-1510.841) [-1508.194] (-1508.320) (-1507.030) -- 0:01:44
      228500 -- [-1509.409] (-1506.299) (-1516.076) (-1509.454) * (-1511.074) (-1507.490) (-1516.546) [-1509.542] -- 0:01:44
      229000 -- [-1508.037] (-1510.946) (-1514.500) (-1510.414) * (-1504.382) (-1515.674) (-1513.517) [-1507.853] -- 0:01:44
      229500 -- [-1507.026] (-1508.652) (-1507.374) (-1507.756) * (-1506.747) (-1517.426) (-1505.539) [-1510.843] -- 0:01:44
      230000 -- [-1506.497] (-1509.541) (-1513.476) (-1512.440) * [-1511.371] (-1509.165) (-1505.538) (-1509.583) -- 0:01:43

      Average standard deviation of split frequencies: 0.006131

      230500 -- (-1510.788) (-1508.836) [-1507.103] (-1508.802) * (-1511.233) (-1504.895) (-1508.336) [-1507.872] -- 0:01:43
      231000 -- [-1504.250] (-1509.839) (-1508.162) (-1508.211) * (-1514.357) (-1508.059) (-1507.117) [-1509.087] -- 0:01:43
      231500 -- (-1511.260) [-1506.054] (-1509.671) (-1510.808) * (-1510.280) (-1508.966) (-1506.455) [-1506.536] -- 0:01:42
      232000 -- (-1508.808) (-1510.261) [-1509.855] (-1509.947) * (-1515.603) [-1504.176] (-1505.583) (-1510.364) -- 0:01:45
      232500 -- (-1508.933) [-1511.117] (-1513.963) (-1508.583) * (-1510.869) (-1516.803) (-1513.809) [-1509.193] -- 0:01:45
      233000 -- (-1504.475) (-1517.558) (-1511.648) [-1503.274] * [-1507.642] (-1511.813) (-1509.096) (-1510.822) -- 0:01:45
      233500 -- (-1508.433) (-1513.588) [-1510.972] (-1508.112) * (-1506.200) (-1507.756) (-1511.361) [-1503.229] -- 0:01:45
      234000 -- [-1505.926] (-1511.300) (-1515.694) (-1511.804) * (-1510.189) [-1507.923] (-1509.717) (-1506.026) -- 0:01:44
      234500 -- (-1502.905) (-1507.956) (-1506.905) [-1511.120] * (-1512.718) [-1507.907] (-1514.030) (-1510.660) -- 0:01:44
      235000 -- (-1509.240) (-1513.228) [-1506.538] (-1514.923) * (-1510.581) (-1507.032) (-1510.889) [-1510.490] -- 0:01:44

      Average standard deviation of split frequencies: 0.001997

      235500 -- (-1509.931) (-1513.206) (-1512.522) [-1512.421] * (-1510.150) (-1511.150) [-1510.143] (-1522.019) -- 0:01:43
      236000 -- (-1509.116) (-1512.387) (-1511.417) [-1510.976] * (-1511.526) (-1507.396) (-1509.327) [-1509.265] -- 0:01:43
      236500 -- (-1520.337) (-1507.350) [-1503.645] (-1510.054) * (-1515.319) (-1508.765) [-1506.047] (-1507.632) -- 0:01:43
      237000 -- (-1516.079) [-1505.375] (-1506.353) (-1506.137) * [-1507.884] (-1510.502) (-1506.762) (-1508.722) -- 0:01:43
      237500 -- (-1509.570) (-1511.788) [-1505.520] (-1510.316) * [-1513.125] (-1508.057) (-1512.800) (-1509.158) -- 0:01:42
      238000 -- (-1510.010) [-1508.814] (-1513.572) (-1512.476) * (-1505.837) (-1505.399) (-1515.729) [-1506.447] -- 0:01:42
      238500 -- (-1509.913) (-1507.362) [-1508.805] (-1510.149) * (-1509.572) (-1507.245) (-1510.665) [-1509.151] -- 0:01:42
      239000 -- (-1510.361) [-1506.730] (-1518.939) (-1511.838) * (-1506.733) (-1512.318) (-1514.281) [-1504.836] -- 0:01:45
      239500 -- [-1511.059] (-1505.876) (-1513.722) (-1515.612) * (-1505.509) [-1505.707] (-1517.902) (-1506.180) -- 0:01:44
      240000 -- (-1509.246) (-1507.787) (-1510.911) [-1509.667] * (-1509.803) (-1508.390) [-1503.615] (-1509.189) -- 0:01:44

      Average standard deviation of split frequencies: 0.003917

      240500 -- (-1515.902) [-1509.409] (-1510.423) (-1510.281) * (-1510.013) [-1512.434] (-1513.642) (-1506.774) -- 0:01:44
      241000 -- (-1505.154) (-1509.807) (-1512.191) [-1505.267] * (-1511.995) (-1508.284) [-1508.946] (-1505.299) -- 0:01:43
      241500 -- (-1510.272) (-1506.746) (-1509.718) [-1507.212] * (-1513.224) (-1511.096) (-1508.715) [-1510.255] -- 0:01:43
      242000 -- [-1507.079] (-1511.036) (-1508.893) (-1506.673) * (-1520.069) (-1510.860) (-1510.404) [-1506.051] -- 0:01:43
      242500 -- (-1509.244) [-1510.778] (-1509.852) (-1508.421) * (-1518.984) [-1508.461] (-1510.775) (-1507.216) -- 0:01:43
      243000 -- (-1514.237) (-1506.004) [-1509.165] (-1505.089) * (-1517.611) [-1507.938] (-1511.527) (-1507.298) -- 0:01:42
      243500 -- (-1512.005) [-1509.100] (-1516.154) (-1506.516) * (-1516.470) [-1513.359] (-1516.973) (-1512.909) -- 0:01:42
      244000 -- (-1510.216) (-1508.717) (-1513.128) [-1507.440] * (-1516.291) [-1504.024] (-1509.355) (-1507.899) -- 0:01:42
      244500 -- (-1508.122) [-1505.956] (-1506.284) (-1515.147) * (-1513.603) (-1509.457) (-1510.954) [-1509.603] -- 0:01:41
      245000 -- (-1510.390) (-1503.797) [-1506.797] (-1514.773) * (-1514.362) (-1508.974) (-1516.709) [-1504.918] -- 0:01:41

      Average standard deviation of split frequencies: 0.011498

      245500 -- [-1512.162] (-1506.277) (-1511.698) (-1508.962) * (-1513.104) (-1508.865) [-1509.767] (-1512.323) -- 0:01:41
      246000 -- (-1508.870) (-1506.163) (-1514.642) [-1510.745] * (-1510.446) (-1507.453) (-1513.258) [-1505.167] -- 0:01:41
      246500 -- (-1510.691) (-1513.401) (-1505.830) [-1506.849] * [-1508.486] (-1509.601) (-1510.045) (-1504.718) -- 0:01:43
      247000 -- (-1508.650) (-1507.331) (-1509.810) [-1507.917] * (-1510.841) [-1511.049] (-1507.109) (-1505.413) -- 0:01:43
      247500 -- (-1506.283) [-1504.810] (-1516.307) (-1513.082) * (-1516.275) [-1505.943] (-1509.214) (-1509.030) -- 0:01:43
      248000 -- (-1512.379) (-1510.388) [-1508.183] (-1508.277) * (-1512.854) [-1505.568] (-1510.132) (-1508.789) -- 0:01:43
      248500 -- (-1513.034) (-1513.144) [-1505.564] (-1513.419) * [-1507.264] (-1508.972) (-1505.541) (-1510.730) -- 0:01:42
      249000 -- [-1508.123] (-1512.389) (-1507.498) (-1515.680) * (-1516.010) (-1508.917) (-1507.153) [-1507.147] -- 0:01:42
      249500 -- [-1508.531] (-1512.259) (-1510.692) (-1512.333) * (-1517.104) (-1513.035) (-1508.817) [-1503.790] -- 0:01:42
      250000 -- (-1507.136) [-1507.373] (-1513.428) (-1514.734) * [-1507.307] (-1513.672) (-1506.343) (-1506.509) -- 0:01:42

      Average standard deviation of split frequencies: 0.013164

      250500 -- (-1510.438) [-1506.977] (-1511.786) (-1512.161) * (-1506.424) (-1506.981) [-1507.559] (-1514.929) -- 0:01:41
      251000 -- (-1510.487) [-1507.202] (-1508.662) (-1512.742) * (-1511.764) (-1507.818) [-1510.243] (-1511.424) -- 0:01:41
      251500 -- (-1513.497) (-1507.183) [-1507.980] (-1518.332) * (-1508.793) (-1506.531) [-1509.047] (-1510.826) -- 0:01:41
      252000 -- (-1509.909) (-1508.522) (-1513.285) [-1510.692] * (-1510.216) (-1511.760) (-1503.516) [-1511.750] -- 0:01:40
      252500 -- (-1510.680) (-1507.546) (-1511.121) [-1509.157] * (-1516.926) (-1517.047) [-1506.549] (-1506.649) -- 0:01:40
      253000 -- [-1506.237] (-1507.114) (-1509.455) (-1511.326) * [-1506.524] (-1510.347) (-1506.202) (-1511.547) -- 0:01:40
      253500 -- (-1508.151) (-1508.383) [-1505.405] (-1508.442) * (-1508.002) [-1507.247] (-1506.942) (-1511.582) -- 0:01:43
      254000 -- (-1508.915) [-1507.779] (-1509.563) (-1514.166) * [-1508.097] (-1510.771) (-1504.895) (-1507.693) -- 0:01:42
      254500 -- (-1508.266) [-1515.034] (-1507.149) (-1514.957) * [-1504.129] (-1512.555) (-1512.490) (-1505.915) -- 0:01:42
      255000 -- [-1508.474] (-1507.499) (-1511.049) (-1511.183) * (-1506.141) (-1514.660) [-1507.100] (-1512.918) -- 0:01:42

      Average standard deviation of split frequencies: 0.011969

      255500 -- (-1512.651) (-1507.309) [-1508.869] (-1507.154) * (-1507.250) (-1510.728) (-1508.718) [-1511.893] -- 0:01:41
      256000 -- (-1513.986) (-1509.699) (-1510.358) [-1509.571] * [-1514.835] (-1508.579) (-1511.891) (-1511.774) -- 0:01:41
      256500 -- [-1510.934] (-1510.195) (-1511.514) (-1513.566) * (-1508.160) (-1506.044) [-1504.404] (-1516.967) -- 0:01:41
      257000 -- (-1509.755) (-1515.421) [-1507.824] (-1513.803) * [-1512.876] (-1511.073) (-1507.978) (-1513.936) -- 0:01:41
      257500 -- [-1504.992] (-1508.050) (-1512.152) (-1518.179) * (-1511.075) (-1507.953) (-1511.578) [-1514.625] -- 0:01:40
      258000 -- (-1507.178) (-1512.794) (-1509.438) [-1510.806] * (-1513.091) [-1507.413] (-1508.746) (-1508.662) -- 0:01:40
      258500 -- (-1511.140) [-1511.843] (-1514.046) (-1510.367) * (-1508.755) (-1510.860) (-1505.512) [-1511.248] -- 0:01:40
      259000 -- (-1510.318) [-1509.272] (-1507.426) (-1510.889) * (-1512.496) (-1509.502) [-1502.948] (-1509.231) -- 0:01:40
      259500 -- (-1507.182) (-1510.418) (-1506.042) [-1511.259] * (-1513.652) (-1507.198) [-1505.536] (-1508.573) -- 0:01:39
      260000 -- (-1515.493) [-1511.173] (-1509.565) (-1505.994) * (-1511.305) (-1507.632) (-1510.538) [-1508.144] -- 0:01:39

      Average standard deviation of split frequencies: 0.012659

      260500 -- (-1514.408) (-1515.835) (-1509.919) [-1505.936] * (-1508.323) [-1508.103] (-1506.294) (-1512.658) -- 0:01:39
      261000 -- (-1507.885) (-1510.890) (-1509.010) [-1511.489] * [-1510.800] (-1510.524) (-1513.917) (-1512.901) -- 0:01:41
      261500 -- (-1521.400) (-1511.023) (-1504.976) [-1510.206] * (-1513.005) (-1510.124) (-1512.881) [-1513.933] -- 0:01:41
      262000 -- (-1510.402) (-1514.116) (-1509.919) [-1512.808] * (-1515.145) [-1508.897] (-1513.111) (-1509.728) -- 0:01:41
      262500 -- [-1508.137] (-1511.757) (-1506.969) (-1513.088) * (-1517.854) (-1511.074) (-1505.388) [-1507.797] -- 0:01:41
      263000 -- (-1512.221) (-1504.151) (-1507.521) [-1505.892] * [-1510.794] (-1512.468) (-1508.348) (-1513.800) -- 0:01:40
      263500 -- (-1519.668) [-1504.693] (-1513.050) (-1508.470) * [-1504.637] (-1509.645) (-1508.338) (-1512.066) -- 0:01:40
      264000 -- (-1512.148) (-1507.067) [-1505.179] (-1508.381) * (-1508.196) [-1505.235] (-1511.482) (-1506.947) -- 0:01:40
      264500 -- (-1508.016) [-1507.282] (-1511.406) (-1507.666) * [-1514.483] (-1507.295) (-1511.819) (-1511.977) -- 0:01:40
      265000 -- (-1509.731) (-1508.259) [-1506.375] (-1507.520) * [-1509.491] (-1513.359) (-1508.030) (-1509.498) -- 0:01:39

      Average standard deviation of split frequencies: 0.014178

      265500 -- (-1507.806) (-1510.037) (-1511.505) [-1507.013] * [-1507.323] (-1509.142) (-1512.878) (-1511.138) -- 0:01:39
      266000 -- [-1513.135] (-1511.300) (-1505.088) (-1504.251) * (-1509.491) [-1507.136] (-1513.748) (-1516.877) -- 0:01:39
      266500 -- (-1510.910) (-1511.773) [-1507.037] (-1505.952) * (-1510.987) [-1504.133] (-1518.724) (-1509.712) -- 0:01:39
      267000 -- (-1505.963) (-1508.710) (-1513.040) [-1511.460] * (-1511.719) [-1507.270] (-1520.459) (-1508.694) -- 0:01:38
      267500 -- [-1511.955] (-1508.657) (-1513.709) (-1508.620) * (-1513.630) (-1507.439) (-1508.336) [-1503.806] -- 0:01:38
      268000 -- [-1511.763] (-1507.913) (-1517.941) (-1511.614) * (-1509.628) [-1504.839] (-1510.322) (-1509.616) -- 0:01:38
      268500 -- [-1508.411] (-1512.609) (-1514.239) (-1512.752) * (-1509.590) (-1507.704) (-1519.321) [-1508.929] -- 0:01:40
      269000 -- (-1510.843) (-1514.461) [-1508.208] (-1510.698) * (-1509.592) (-1508.840) (-1509.155) [-1504.941] -- 0:01:40
      269500 -- (-1514.822) (-1514.177) (-1510.507) [-1507.905] * (-1507.919) (-1507.620) [-1510.302] (-1505.783) -- 0:01:40
      270000 -- (-1507.156) (-1509.625) (-1507.898) [-1512.718] * (-1506.218) (-1509.980) (-1510.815) [-1503.058] -- 0:01:40

      Average standard deviation of split frequencies: 0.020029

      270500 -- (-1511.088) (-1510.716) [-1509.402] (-1506.268) * (-1510.277) [-1509.624] (-1508.915) (-1513.482) -- 0:01:39
      271000 -- (-1512.996) (-1513.310) (-1508.440) [-1509.301] * (-1515.084) (-1509.512) (-1514.596) [-1504.251] -- 0:01:39
      271500 -- (-1512.053) [-1507.776] (-1511.321) (-1513.311) * (-1508.019) (-1518.611) (-1518.784) [-1510.121] -- 0:01:39
      272000 -- [-1510.031] (-1507.081) (-1513.633) (-1508.422) * (-1508.521) [-1509.420] (-1509.961) (-1511.481) -- 0:01:39
      272500 -- (-1506.774) (-1510.499) (-1505.336) [-1512.385] * (-1510.511) [-1508.749] (-1515.886) (-1514.653) -- 0:01:38
      273000 -- (-1504.687) (-1511.367) [-1513.577] (-1509.616) * (-1508.288) (-1510.106) (-1514.076) [-1510.017] -- 0:01:38
      273500 -- (-1510.749) (-1511.526) [-1509.431] (-1511.821) * [-1508.652] (-1507.925) (-1521.532) (-1506.454) -- 0:01:38
      274000 -- (-1506.102) (-1510.325) (-1509.308) [-1506.783] * [-1509.694] (-1507.740) (-1510.832) (-1515.842) -- 0:01:38
      274500 -- (-1508.581) [-1512.556] (-1511.771) (-1508.756) * [-1504.835] (-1506.616) (-1505.013) (-1507.048) -- 0:01:37
      275000 -- (-1506.435) (-1514.903) [-1508.596] (-1517.894) * [-1508.436] (-1511.548) (-1511.689) (-1510.720) -- 0:01:37

      Average standard deviation of split frequencies: 0.017080

      275500 -- (-1510.167) (-1507.572) [-1506.688] (-1512.920) * (-1506.297) (-1509.725) (-1506.791) [-1508.535] -- 0:01:39
      276000 -- (-1510.575) (-1513.768) [-1508.546] (-1509.580) * (-1510.477) (-1507.928) (-1506.990) [-1508.685] -- 0:01:39
      276500 -- (-1509.719) [-1514.084] (-1513.929) (-1520.104) * (-1514.231) [-1512.009] (-1511.837) (-1508.672) -- 0:01:39
      277000 -- (-1507.735) [-1507.484] (-1506.808) (-1516.906) * (-1504.998) (-1512.597) (-1515.948) [-1507.249] -- 0:01:39
      277500 -- [-1507.354] (-1508.137) (-1507.895) (-1509.072) * (-1506.342) [-1514.875] (-1507.747) (-1511.652) -- 0:01:38
      278000 -- (-1511.618) (-1507.984) [-1506.096] (-1516.211) * [-1505.586] (-1511.610) (-1512.574) (-1509.872) -- 0:01:38
      278500 -- (-1511.103) (-1509.981) [-1507.119] (-1510.084) * [-1506.928] (-1511.617) (-1515.866) (-1511.091) -- 0:01:38
      279000 -- (-1508.276) (-1515.335) [-1511.292] (-1508.245) * [-1509.967] (-1513.574) (-1523.038) (-1513.747) -- 0:01:38
      279500 -- (-1505.775) [-1508.526] (-1507.442) (-1508.303) * (-1516.118) [-1511.123] (-1510.974) (-1509.706) -- 0:01:37
      280000 -- (-1507.471) (-1510.034) [-1512.964] (-1514.914) * (-1509.458) (-1506.837) (-1512.682) [-1512.729] -- 0:01:37

      Average standard deviation of split frequencies: 0.013437

      280500 -- (-1503.529) [-1506.439] (-1517.303) (-1517.544) * (-1509.469) (-1513.150) (-1509.795) [-1506.496] -- 0:01:37
      281000 -- (-1513.649) (-1506.435) [-1513.002] (-1514.761) * (-1511.562) (-1509.446) [-1510.253] (-1509.049) -- 0:01:37
      281500 -- (-1510.092) [-1505.565] (-1503.930) (-1511.332) * [-1509.670] (-1512.403) (-1514.332) (-1509.032) -- 0:01:36
      282000 -- [-1509.926] (-1514.270) (-1508.805) (-1511.010) * (-1508.466) (-1513.001) [-1516.491] (-1513.468) -- 0:01:36
      282500 -- [-1508.272] (-1515.808) (-1507.084) (-1514.695) * (-1513.171) (-1513.869) (-1511.015) [-1510.554] -- 0:01:36
      283000 -- (-1510.707) (-1508.317) [-1506.903] (-1512.536) * (-1510.680) (-1509.337) [-1509.759] (-1516.138) -- 0:01:38
      283500 -- (-1514.545) (-1509.280) [-1506.063] (-1514.545) * (-1513.503) (-1514.588) (-1509.608) [-1511.030] -- 0:01:38
      284000 -- (-1516.373) (-1511.189) (-1507.337) [-1509.122] * (-1511.050) (-1507.387) [-1509.195] (-1512.044) -- 0:01:38
      284500 -- (-1507.364) (-1513.101) [-1505.150] (-1507.366) * [-1511.693] (-1506.296) (-1509.293) (-1512.414) -- 0:01:38
      285000 -- (-1512.391) (-1509.604) [-1507.806] (-1508.352) * (-1508.052) (-1511.483) [-1504.514] (-1514.287) -- 0:01:37

      Average standard deviation of split frequencies: 0.006593

      285500 -- (-1509.083) (-1508.370) (-1504.228) [-1507.152] * (-1510.628) [-1509.418] (-1509.666) (-1512.710) -- 0:01:37
      286000 -- (-1509.366) (-1508.303) (-1511.625) [-1505.312] * (-1514.668) [-1504.277] (-1507.563) (-1512.925) -- 0:01:37
      286500 -- (-1511.164) (-1504.788) (-1507.258) [-1513.179] * [-1515.389] (-1511.386) (-1506.176) (-1513.190) -- 0:01:37
      287000 -- [-1505.812] (-1510.719) (-1517.688) (-1509.031) * (-1510.288) [-1510.343] (-1510.999) (-1514.203) -- 0:01:36
      287500 -- (-1513.240) (-1510.501) (-1510.687) [-1511.371] * [-1507.890] (-1505.495) (-1517.627) (-1510.746) -- 0:01:36
      288000 -- (-1511.476) (-1514.837) [-1513.161] (-1509.546) * (-1508.830) (-1513.798) (-1512.267) [-1506.262] -- 0:01:36
      288500 -- [-1507.137] (-1509.300) (-1512.045) (-1510.748) * (-1509.648) (-1513.364) [-1506.709] (-1507.897) -- 0:01:36
      289000 -- (-1508.419) (-1509.883) [-1505.514] (-1507.069) * [-1513.871] (-1508.199) (-1510.772) (-1510.427) -- 0:01:35
      289500 -- (-1508.873) (-1510.697) [-1506.841] (-1508.849) * (-1510.972) (-1506.846) (-1508.061) [-1506.148] -- 0:01:35
      290000 -- (-1507.951) (-1510.697) (-1506.949) [-1507.045] * (-1511.369) (-1511.521) [-1506.702] (-1514.690) -- 0:01:35

      Average standard deviation of split frequencies: 0.005676

      290500 -- (-1507.538) [-1507.086] (-1505.114) (-1510.287) * (-1515.052) (-1506.963) (-1508.299) [-1512.721] -- 0:01:37
      291000 -- (-1511.270) (-1508.973) (-1506.610) [-1508.725] * (-1511.321) (-1510.901) (-1510.634) [-1509.728] -- 0:01:37
      291500 -- (-1510.907) (-1509.859) (-1503.807) [-1506.274] * (-1513.519) [-1508.508] (-1510.901) (-1516.299) -- 0:01:37
      292000 -- (-1514.394) [-1509.883] (-1506.072) (-1511.173) * (-1512.298) (-1511.094) (-1519.628) [-1507.253] -- 0:01:36
      292500 -- (-1510.143) [-1506.448] (-1511.479) (-1511.763) * (-1514.499) [-1513.348] (-1514.267) (-1509.769) -- 0:01:36
      293000 -- (-1505.676) [-1506.555] (-1512.993) (-1511.609) * [-1508.638] (-1513.768) (-1513.183) (-1504.998) -- 0:01:36
      293500 -- (-1510.253) (-1512.946) (-1510.216) [-1506.822] * [-1507.094] (-1513.500) (-1518.122) (-1506.480) -- 0:01:36
      294000 -- (-1511.535) (-1514.117) [-1507.716] (-1517.231) * (-1507.751) [-1510.384] (-1513.028) (-1508.218) -- 0:01:36
      294500 -- [-1509.270] (-1515.964) (-1506.726) (-1510.551) * [-1510.051] (-1512.260) (-1511.974) (-1508.613) -- 0:01:35
      295000 -- (-1511.960) (-1510.304) (-1510.046) [-1515.002] * (-1508.636) (-1507.098) (-1509.886) [-1508.543] -- 0:01:35

      Average standard deviation of split frequencies: 0.001593

      295500 -- (-1513.624) (-1508.678) (-1507.956) [-1511.335] * (-1512.259) (-1509.004) [-1507.917] (-1508.854) -- 0:01:35
      296000 -- (-1512.913) [-1506.037] (-1507.159) (-1509.554) * (-1508.282) [-1511.095] (-1507.864) (-1510.851) -- 0:01:35
      296500 -- (-1520.022) (-1509.018) [-1508.066] (-1511.128) * (-1513.240) (-1511.550) [-1508.701] (-1508.933) -- 0:01:34
      297000 -- (-1507.803) [-1511.622] (-1511.390) (-1511.789) * (-1511.448) [-1510.596] (-1512.694) (-1510.548) -- 0:01:34
      297500 -- [-1516.202] (-1514.675) (-1511.507) (-1510.058) * (-1508.910) (-1514.706) (-1509.471) [-1510.234] -- 0:01:36
      298000 -- (-1519.325) (-1508.615) [-1508.380] (-1510.581) * (-1509.273) (-1513.043) (-1507.628) [-1508.796] -- 0:01:36
      298500 -- (-1517.385) (-1508.560) [-1513.559] (-1509.535) * (-1506.357) [-1508.678] (-1508.285) (-1510.460) -- 0:01:36
      299000 -- [-1506.911] (-1514.683) (-1511.410) (-1513.491) * (-1506.628) (-1511.416) [-1510.333] (-1509.831) -- 0:01:36
      299500 -- (-1516.706) [-1510.692] (-1518.422) (-1512.140) * [-1505.124] (-1515.466) (-1509.306) (-1513.892) -- 0:01:35
      300000 -- [-1513.486] (-1506.329) (-1513.611) (-1510.479) * (-1512.843) [-1511.305] (-1512.161) (-1513.683) -- 0:01:35

      Average standard deviation of split frequencies: 0.004704

      300500 -- (-1513.640) (-1506.864) (-1507.486) [-1504.548] * (-1505.191) [-1507.263] (-1511.627) (-1511.504) -- 0:01:35
      301000 -- (-1506.562) (-1508.581) (-1506.609) [-1505.981] * [-1505.259] (-1509.258) (-1506.775) (-1512.077) -- 0:01:35
      301500 -- (-1506.244) [-1508.742] (-1508.163) (-1509.755) * (-1504.555) (-1515.051) [-1507.729] (-1511.489) -- 0:01:34
      302000 -- (-1513.444) (-1505.517) (-1507.427) [-1513.266] * (-1515.194) [-1507.814] (-1511.595) (-1510.880) -- 0:01:34
      302500 -- (-1505.964) (-1508.709) [-1505.825] (-1507.816) * (-1510.381) (-1516.972) (-1504.743) [-1510.383] -- 0:01:34
      303000 -- (-1509.288) [-1508.701] (-1508.634) (-1512.974) * (-1516.629) [-1511.821] (-1510.488) (-1508.734) -- 0:01:34
      303500 -- (-1504.569) [-1507.198] (-1507.023) (-1510.890) * (-1508.077) (-1511.075) (-1511.653) [-1511.694] -- 0:01:34
      304000 -- (-1510.335) (-1507.339) (-1509.209) [-1507.098] * (-1510.080) (-1512.746) (-1510.154) [-1509.710] -- 0:01:33
      304500 -- (-1512.639) [-1507.950] (-1507.448) (-1509.399) * (-1510.551) (-1514.003) [-1510.000] (-1514.126) -- 0:01:33
      305000 -- (-1510.976) (-1512.582) [-1513.179] (-1512.722) * (-1505.886) (-1509.882) (-1505.066) [-1510.101] -- 0:01:35

      Average standard deviation of split frequencies: 0.003081

      305500 -- (-1509.473) (-1509.930) [-1506.675] (-1512.018) * (-1505.333) (-1508.895) (-1515.709) [-1508.854] -- 0:01:35
      306000 -- [-1507.148] (-1507.597) (-1508.286) (-1508.761) * [-1508.096] (-1515.161) (-1507.885) (-1507.995) -- 0:01:35
      306500 -- [-1506.748] (-1513.370) (-1516.894) (-1509.319) * (-1508.738) (-1518.039) [-1509.030] (-1510.285) -- 0:01:35
      307000 -- (-1510.629) (-1514.975) (-1507.155) [-1511.747] * (-1509.399) (-1509.877) (-1513.418) [-1507.131] -- 0:01:34
      307500 -- (-1515.258) (-1517.098) (-1509.506) [-1512.055] * [-1509.181] (-1507.056) (-1510.279) (-1513.585) -- 0:01:34
      308000 -- (-1509.474) [-1508.981] (-1508.891) (-1508.510) * (-1510.782) [-1508.113] (-1513.798) (-1507.373) -- 0:01:34
      308500 -- [-1506.302] (-1510.951) (-1507.578) (-1507.824) * (-1513.777) (-1508.220) (-1511.443) [-1511.957] -- 0:01:34
      309000 -- [-1511.032] (-1517.163) (-1513.880) (-1514.352) * (-1516.737) (-1513.206) [-1505.736] (-1515.503) -- 0:01:33
      309500 -- [-1504.350] (-1512.341) (-1509.127) (-1511.266) * (-1512.762) (-1516.447) (-1507.431) [-1516.164] -- 0:01:33
      310000 -- (-1510.340) (-1507.317) (-1509.245) [-1512.907] * (-1512.514) (-1516.946) (-1511.157) [-1509.576] -- 0:01:33

      Average standard deviation of split frequencies: 0.003035

      310500 -- [-1507.421] (-1506.027) (-1511.488) (-1516.017) * [-1508.246] (-1511.159) (-1505.789) (-1509.492) -- 0:01:33
      311000 -- (-1509.506) [-1508.799] (-1509.348) (-1516.092) * (-1511.891) [-1506.238] (-1509.396) (-1506.844) -- 0:01:33
      311500 -- (-1510.938) (-1508.205) (-1507.924) [-1507.884] * (-1513.854) (-1503.951) (-1508.646) [-1506.747] -- 0:01:32
      312000 -- (-1509.195) (-1510.848) (-1511.037) [-1507.291] * [-1513.929] (-1510.288) (-1509.674) (-1512.793) -- 0:01:34
      312500 -- (-1507.857) (-1517.781) (-1507.833) [-1512.832] * (-1510.937) (-1512.373) [-1507.974] (-1512.537) -- 0:01:34
      313000 -- (-1510.223) (-1511.194) [-1511.877] (-1508.514) * [-1506.637] (-1508.907) (-1511.086) (-1510.138) -- 0:01:34
      313500 -- (-1507.500) (-1509.279) (-1509.937) [-1510.887] * [-1511.871] (-1509.423) (-1520.491) (-1514.153) -- 0:01:34
      314000 -- (-1512.793) [-1509.533] (-1514.712) (-1516.611) * [-1506.838] (-1508.960) (-1512.266) (-1516.324) -- 0:01:33
      314500 -- [-1510.199] (-1506.894) (-1505.800) (-1507.987) * [-1508.798] (-1509.688) (-1509.369) (-1513.842) -- 0:01:33
      315000 -- (-1509.143) (-1507.343) (-1511.544) [-1505.826] * [-1509.683] (-1509.064) (-1512.033) (-1507.386) -- 0:01:33

      Average standard deviation of split frequencies: 0.002984

      315500 -- (-1513.868) [-1504.771] (-1511.924) (-1507.008) * (-1513.471) (-1509.418) [-1510.641] (-1508.735) -- 0:01:33
      316000 -- (-1510.173) (-1505.694) (-1515.820) [-1510.218] * (-1510.466) [-1517.496] (-1508.856) (-1512.962) -- 0:01:33
      316500 -- (-1507.611) (-1503.607) (-1514.075) [-1503.656] * [-1506.124] (-1510.140) (-1511.379) (-1513.049) -- 0:01:32
      317000 -- (-1506.047) (-1514.694) [-1510.191] (-1507.782) * (-1509.443) (-1508.408) [-1506.079] (-1519.962) -- 0:01:32
      317500 -- [-1509.082] (-1509.887) (-1511.283) (-1510.577) * (-1507.407) (-1505.679) [-1509.729] (-1510.066) -- 0:01:32
      318000 -- [-1510.419] (-1510.925) (-1512.395) (-1506.978) * (-1508.461) (-1515.305) [-1509.211] (-1509.585) -- 0:01:32
      318500 -- (-1512.348) (-1509.415) [-1510.382] (-1512.047) * [-1508.927] (-1517.643) (-1508.300) (-1513.406) -- 0:01:32
      319000 -- (-1506.284) (-1515.086) (-1512.053) [-1510.129] * [-1505.717] (-1517.531) (-1506.018) (-1510.109) -- 0:01:31
      319500 -- (-1511.821) (-1513.773) (-1512.412) [-1508.438] * (-1513.640) (-1509.648) (-1506.071) [-1507.356] -- 0:01:33
      320000 -- (-1516.079) (-1512.727) [-1506.618] (-1507.239) * (-1511.776) [-1510.221] (-1510.280) (-1513.058) -- 0:01:33

      Average standard deviation of split frequencies: 0.002205

      320500 -- (-1514.706) (-1507.980) (-1506.616) [-1509.468] * [-1510.801] (-1509.137) (-1509.238) (-1508.049) -- 0:01:33
      321000 -- (-1512.735) [-1506.208] (-1506.606) (-1511.064) * (-1505.283) (-1511.148) (-1508.745) [-1508.944] -- 0:01:33
      321500 -- (-1514.799) (-1516.190) [-1507.263] (-1513.561) * (-1511.125) [-1508.706] (-1513.193) (-1509.791) -- 0:01:32
      322000 -- [-1511.471] (-1514.609) (-1507.398) (-1515.896) * (-1511.666) (-1513.812) [-1510.580] (-1505.624) -- 0:01:32
      322500 -- (-1513.407) (-1506.873) (-1504.573) [-1514.044] * (-1509.376) (-1514.379) [-1509.328] (-1510.542) -- 0:01:32
      323000 -- (-1510.383) [-1507.383] (-1503.625) (-1512.680) * (-1508.617) (-1515.246) [-1512.268] (-1506.787) -- 0:01:32
      323500 -- (-1507.653) [-1507.065] (-1510.548) (-1506.662) * (-1507.166) (-1510.361) [-1514.671] (-1506.388) -- 0:01:32
      324000 -- (-1505.348) [-1506.495] (-1507.192) (-1508.548) * (-1509.483) [-1512.309] (-1509.870) (-1505.782) -- 0:01:31
      324500 -- (-1506.905) [-1511.148] (-1515.657) (-1511.164) * (-1507.218) (-1509.009) (-1505.819) [-1507.473] -- 0:01:31
      325000 -- (-1510.793) (-1508.483) [-1509.207] (-1508.624) * (-1510.001) (-1515.865) [-1508.916] (-1504.629) -- 0:01:31

      Average standard deviation of split frequencies: 0.003615

      325500 -- (-1507.110) (-1508.577) [-1510.301] (-1508.860) * (-1505.775) (-1508.106) (-1508.563) [-1506.845] -- 0:01:31
      326000 -- (-1508.894) [-1512.353] (-1509.015) (-1511.922) * (-1507.338) [-1513.473] (-1510.421) (-1509.805) -- 0:01:30
      326500 -- [-1508.640] (-1516.246) (-1510.453) (-1501.890) * (-1511.972) (-1510.561) [-1505.484] (-1509.145) -- 0:01:32
      327000 -- (-1506.611) [-1509.996] (-1512.386) (-1504.876) * (-1510.703) (-1508.208) (-1507.996) [-1508.579] -- 0:01:32
      327500 -- (-1507.678) (-1509.362) (-1508.492) [-1507.317] * (-1513.530) [-1506.598] (-1506.804) (-1511.113) -- 0:01:32
      328000 -- (-1515.143) [-1508.827] (-1509.162) (-1509.773) * (-1514.986) (-1509.469) [-1505.743] (-1512.047) -- 0:01:32
      328500 -- [-1511.926] (-1509.298) (-1508.521) (-1506.678) * (-1511.965) [-1507.524] (-1508.187) (-1511.109) -- 0:01:31
      329000 -- (-1512.247) [-1511.072] (-1507.581) (-1505.961) * [-1511.044] (-1510.807) (-1507.960) (-1514.225) -- 0:01:31
      329500 -- (-1509.121) [-1510.740] (-1517.368) (-1507.248) * (-1512.720) [-1507.057] (-1509.322) (-1513.979) -- 0:01:31
      330000 -- (-1510.201) (-1517.763) [-1510.330] (-1506.811) * (-1508.402) (-1508.272) (-1507.717) [-1512.677] -- 0:01:31

      Average standard deviation of split frequencies: 0.003564

      330500 -- (-1508.797) [-1509.144] (-1506.763) (-1511.879) * (-1512.084) [-1508.453] (-1512.156) (-1515.295) -- 0:01:31
      331000 -- [-1506.291] (-1505.649) (-1511.893) (-1509.520) * (-1515.362) [-1508.103] (-1516.997) (-1509.154) -- 0:01:30
      331500 -- (-1505.060) (-1511.351) [-1510.206] (-1513.571) * (-1513.609) [-1508.341] (-1511.989) (-1508.619) -- 0:01:30
      332000 -- (-1504.136) (-1505.831) (-1511.909) [-1507.980] * [-1511.525] (-1506.717) (-1509.140) (-1510.233) -- 0:01:30
      332500 -- (-1507.872) (-1509.385) (-1511.874) [-1506.563] * (-1511.893) [-1510.767] (-1506.669) (-1510.896) -- 0:01:30
      333000 -- [-1511.191] (-1508.050) (-1510.711) (-1512.917) * (-1510.475) (-1506.077) [-1510.373] (-1507.595) -- 0:01:30
      333500 -- (-1508.826) (-1511.807) [-1507.620] (-1516.661) * (-1510.351) (-1508.482) [-1510.345] (-1513.895) -- 0:01:29
      334000 -- (-1510.469) (-1511.095) [-1510.857] (-1516.979) * [-1507.353] (-1508.247) (-1514.050) (-1509.265) -- 0:01:31
      334500 -- (-1507.760) [-1514.066] (-1508.870) (-1511.354) * [-1512.993] (-1516.269) (-1510.265) (-1506.512) -- 0:01:31
      335000 -- (-1507.938) [-1509.213] (-1508.716) (-1514.388) * [-1507.748] (-1511.797) (-1511.522) (-1508.201) -- 0:01:31

      Average standard deviation of split frequencies: 0.004209

      335500 -- (-1507.121) [-1503.315] (-1505.853) (-1511.734) * (-1515.193) [-1508.500] (-1509.247) (-1507.987) -- 0:01:31
      336000 -- (-1507.792) (-1504.698) [-1507.703] (-1510.061) * [-1517.063] (-1513.598) (-1506.529) (-1512.071) -- 0:01:30
      336500 -- (-1507.112) [-1506.349] (-1507.026) (-1509.959) * (-1516.758) (-1509.569) (-1507.843) [-1506.227] -- 0:01:30
      337000 -- (-1511.819) [-1510.373] (-1507.876) (-1512.996) * [-1505.392] (-1513.025) (-1514.719) (-1513.922) -- 0:01:30
      337500 -- (-1509.437) (-1512.331) (-1511.293) [-1509.154] * (-1511.586) (-1510.132) [-1504.581] (-1507.923) -- 0:01:30
      338000 -- (-1510.718) [-1509.134] (-1511.360) (-1513.419) * [-1511.077] (-1516.412) (-1505.514) (-1509.567) -- 0:01:30
      338500 -- (-1509.096) (-1508.533) [-1511.257] (-1508.284) * (-1509.556) [-1506.302] (-1506.838) (-1512.650) -- 0:01:29
      339000 -- (-1509.822) (-1510.906) [-1513.616] (-1511.588) * (-1509.707) (-1506.479) [-1507.281] (-1514.621) -- 0:01:29
      339500 -- [-1509.353] (-1506.553) (-1509.570) (-1512.758) * [-1506.821] (-1505.141) (-1510.969) (-1513.513) -- 0:01:29
      340000 -- (-1508.227) (-1509.946) (-1516.511) [-1508.310] * (-1507.914) [-1508.908] (-1519.646) (-1511.620) -- 0:01:29

      Average standard deviation of split frequencies: 0.004151

      340500 -- [-1511.711] (-1509.220) (-1516.797) (-1508.255) * (-1510.350) (-1511.151) (-1513.927) [-1510.692] -- 0:01:29
      341000 -- (-1511.651) [-1507.130] (-1513.199) (-1516.009) * (-1513.191) (-1505.925) [-1508.224] (-1507.812) -- 0:01:30
      341500 -- (-1509.397) [-1507.284] (-1514.116) (-1512.617) * (-1515.304) (-1512.042) [-1509.809] (-1510.700) -- 0:01:30
      342000 -- [-1506.640] (-1510.076) (-1508.015) (-1511.751) * (-1515.954) (-1504.705) [-1511.307] (-1510.167) -- 0:01:30
      342500 -- (-1510.175) [-1507.780] (-1518.052) (-1511.847) * (-1512.572) (-1510.240) [-1508.080] (-1513.984) -- 0:01:30
      343000 -- (-1512.821) (-1512.693) (-1513.684) [-1515.386] * (-1516.788) (-1516.260) (-1508.482) [-1507.813] -- 0:01:30
      343500 -- (-1513.320) (-1509.390) (-1511.110) [-1505.592] * (-1510.551) (-1512.691) [-1508.637] (-1509.563) -- 0:01:29
      344000 -- (-1505.342) [-1508.084] (-1508.471) (-1508.461) * (-1515.318) [-1512.212] (-1510.263) (-1512.268) -- 0:01:29
      344500 -- (-1509.480) (-1511.798) (-1507.293) [-1506.453] * (-1511.859) [-1507.301] (-1508.779) (-1509.149) -- 0:01:29
      345000 -- [-1506.215] (-1507.354) (-1514.812) (-1503.236) * (-1507.085) [-1518.532] (-1510.235) (-1514.855) -- 0:01:29

      Average standard deviation of split frequencies: 0.004769

      345500 -- (-1504.376) (-1509.044) (-1510.611) [-1513.386] * (-1512.843) (-1507.422) (-1508.022) [-1508.003] -- 0:01:29
      346000 -- [-1504.115] (-1506.434) (-1507.708) (-1508.824) * (-1507.598) [-1507.819] (-1515.965) (-1511.946) -- 0:01:28
      346500 -- [-1505.449] (-1506.032) (-1512.054) (-1509.742) * (-1506.045) (-1516.194) (-1506.419) [-1510.101] -- 0:01:28
      347000 -- (-1511.173) [-1502.871] (-1508.933) (-1511.375) * [-1511.981] (-1510.226) (-1511.305) (-1510.112) -- 0:01:28
      347500 -- [-1508.193] (-1512.655) (-1509.766) (-1506.547) * (-1513.659) (-1513.963) [-1506.038] (-1507.910) -- 0:01:28
      348000 -- [-1503.769] (-1515.211) (-1515.798) (-1514.885) * (-1512.541) (-1515.046) [-1510.875] (-1511.865) -- 0:01:28
      348500 -- (-1504.824) (-1507.566) [-1508.836] (-1510.016) * [-1510.480] (-1510.821) (-1510.836) (-1508.404) -- 0:01:29
      349000 -- [-1506.086] (-1505.544) (-1509.294) (-1510.906) * (-1509.201) (-1512.575) [-1507.053] (-1508.062) -- 0:01:29
      349500 -- (-1506.943) [-1510.170] (-1504.118) (-1513.540) * (-1512.504) (-1514.451) (-1504.433) [-1507.359] -- 0:01:29
      350000 -- [-1506.167] (-1512.184) (-1507.133) (-1508.748) * (-1515.505) (-1513.304) (-1508.228) [-1507.376] -- 0:01:29

      Average standard deviation of split frequencies: 0.008066

      350500 -- (-1503.996) [-1503.765] (-1513.510) (-1515.892) * (-1510.930) (-1507.423) (-1509.041) [-1508.718] -- 0:01:28
      351000 -- (-1507.920) (-1507.973) (-1510.468) [-1513.273] * (-1507.412) [-1509.801] (-1504.059) (-1507.806) -- 0:01:28
      351500 -- (-1503.941) (-1513.046) [-1506.926] (-1515.294) * (-1511.453) (-1515.088) (-1508.423) [-1510.519] -- 0:01:28
      352000 -- (-1505.089) (-1507.076) (-1505.137) [-1510.380] * [-1512.003] (-1511.784) (-1510.249) (-1509.039) -- 0:01:28
      352500 -- (-1512.360) (-1510.145) (-1511.872) [-1510.498] * [-1510.492] (-1509.208) (-1507.676) (-1510.796) -- 0:01:28
      353000 -- [-1510.500] (-1508.289) (-1508.800) (-1509.314) * (-1507.297) [-1509.338] (-1506.977) (-1513.267) -- 0:01:27
      353500 -- (-1503.951) (-1510.270) [-1508.652] (-1507.940) * [-1506.520] (-1509.153) (-1508.832) (-1508.804) -- 0:01:27
      354000 -- (-1511.481) (-1508.794) (-1506.014) [-1508.200] * [-1510.478] (-1506.575) (-1518.884) (-1516.626) -- 0:01:27
      354500 -- (-1506.161) (-1507.174) [-1509.649] (-1509.227) * [-1514.686] (-1511.729) (-1511.069) (-1505.068) -- 0:01:27
      355000 -- [-1507.031] (-1513.844) (-1509.876) (-1509.995) * (-1508.553) (-1506.625) [-1509.714] (-1504.090) -- 0:01:27

      Average standard deviation of split frequencies: 0.007945

      355500 -- [-1507.970] (-1510.357) (-1515.321) (-1511.317) * (-1507.247) (-1508.885) [-1506.824] (-1509.884) -- 0:01:27
      356000 -- (-1510.020) [-1507.404] (-1513.456) (-1513.800) * (-1507.155) (-1510.656) (-1505.890) [-1508.148] -- 0:01:28
      356500 -- (-1513.420) (-1508.833) (-1513.990) [-1508.257] * (-1512.724) [-1508.407] (-1505.527) (-1508.791) -- 0:01:28
      357000 -- [-1512.063] (-1509.170) (-1516.454) (-1509.064) * (-1518.463) [-1513.931] (-1509.020) (-1514.241) -- 0:01:28
      357500 -- [-1512.737] (-1511.218) (-1511.040) (-1504.395) * [-1509.739] (-1506.978) (-1507.684) (-1512.738) -- 0:01:28
      358000 -- [-1507.364] (-1510.606) (-1513.292) (-1509.450) * (-1509.958) [-1510.967] (-1504.227) (-1510.268) -- 0:01:27
      358500 -- (-1509.665) [-1508.839] (-1513.274) (-1510.929) * [-1509.155] (-1510.205) (-1508.531) (-1514.393) -- 0:01:27
      359000 -- (-1508.130) (-1511.447) [-1510.715] (-1510.767) * (-1510.614) (-1509.971) [-1506.558] (-1517.463) -- 0:01:27
      359500 -- (-1505.506) (-1506.127) [-1508.429] (-1509.029) * [-1511.973] (-1510.173) (-1506.407) (-1506.938) -- 0:01:27
      360000 -- [-1510.594] (-1507.277) (-1509.319) (-1508.909) * (-1506.744) [-1506.627] (-1506.228) (-1506.711) -- 0:01:27

      Average standard deviation of split frequencies: 0.005882

      360500 -- (-1514.826) (-1506.593) [-1509.307] (-1503.345) * (-1509.293) (-1509.591) (-1508.300) [-1512.610] -- 0:01:26
      361000 -- (-1514.692) [-1509.260] (-1508.267) (-1508.504) * (-1513.482) (-1509.140) [-1512.924] (-1512.679) -- 0:01:26
      361500 -- [-1503.934] (-1511.189) (-1515.355) (-1512.895) * (-1510.204) (-1511.016) [-1506.112] (-1508.100) -- 0:01:26
      362000 -- (-1504.838) [-1506.740] (-1516.753) (-1513.484) * (-1514.401) (-1516.920) (-1508.594) [-1513.996] -- 0:01:26
      362500 -- (-1506.103) [-1510.185] (-1513.272) (-1510.224) * (-1508.563) [-1510.735] (-1514.102) (-1510.936) -- 0:01:26
      363000 -- (-1506.968) (-1507.625) (-1508.855) [-1505.733] * (-1506.758) (-1507.400) (-1508.884) [-1514.408] -- 0:01:27
      363500 -- (-1510.510) [-1509.350] (-1513.335) (-1509.261) * (-1512.723) [-1506.646] (-1508.823) (-1508.082) -- 0:01:27
      364000 -- [-1512.726] (-1507.450) (-1507.332) (-1510.810) * (-1510.350) [-1506.271] (-1511.341) (-1506.104) -- 0:01:27
      364500 -- (-1515.277) (-1509.854) [-1508.284] (-1510.012) * (-1510.553) [-1504.996] (-1509.538) (-1515.796) -- 0:01:27
      365000 -- (-1513.809) (-1508.133) (-1512.427) [-1507.644] * [-1504.272] (-1512.489) (-1510.231) (-1512.183) -- 0:01:26

      Average standard deviation of split frequencies: 0.002576

      365500 -- (-1509.836) (-1509.490) (-1508.938) [-1510.322] * (-1508.338) [-1507.549] (-1508.130) (-1506.028) -- 0:01:26
      366000 -- [-1512.192] (-1511.178) (-1510.138) (-1509.363) * (-1511.692) (-1510.294) [-1513.853] (-1508.716) -- 0:01:26
      366500 -- (-1510.646) (-1516.584) [-1508.297] (-1507.799) * (-1508.731) [-1509.871] (-1515.748) (-1508.169) -- 0:01:26
      367000 -- (-1515.070) (-1511.766) [-1508.837] (-1509.292) * (-1508.271) (-1512.985) (-1513.005) [-1510.166] -- 0:01:26
      367500 -- (-1511.415) (-1505.725) (-1511.179) [-1507.947] * (-1507.032) (-1513.583) [-1504.444] (-1504.798) -- 0:01:26
      368000 -- [-1512.043] (-1508.322) (-1511.905) (-1508.167) * (-1504.677) (-1512.121) [-1509.854] (-1505.894) -- 0:01:25
      368500 -- (-1510.367) (-1509.942) [-1515.921] (-1509.900) * (-1511.188) (-1512.950) (-1506.396) [-1510.031] -- 0:01:25
      369000 -- (-1513.902) [-1510.134] (-1516.938) (-1508.115) * [-1515.164] (-1512.720) (-1512.955) (-1506.672) -- 0:01:25
      369500 -- [-1506.820] (-1507.576) (-1509.418) (-1509.839) * (-1507.162) (-1512.645) (-1508.590) [-1507.502] -- 0:01:25
      370000 -- (-1513.692) (-1508.589) [-1508.288] (-1507.919) * [-1507.961] (-1507.864) (-1512.826) (-1505.877) -- 0:01:25

      Average standard deviation of split frequencies: 0.002544

      370500 -- (-1508.497) (-1510.292) [-1510.007] (-1509.015) * (-1506.689) (-1509.552) (-1518.968) [-1507.768] -- 0:01:26
      371000 -- [-1505.675] (-1509.977) (-1511.455) (-1511.021) * (-1511.984) [-1506.795] (-1514.851) (-1507.414) -- 0:01:26
      371500 -- (-1509.767) (-1515.497) (-1507.415) [-1507.190] * (-1509.933) (-1507.933) (-1519.915) [-1509.760] -- 0:01:26
      372000 -- (-1505.568) (-1504.756) [-1509.173] (-1509.926) * (-1509.986) (-1504.400) (-1517.037) [-1505.145] -- 0:01:26
      372500 -- (-1506.839) (-1511.506) [-1506.024] (-1507.951) * (-1507.352) (-1506.320) (-1514.056) [-1508.711] -- 0:01:25
      373000 -- (-1512.005) [-1510.884] (-1506.351) (-1505.324) * (-1513.407) (-1503.965) (-1514.080) [-1506.916] -- 0:01:25
      373500 -- [-1505.543] (-1508.705) (-1506.093) (-1508.090) * (-1515.722) (-1508.329) (-1516.998) [-1506.300] -- 0:01:25
      374000 -- (-1510.842) [-1506.269] (-1511.065) (-1508.886) * (-1510.366) [-1504.945] (-1521.877) (-1508.084) -- 0:01:25
      374500 -- [-1508.501] (-1508.735) (-1515.970) (-1515.097) * (-1509.127) [-1506.684] (-1509.659) (-1507.484) -- 0:01:25
      375000 -- [-1506.992] (-1513.030) (-1514.461) (-1514.788) * (-1511.049) (-1508.657) (-1510.355) [-1508.469] -- 0:01:25

      Average standard deviation of split frequencies: 0.002507

      375500 -- (-1504.667) (-1508.232) (-1514.308) [-1513.213] * (-1512.666) (-1509.662) [-1510.315] (-1509.394) -- 0:01:24
      376000 -- [-1504.532] (-1512.659) (-1511.645) (-1511.088) * (-1513.079) [-1508.139] (-1509.205) (-1519.913) -- 0:01:24
      376500 -- [-1510.782] (-1509.109) (-1508.779) (-1512.201) * (-1510.592) (-1503.028) (-1504.448) [-1512.134] -- 0:01:24
      377000 -- (-1517.177) [-1508.418] (-1506.145) (-1511.700) * (-1511.556) [-1511.911] (-1505.692) (-1509.677) -- 0:01:24
      377500 -- (-1512.038) (-1513.011) [-1502.057] (-1518.562) * [-1509.221] (-1516.304) (-1508.579) (-1507.199) -- 0:01:24
      378000 -- [-1506.654] (-1507.742) (-1505.981) (-1512.367) * (-1509.770) [-1508.757] (-1507.587) (-1510.867) -- 0:01:25
      378500 -- (-1510.233) (-1511.354) (-1505.951) [-1504.124] * (-1523.055) (-1511.234) [-1508.419] (-1509.767) -- 0:01:25
      379000 -- (-1507.482) (-1516.384) (-1504.860) [-1505.417] * [-1511.166] (-1511.432) (-1509.482) (-1511.529) -- 0:01:25
      379500 -- [-1504.662] (-1512.365) (-1504.957) (-1512.958) * (-1509.003) (-1505.344) (-1509.638) [-1507.756] -- 0:01:25
      380000 -- (-1507.702) (-1509.676) (-1506.727) [-1513.284] * (-1507.672) (-1506.806) (-1509.900) [-1507.970] -- 0:01:24

      Average standard deviation of split frequencies: 0.003096

      380500 -- (-1510.889) (-1509.945) (-1509.872) [-1508.096] * (-1507.129) [-1509.479] (-1511.958) (-1509.911) -- 0:01:24
      381000 -- (-1517.047) (-1520.861) [-1504.998] (-1507.939) * [-1510.817] (-1506.090) (-1520.481) (-1508.775) -- 0:01:24
      381500 -- (-1506.354) (-1516.751) [-1503.553] (-1513.596) * [-1504.703] (-1512.707) (-1515.967) (-1515.732) -- 0:01:24
      382000 -- (-1509.146) (-1515.578) [-1507.715] (-1513.736) * [-1511.194] (-1508.376) (-1512.147) (-1510.393) -- 0:01:24
      382500 -- (-1513.491) (-1515.412) [-1508.159] (-1514.954) * [-1508.291] (-1508.738) (-1515.656) (-1507.490) -- 0:01:23
      383000 -- (-1510.201) (-1513.879) [-1508.353] (-1510.135) * [-1508.665] (-1508.249) (-1521.190) (-1511.591) -- 0:01:23
      383500 -- [-1509.374] (-1511.064) (-1508.198) (-1508.971) * (-1511.179) (-1508.641) [-1510.019] (-1515.838) -- 0:01:23
      384000 -- (-1508.804) (-1511.779) (-1511.698) [-1509.247] * (-1512.774) [-1515.071] (-1515.749) (-1510.834) -- 0:01:23
      384500 -- [-1508.007] (-1512.972) (-1509.855) (-1507.790) * (-1510.257) [-1511.214] (-1510.584) (-1515.499) -- 0:01:23
      385000 -- (-1505.547) [-1509.519] (-1507.768) (-1507.007) * [-1506.325] (-1515.108) (-1512.296) (-1516.675) -- 0:01:24

      Average standard deviation of split frequencies: 0.003053

      385500 -- (-1507.085) (-1508.844) (-1508.610) [-1518.448] * [-1507.115] (-1513.824) (-1514.340) (-1511.620) -- 0:01:24
      386000 -- [-1507.321] (-1509.979) (-1503.808) (-1512.277) * (-1506.704) (-1513.512) [-1506.929] (-1516.795) -- 0:01:24
      386500 -- (-1507.159) (-1508.770) [-1512.233] (-1509.204) * [-1506.308] (-1509.064) (-1515.754) (-1511.899) -- 0:01:24
      387000 -- (-1510.074) (-1511.543) [-1506.432] (-1513.758) * (-1505.041) (-1509.747) [-1513.060] (-1509.878) -- 0:01:23
      387500 -- (-1512.164) (-1510.002) [-1508.627] (-1511.269) * (-1510.632) (-1509.659) (-1509.828) [-1508.005] -- 0:01:23
      388000 -- [-1509.384] (-1506.389) (-1509.062) (-1509.827) * (-1513.026) [-1514.850] (-1509.349) (-1506.339) -- 0:01:23
      388500 -- [-1504.296] (-1506.147) (-1513.782) (-1508.306) * [-1508.723] (-1509.236) (-1509.717) (-1512.608) -- 0:01:23
      389000 -- (-1508.829) (-1511.219) [-1505.655] (-1508.314) * (-1505.320) [-1509.034] (-1509.758) (-1510.637) -- 0:01:23
      389500 -- (-1508.329) (-1508.549) [-1507.738] (-1511.042) * (-1512.451) [-1508.469] (-1507.030) (-1503.428) -- 0:01:23
      390000 -- [-1510.180] (-1509.437) (-1507.290) (-1507.159) * (-1514.761) (-1510.682) (-1507.441) [-1514.236] -- 0:01:22

      Average standard deviation of split frequencies: 0.003017

      390500 -- [-1510.309] (-1505.627) (-1507.357) (-1505.067) * (-1509.942) [-1511.699] (-1512.038) (-1512.506) -- 0:01:22
      391000 -- (-1510.984) (-1508.222) [-1507.340] (-1510.261) * (-1510.817) [-1503.813] (-1509.073) (-1510.305) -- 0:01:22
      391500 -- (-1511.940) (-1507.679) [-1502.116] (-1508.752) * (-1510.538) (-1512.289) [-1510.316] (-1513.020) -- 0:01:22
      392000 -- (-1516.677) (-1514.106) (-1505.402) [-1507.511] * (-1509.359) (-1511.163) (-1510.361) [-1514.161] -- 0:01:22
      392500 -- (-1516.350) (-1507.098) [-1505.321] (-1511.283) * (-1512.496) (-1510.257) [-1508.195] (-1515.649) -- 0:01:23
      393000 -- [-1509.438] (-1515.057) (-1509.998) (-1504.993) * (-1512.942) (-1509.845) [-1512.205] (-1509.456) -- 0:01:23
      393500 -- [-1509.562] (-1513.675) (-1514.409) (-1506.460) * (-1506.029) (-1508.729) [-1508.335] (-1509.515) -- 0:01:23
      394000 -- (-1507.766) (-1513.892) (-1513.019) [-1504.026] * [-1505.145] (-1505.584) (-1505.164) (-1519.717) -- 0:01:23
      394500 -- (-1509.709) (-1513.193) [-1511.603] (-1509.836) * [-1504.037] (-1507.461) (-1508.913) (-1517.477) -- 0:01:22
      395000 -- (-1509.375) (-1509.831) [-1505.172] (-1509.383) * (-1508.172) [-1509.756] (-1508.988) (-1512.145) -- 0:01:22

      Average standard deviation of split frequencies: 0.002976

      395500 -- (-1509.362) (-1513.046) [-1506.607] (-1513.372) * (-1507.350) [-1510.609] (-1515.029) (-1511.356) -- 0:01:22
      396000 -- (-1516.291) (-1515.740) (-1503.927) [-1513.923] * (-1510.449) (-1506.811) (-1516.359) [-1507.222] -- 0:01:22
      396500 -- [-1514.234] (-1507.346) (-1508.662) (-1512.906) * (-1510.320) [-1508.592] (-1518.674) (-1508.967) -- 0:01:22
      397000 -- (-1510.684) (-1505.832) (-1512.759) [-1512.674] * (-1507.111) [-1506.915] (-1515.919) (-1507.097) -- 0:01:22
      397500 -- (-1509.133) (-1511.803) (-1510.313) [-1509.145] * [-1508.510] (-1516.169) (-1506.610) (-1511.040) -- 0:01:21
      398000 -- (-1516.959) (-1510.586) [-1508.067] (-1512.880) * (-1508.157) (-1516.529) [-1507.599] (-1509.639) -- 0:01:21
      398500 -- [-1512.922] (-1510.725) (-1510.848) (-1509.117) * [-1508.301] (-1511.675) (-1511.521) (-1513.081) -- 0:01:21
      399000 -- (-1511.038) (-1509.110) (-1511.220) [-1507.929] * (-1508.455) (-1511.143) (-1510.465) [-1509.506] -- 0:01:21
      399500 -- [-1503.143] (-1513.200) (-1511.078) (-1513.923) * (-1511.988) (-1509.775) [-1509.955] (-1514.615) -- 0:01:21
      400000 -- (-1509.806) [-1505.635] (-1513.391) (-1508.251) * (-1508.414) (-1510.850) [-1512.112] (-1514.937) -- 0:01:22

      Average standard deviation of split frequencies: 0.004118

      400500 -- (-1507.993) [-1505.471] (-1511.221) (-1507.931) * (-1509.025) [-1507.943] (-1507.361) (-1511.542) -- 0:01:22
      401000 -- (-1518.579) (-1516.202) [-1511.020] (-1505.319) * (-1512.035) (-1509.186) [-1506.461] (-1512.843) -- 0:01:22
      401500 -- (-1512.506) [-1504.679] (-1509.426) (-1508.321) * (-1511.281) (-1507.762) (-1512.218) [-1512.857] -- 0:01:21
      402000 -- (-1512.933) [-1508.671] (-1513.548) (-1509.552) * (-1510.407) (-1515.308) [-1509.264] (-1507.453) -- 0:01:21
      402500 -- (-1513.564) [-1507.912] (-1507.631) (-1512.143) * (-1505.278) (-1506.644) [-1503.438] (-1516.051) -- 0:01:21
      403000 -- (-1513.203) [-1507.215] (-1511.463) (-1513.299) * (-1511.132) [-1510.418] (-1510.800) (-1510.767) -- 0:01:21
      403500 -- (-1513.851) (-1521.385) [-1506.936] (-1511.985) * (-1508.276) (-1506.906) [-1507.385] (-1511.296) -- 0:01:21
      404000 -- [-1508.661] (-1512.576) (-1516.104) (-1509.985) * [-1507.762] (-1509.617) (-1508.977) (-1516.213) -- 0:01:21
      404500 -- (-1510.394) [-1507.123] (-1508.910) (-1505.426) * (-1509.450) (-1509.466) (-1508.138) [-1518.688] -- 0:01:20
      405000 -- (-1513.612) (-1514.365) [-1505.474] (-1509.379) * (-1508.802) [-1508.088] (-1522.749) (-1511.190) -- 0:01:20

      Average standard deviation of split frequencies: 0.005225

      405500 -- (-1509.390) (-1515.695) [-1509.924] (-1512.406) * (-1508.426) (-1510.077) (-1512.902) [-1511.188] -- 0:01:20
      406000 -- [-1511.158] (-1510.444) (-1504.296) (-1515.710) * [-1508.348] (-1514.022) (-1510.224) (-1514.286) -- 0:01:20
      406500 -- (-1513.500) [-1507.661] (-1509.404) (-1514.440) * (-1507.643) (-1510.338) [-1508.585] (-1510.391) -- 0:01:20
      407000 -- [-1509.052] (-1509.449) (-1510.149) (-1510.996) * (-1509.471) (-1506.882) [-1509.964] (-1509.963) -- 0:01:21
      407500 -- (-1509.592) (-1512.537) [-1506.287] (-1510.661) * (-1508.231) (-1506.915) (-1506.667) [-1511.507] -- 0:01:21
      408000 -- (-1506.844) (-1516.392) [-1503.764] (-1515.951) * (-1505.533) (-1512.183) (-1509.740) [-1511.722] -- 0:01:21
      408500 -- (-1512.885) (-1506.730) (-1507.566) [-1506.358] * [-1509.217] (-1509.779) (-1510.821) (-1513.186) -- 0:01:21
      409000 -- (-1513.383) (-1507.418) [-1509.575] (-1507.644) * [-1502.982] (-1510.409) (-1510.164) (-1511.738) -- 0:01:20
      409500 -- (-1516.664) [-1509.826] (-1508.029) (-1511.403) * [-1506.559] (-1510.259) (-1511.281) (-1511.503) -- 0:01:20
      410000 -- [-1507.440] (-1506.556) (-1511.869) (-1516.733) * [-1508.205] (-1517.471) (-1512.546) (-1505.271) -- 0:01:20

      Average standard deviation of split frequencies: 0.005166

      410500 -- [-1506.895] (-1506.836) (-1511.048) (-1517.497) * (-1507.711) (-1513.116) (-1512.391) [-1506.828] -- 0:01:20
      411000 -- (-1510.138) [-1505.561] (-1521.547) (-1512.437) * (-1507.307) (-1513.797) (-1513.706) [-1507.645] -- 0:01:20
      411500 -- (-1514.209) (-1508.310) [-1512.170] (-1514.823) * (-1507.979) (-1517.525) [-1509.263] (-1508.505) -- 0:01:20
      412000 -- (-1514.904) [-1508.393] (-1513.033) (-1509.773) * (-1503.663) (-1512.280) (-1509.312) [-1507.161] -- 0:01:19
      412500 -- (-1509.434) [-1507.448] (-1518.821) (-1507.716) * (-1508.471) (-1508.815) (-1511.819) [-1509.028] -- 0:01:19
      413000 -- (-1518.476) (-1518.072) (-1515.272) [-1508.547] * (-1511.537) (-1509.629) (-1509.811) [-1510.814] -- 0:01:19
      413500 -- [-1505.749] (-1511.454) (-1508.441) (-1508.116) * [-1506.359] (-1507.613) (-1509.341) (-1517.179) -- 0:01:19
      414000 -- [-1512.713] (-1509.843) (-1510.045) (-1511.448) * (-1510.638) (-1511.769) (-1513.032) [-1507.931] -- 0:01:19
      414500 -- (-1506.492) (-1509.936) (-1512.396) [-1508.210] * (-1508.483) (-1507.272) [-1510.922] (-1508.802) -- 0:01:20
      415000 -- (-1510.788) [-1510.129] (-1511.944) (-1514.124) * [-1511.218] (-1507.816) (-1507.632) (-1512.784) -- 0:01:20

      Average standard deviation of split frequencies: 0.004533

      415500 -- (-1509.139) (-1508.019) [-1505.278] (-1511.435) * (-1508.512) (-1509.349) [-1509.079] (-1513.476) -- 0:01:20
      416000 -- (-1510.350) (-1513.145) [-1506.529] (-1507.053) * (-1506.661) (-1513.709) [-1505.288] (-1509.650) -- 0:01:20
      416500 -- (-1512.199) [-1511.896] (-1507.092) (-1508.125) * [-1510.097] (-1517.247) (-1506.279) (-1509.415) -- 0:01:19
      417000 -- (-1508.126) (-1508.450) [-1509.157] (-1512.404) * (-1510.267) [-1508.905] (-1507.065) (-1508.338) -- 0:01:19
      417500 -- (-1507.552) [-1506.572] (-1511.241) (-1513.049) * (-1508.260) (-1510.528) (-1504.393) [-1509.262] -- 0:01:19
      418000 -- (-1513.217) (-1504.321) (-1512.737) [-1505.564] * [-1508.333] (-1508.166) (-1509.571) (-1512.176) -- 0:01:19
      418500 -- (-1514.656) (-1509.980) [-1508.318] (-1505.164) * (-1504.311) (-1505.848) [-1506.362] (-1507.239) -- 0:01:19
      419000 -- (-1516.204) (-1508.668) (-1517.827) [-1510.941] * [-1510.671] (-1504.951) (-1507.185) (-1511.938) -- 0:01:19
      419500 -- (-1512.491) (-1510.234) (-1514.234) [-1509.479] * (-1513.982) (-1513.197) (-1517.933) [-1510.196] -- 0:01:18
      420000 -- (-1508.637) (-1509.992) [-1506.646] (-1514.563) * [-1516.434] (-1512.254) (-1508.968) (-1511.537) -- 0:01:18

      Average standard deviation of split frequencies: 0.007284

      420500 -- (-1515.717) [-1511.645] (-1513.418) (-1506.312) * (-1507.333) [-1511.041] (-1509.639) (-1505.585) -- 0:01:18
      421000 -- (-1516.064) [-1516.062] (-1510.861) (-1510.422) * [-1506.277] (-1510.689) (-1507.243) (-1508.517) -- 0:01:18
      421500 -- (-1506.604) (-1508.014) (-1509.042) [-1510.970] * [-1508.087] (-1515.171) (-1514.682) (-1508.746) -- 0:01:18
      422000 -- (-1506.866) (-1508.845) (-1507.528) [-1507.293] * (-1510.547) [-1515.259] (-1513.005) (-1507.678) -- 0:01:19
      422500 -- (-1504.646) (-1509.093) (-1508.161) [-1509.394] * (-1509.163) (-1510.330) [-1511.386] (-1508.875) -- 0:01:19
      423000 -- (-1511.917) (-1509.199) (-1511.601) [-1512.238] * (-1509.965) [-1508.099] (-1508.883) (-1508.059) -- 0:01:19
      423500 -- [-1509.342] (-1508.362) (-1511.874) (-1508.080) * (-1507.610) (-1515.310) (-1514.615) [-1518.348] -- 0:01:18
      424000 -- (-1515.216) (-1516.751) (-1510.880) [-1514.363] * (-1512.646) [-1509.777] (-1511.556) (-1507.717) -- 0:01:18
      424500 -- (-1514.909) (-1515.469) (-1508.909) [-1508.842] * (-1508.339) (-1515.706) [-1508.746] (-1509.143) -- 0:01:18
      425000 -- (-1517.423) (-1512.951) (-1506.167) [-1507.705] * (-1509.140) (-1507.046) [-1509.996] (-1510.515) -- 0:01:18

      Average standard deviation of split frequencies: 0.009406

      425500 -- (-1508.614) (-1514.019) (-1506.447) [-1509.043] * (-1503.836) (-1509.803) (-1517.708) [-1509.857] -- 0:01:18
      426000 -- (-1512.633) (-1512.968) (-1513.718) [-1508.086] * [-1509.291] (-1508.663) (-1510.394) (-1509.716) -- 0:01:18
      426500 -- (-1512.667) (-1515.923) (-1506.152) [-1509.552] * (-1511.547) (-1511.593) (-1511.564) [-1507.155] -- 0:01:17
      427000 -- [-1507.388] (-1519.377) (-1508.468) (-1513.875) * (-1515.515) (-1510.115) [-1510.576] (-1512.226) -- 0:01:17
      427500 -- (-1506.525) (-1520.211) (-1506.027) [-1506.003] * (-1508.417) [-1507.252] (-1512.035) (-1508.213) -- 0:01:17
      428000 -- (-1513.264) (-1511.005) (-1508.249) [-1505.296] * (-1506.833) (-1505.707) (-1512.553) [-1505.486] -- 0:01:17
      428500 -- (-1512.938) (-1510.223) (-1511.876) [-1510.275] * [-1508.918] (-1507.677) (-1507.869) (-1508.634) -- 0:01:17
      429000 -- (-1507.924) [-1508.051] (-1509.937) (-1510.453) * [-1506.953] (-1507.780) (-1506.194) (-1512.882) -- 0:01:18
      429500 -- (-1516.340) [-1509.293] (-1508.222) (-1509.511) * (-1505.847) [-1507.740] (-1513.518) (-1509.703) -- 0:01:18
      430000 -- (-1516.554) (-1506.690) (-1513.968) [-1503.963] * [-1510.418] (-1513.649) (-1509.118) (-1511.411) -- 0:01:18

      Average standard deviation of split frequencies: 0.012588

      430500 -- (-1502.971) (-1506.707) (-1515.341) [-1507.163] * (-1512.089) (-1507.228) [-1506.970] (-1507.344) -- 0:01:18
      431000 -- (-1509.157) [-1507.842] (-1509.129) (-1511.305) * (-1508.505) [-1509.232] (-1515.282) (-1507.520) -- 0:01:17
      431500 -- [-1507.873] (-1508.535) (-1511.298) (-1508.716) * (-1507.530) [-1512.295] (-1511.466) (-1506.905) -- 0:01:17
      432000 -- (-1505.423) (-1509.478) (-1508.886) [-1508.784] * [-1508.977] (-1506.462) (-1511.519) (-1506.311) -- 0:01:17
      432500 -- [-1505.577] (-1512.073) (-1509.908) (-1506.621) * (-1515.798) (-1505.336) (-1512.507) [-1506.163] -- 0:01:17
      433000 -- [-1506.445] (-1508.277) (-1513.891) (-1506.603) * (-1512.138) [-1509.734] (-1507.694) (-1505.577) -- 0:01:17
      433500 -- (-1508.847) [-1508.285] (-1510.405) (-1509.352) * (-1509.003) (-1511.020) [-1509.979] (-1508.775) -- 0:01:17
      434000 -- (-1515.278) [-1512.253] (-1512.137) (-1506.332) * (-1512.767) (-1510.568) (-1505.438) [-1505.362] -- 0:01:16
      434500 -- (-1509.373) [-1508.060] (-1519.538) (-1509.343) * (-1508.507) (-1507.541) (-1507.724) [-1509.811] -- 0:01:16
      435000 -- (-1506.298) (-1510.235) (-1511.166) [-1510.455] * [-1512.356] (-1510.367) (-1509.901) (-1514.294) -- 0:01:16

      Average standard deviation of split frequencies: 0.014056

      435500 -- (-1508.374) (-1513.542) (-1510.325) [-1510.073] * (-1507.201) (-1509.875) (-1507.181) [-1508.649] -- 0:01:16
      436000 -- (-1511.679) (-1509.007) [-1508.914] (-1508.248) * (-1514.443) (-1509.710) (-1507.638) [-1510.350] -- 0:01:16
      436500 -- (-1505.881) [-1504.741] (-1511.687) (-1508.533) * [-1511.375] (-1505.191) (-1514.212) (-1507.879) -- 0:01:17
      437000 -- (-1511.127) (-1508.380) [-1511.082] (-1507.472) * (-1509.020) (-1510.524) [-1509.586] (-1506.483) -- 0:01:17
      437500 -- (-1507.428) (-1517.349) (-1509.548) [-1513.134] * (-1513.990) [-1509.627] (-1511.700) (-1509.418) -- 0:01:17
      438000 -- (-1513.968) (-1516.447) [-1510.360] (-1511.031) * (-1521.498) (-1508.162) [-1509.927] (-1509.918) -- 0:01:16
      438500 -- (-1509.649) (-1515.998) [-1507.815] (-1517.898) * (-1509.745) (-1510.178) [-1510.248] (-1506.144) -- 0:01:16
      439000 -- (-1507.467) [-1510.573] (-1510.024) (-1518.856) * (-1510.731) [-1507.286] (-1506.582) (-1508.726) -- 0:01:16
      439500 -- [-1506.907] (-1506.936) (-1505.526) (-1511.210) * [-1509.853] (-1507.841) (-1509.590) (-1507.928) -- 0:01:16
      440000 -- (-1506.978) [-1509.194] (-1506.635) (-1515.371) * (-1512.928) (-1512.304) (-1510.554) [-1509.546] -- 0:01:16

      Average standard deviation of split frequencies: 0.013372

      440500 -- (-1505.731) (-1513.201) [-1506.001] (-1509.018) * (-1514.779) [-1510.686] (-1508.505) (-1508.338) -- 0:01:16
      441000 -- (-1508.016) (-1506.590) (-1510.224) [-1508.021] * (-1507.160) [-1506.330] (-1515.581) (-1508.913) -- 0:01:16
      441500 -- (-1508.314) (-1515.417) [-1506.059] (-1511.211) * [-1504.941] (-1513.064) (-1513.753) (-1508.054) -- 0:01:15
      442000 -- (-1506.401) (-1511.304) [-1511.614] (-1507.062) * (-1507.103) [-1508.249] (-1514.723) (-1511.185) -- 0:01:15
      442500 -- (-1508.991) (-1506.779) [-1509.686] (-1509.529) * [-1508.306] (-1509.219) (-1517.670) (-1513.464) -- 0:01:15
      443000 -- (-1514.429) (-1512.731) (-1503.843) [-1507.942] * (-1507.345) [-1508.945] (-1509.173) (-1514.087) -- 0:01:15
      443500 -- (-1510.366) (-1510.419) (-1504.332) [-1509.185] * (-1512.162) (-1510.845) [-1509.014] (-1515.039) -- 0:01:15
      444000 -- (-1508.487) (-1510.830) [-1503.591] (-1508.019) * (-1509.982) [-1510.186] (-1508.582) (-1508.779) -- 0:01:16
      444500 -- (-1509.990) [-1509.637] (-1517.082) (-1518.721) * (-1511.420) [-1509.503] (-1505.846) (-1504.624) -- 0:01:16
      445000 -- (-1514.538) (-1507.736) (-1508.423) [-1508.197] * [-1511.284] (-1507.412) (-1508.077) (-1504.539) -- 0:01:16

      Average standard deviation of split frequencies: 0.021139

      445500 -- (-1515.637) [-1507.692] (-1507.507) (-1512.133) * (-1503.527) [-1508.952] (-1508.657) (-1505.341) -- 0:01:15
      446000 -- (-1506.231) [-1507.548] (-1506.073) (-1515.236) * (-1511.282) [-1508.920] (-1510.836) (-1504.986) -- 0:01:15
      446500 -- (-1512.912) (-1506.649) [-1509.597] (-1512.315) * (-1512.755) (-1515.792) [-1507.846] (-1511.730) -- 0:01:15
      447000 -- (-1503.091) (-1513.055) [-1508.365] (-1507.917) * (-1510.023) (-1512.128) [-1507.022] (-1511.088) -- 0:01:15
      447500 -- [-1511.237] (-1508.532) (-1509.870) (-1508.053) * [-1513.531] (-1515.799) (-1512.387) (-1511.436) -- 0:01:15
      448000 -- (-1506.245) [-1506.439] (-1512.430) (-1520.909) * (-1509.342) [-1507.713] (-1507.099) (-1510.082) -- 0:01:15
      448500 -- (-1511.346) [-1506.320] (-1509.097) (-1512.242) * (-1509.189) [-1507.097] (-1510.139) (-1510.826) -- 0:01:15
      449000 -- [-1510.687] (-1511.139) (-1509.442) (-1506.844) * (-1512.946) (-1509.857) [-1505.311] (-1506.998) -- 0:01:14
      449500 -- [-1510.952] (-1512.178) (-1508.752) (-1510.339) * [-1511.739] (-1507.260) (-1508.188) (-1514.412) -- 0:01:14
      450000 -- (-1507.872) (-1508.343) (-1508.686) [-1512.034] * (-1511.180) [-1507.719] (-1507.509) (-1514.725) -- 0:01:14

      Average standard deviation of split frequencies: 0.018828

      450500 -- (-1517.466) (-1510.664) (-1504.879) [-1507.858] * [-1504.532] (-1511.731) (-1510.809) (-1504.155) -- 0:01:14
      451000 -- (-1517.771) [-1515.306] (-1512.318) (-1506.805) * (-1511.423) [-1507.326] (-1511.679) (-1507.995) -- 0:01:14
      451500 -- [-1509.413] (-1511.735) (-1514.031) (-1510.563) * (-1505.557) (-1507.586) [-1506.603] (-1507.790) -- 0:01:15
      452000 -- (-1505.831) [-1508.789] (-1509.680) (-1509.286) * (-1506.534) (-1505.505) [-1511.634] (-1511.158) -- 0:01:15
      452500 -- [-1503.899] (-1512.078) (-1520.468) (-1509.876) * (-1506.731) (-1508.127) [-1506.389] (-1510.246) -- 0:01:15
      453000 -- (-1510.657) [-1507.181] (-1506.288) (-1512.654) * (-1514.938) (-1512.942) (-1508.715) [-1508.287] -- 0:01:14
      453500 -- [-1509.036] (-1507.441) (-1512.170) (-1515.445) * (-1513.861) [-1512.004] (-1512.806) (-1507.706) -- 0:01:14
      454000 -- (-1513.326) (-1506.586) (-1507.958) [-1510.071] * (-1514.588) (-1508.039) (-1509.681) [-1510.964] -- 0:01:14
      454500 -- (-1506.372) (-1505.994) [-1509.652] (-1512.718) * (-1510.673) (-1513.567) (-1510.869) [-1510.943] -- 0:01:14
      455000 -- (-1506.167) [-1509.273] (-1510.670) (-1509.612) * (-1506.543) (-1509.957) (-1513.713) [-1506.085] -- 0:01:14

      Average standard deviation of split frequencies: 0.014473

      455500 -- (-1506.235) (-1507.940) [-1507.062] (-1508.806) * (-1508.840) (-1507.955) (-1512.126) [-1512.513] -- 0:01:14
      456000 -- (-1509.576) (-1507.686) (-1508.550) [-1505.008] * (-1512.421) (-1508.404) [-1514.672] (-1509.203) -- 0:01:13
      456500 -- (-1509.599) (-1508.482) (-1516.541) [-1506.234] * [-1509.897] (-1507.232) (-1514.016) (-1506.841) -- 0:01:13
      457000 -- (-1506.860) (-1507.978) [-1512.383] (-1507.778) * (-1513.998) [-1504.516] (-1513.714) (-1508.704) -- 0:01:13
      457500 -- (-1506.848) [-1506.070] (-1508.792) (-1511.440) * [-1512.894] (-1509.983) (-1517.306) (-1511.185) -- 0:01:13
      458000 -- (-1506.326) (-1508.587) [-1513.432] (-1515.119) * (-1510.617) [-1507.950] (-1515.024) (-1511.756) -- 0:01:13
      458500 -- (-1505.454) (-1510.428) (-1519.637) [-1512.962] * (-1511.195) (-1505.868) [-1516.712] (-1510.215) -- 0:01:14
      459000 -- (-1507.742) [-1509.772] (-1517.356) (-1508.514) * (-1507.656) (-1508.889) [-1513.675] (-1512.121) -- 0:01:14
      459500 -- (-1507.914) (-1507.131) (-1514.014) [-1511.635] * [-1509.365] (-1513.672) (-1512.853) (-1512.402) -- 0:01:14
      460000 -- (-1509.379) (-1506.773) (-1509.778) [-1514.655] * (-1509.174) (-1513.792) [-1509.991] (-1507.912) -- 0:01:13

      Average standard deviation of split frequencies: 0.012791

      460500 -- (-1508.787) (-1508.554) (-1508.966) [-1507.929] * [-1507.891] (-1518.785) (-1512.514) (-1509.254) -- 0:01:13
      461000 -- (-1504.313) (-1513.946) [-1508.712] (-1505.308) * (-1510.150) (-1520.450) (-1509.537) [-1508.312] -- 0:01:13
      461500 -- (-1510.151) (-1508.968) (-1509.146) [-1502.554] * (-1508.654) (-1506.761) [-1507.667] (-1510.452) -- 0:01:13
      462000 -- (-1509.339) (-1508.253) (-1507.436) [-1507.542] * (-1511.439) (-1508.159) [-1506.280] (-1509.395) -- 0:01:13
      462500 -- (-1511.693) (-1510.279) (-1506.907) [-1504.207] * (-1514.772) (-1512.078) [-1504.986] (-1518.825) -- 0:01:13
      463000 -- [-1506.045] (-1515.107) (-1508.707) (-1509.212) * (-1506.333) (-1505.419) [-1509.010] (-1510.206) -- 0:01:13
      463500 -- (-1505.457) (-1505.848) (-1508.961) [-1505.251] * (-1510.567) [-1506.338] (-1507.898) (-1507.983) -- 0:01:12
      464000 -- (-1508.877) [-1505.718] (-1511.687) (-1507.402) * (-1510.133) (-1514.850) (-1508.418) [-1510.892] -- 0:01:12
      464500 -- (-1509.619) [-1509.882] (-1509.010) (-1518.081) * (-1509.000) (-1509.131) [-1510.170] (-1509.950) -- 0:01:12
      465000 -- (-1511.411) (-1510.369) [-1505.926] (-1509.644) * (-1507.504) [-1514.539] (-1506.709) (-1509.541) -- 0:01:12

      Average standard deviation of split frequencies: 0.016186

      465500 -- (-1514.172) (-1508.156) [-1506.110] (-1511.171) * (-1508.892) (-1508.268) [-1510.772] (-1511.037) -- 0:01:12
      466000 -- (-1510.838) [-1512.199] (-1509.181) (-1514.400) * (-1506.200) [-1507.413] (-1514.785) (-1510.122) -- 0:01:13
      466500 -- (-1509.897) [-1509.821] (-1508.378) (-1518.984) * [-1507.852] (-1509.128) (-1509.438) (-1512.562) -- 0:01:13
      467000 -- (-1513.500) (-1510.835) (-1510.013) [-1507.768] * (-1509.133) (-1506.243) [-1512.777] (-1510.376) -- 0:01:13
      467500 -- (-1513.162) (-1510.853) [-1511.197] (-1510.360) * (-1513.445) (-1506.460) (-1514.600) [-1515.660] -- 0:01:12
      468000 -- [-1516.033] (-1511.732) (-1507.524) (-1509.783) * (-1510.452) [-1508.723] (-1508.260) (-1516.482) -- 0:01:12
      468500 -- (-1507.370) (-1515.488) (-1508.526) [-1506.256] * (-1509.308) (-1509.702) (-1512.031) [-1506.660] -- 0:01:12
      469000 -- (-1511.898) (-1516.582) (-1509.280) [-1507.733] * (-1512.568) (-1512.628) (-1515.358) [-1513.145] -- 0:01:12
      469500 -- (-1511.353) [-1509.081] (-1511.859) (-1510.586) * (-1509.223) [-1505.285] (-1515.935) (-1508.466) -- 0:01:12
      470000 -- (-1511.387) [-1506.082] (-1509.451) (-1506.034) * (-1507.165) (-1506.028) (-1512.563) [-1507.772] -- 0:01:12

      Average standard deviation of split frequencies: 0.015024

      470500 -- (-1507.425) [-1506.492] (-1513.477) (-1513.705) * (-1512.728) (-1509.829) [-1510.168] (-1506.955) -- 0:01:12
      471000 -- (-1508.667) (-1511.730) [-1513.225] (-1514.845) * (-1512.325) (-1508.906) [-1507.657] (-1506.934) -- 0:01:11
      471500 -- (-1515.963) [-1507.688] (-1515.914) (-1510.660) * (-1511.692) [-1508.717] (-1509.911) (-1506.403) -- 0:01:11
      472000 -- [-1508.187] (-1510.084) (-1507.672) (-1510.555) * (-1513.538) [-1506.135] (-1514.803) (-1510.603) -- 0:01:11
      472500 -- (-1510.961) (-1508.638) [-1511.375] (-1513.040) * (-1509.316) [-1510.724] (-1515.689) (-1510.914) -- 0:01:11
      473000 -- (-1514.631) [-1505.887] (-1511.325) (-1509.716) * [-1506.034] (-1513.458) (-1516.305) (-1514.190) -- 0:01:11
      473500 -- (-1509.870) [-1510.732] (-1510.028) (-1511.889) * (-1506.159) (-1508.997) [-1510.287] (-1505.754) -- 0:01:12
      474000 -- (-1510.011) [-1505.678] (-1507.547) (-1513.497) * (-1505.762) [-1510.084] (-1514.576) (-1508.908) -- 0:01:12
      474500 -- (-1509.380) (-1507.670) [-1506.998] (-1514.845) * (-1507.741) (-1509.491) (-1509.487) [-1507.519] -- 0:01:11
      475000 -- (-1507.262) (-1506.523) [-1509.788] (-1508.664) * (-1512.032) (-1510.349) [-1506.224] (-1512.836) -- 0:01:11

      Average standard deviation of split frequencies: 0.012874

      475500 -- (-1508.218) (-1506.021) [-1506.661] (-1509.049) * (-1513.481) (-1511.653) [-1508.861] (-1510.744) -- 0:01:11
      476000 -- (-1508.357) [-1510.852] (-1510.223) (-1509.329) * [-1510.252] (-1513.529) (-1508.625) (-1512.739) -- 0:01:11
      476500 -- [-1508.253] (-1511.296) (-1514.509) (-1506.950) * (-1513.778) (-1516.565) (-1507.454) [-1510.239] -- 0:01:11
      477000 -- (-1512.339) [-1510.111] (-1509.948) (-1507.627) * (-1509.418) (-1516.166) [-1508.579] (-1513.079) -- 0:01:11
      477500 -- [-1508.502] (-1510.646) (-1514.845) (-1512.274) * (-1507.945) [-1511.917] (-1506.740) (-1512.832) -- 0:01:11
      478000 -- (-1507.108) (-1507.272) [-1509.206] (-1509.914) * (-1508.453) (-1505.530) [-1506.385] (-1509.839) -- 0:01:10
      478500 -- [-1509.246] (-1507.377) (-1510.306) (-1507.445) * [-1507.196] (-1519.889) (-1505.410) (-1508.407) -- 0:01:10
      479000 -- [-1506.235] (-1507.879) (-1515.283) (-1510.701) * (-1510.392) [-1510.007] (-1506.201) (-1512.622) -- 0:01:10
      479500 -- [-1510.391] (-1505.310) (-1516.329) (-1511.805) * (-1514.145) (-1517.425) (-1511.077) [-1512.674] -- 0:01:10
      480000 -- (-1514.486) (-1516.520) (-1506.789) [-1508.998] * (-1514.512) (-1511.600) (-1507.665) [-1516.021] -- 0:01:10

      Average standard deviation of split frequencies: 0.015692

      480500 -- [-1508.900] (-1512.964) (-1510.037) (-1509.862) * (-1518.515) (-1510.658) [-1512.624] (-1506.809) -- 0:01:10
      481000 -- [-1505.004] (-1518.563) (-1508.104) (-1508.911) * (-1514.149) (-1509.718) [-1510.002] (-1509.263) -- 0:01:11
      481500 -- (-1512.072) (-1506.465) (-1511.945) [-1510.232] * (-1515.979) (-1508.025) [-1509.986] (-1511.023) -- 0:01:11
      482000 -- (-1506.896) (-1509.149) [-1509.093] (-1516.679) * (-1523.414) [-1508.519] (-1507.264) (-1511.888) -- 0:01:10
      482500 -- (-1507.753) [-1503.800] (-1505.149) (-1511.251) * (-1510.042) (-1510.614) (-1503.988) [-1516.497] -- 0:01:10
      483000 -- (-1509.596) (-1507.058) (-1514.921) [-1511.539] * (-1512.137) [-1506.776] (-1513.327) (-1512.220) -- 0:01:10
      483500 -- (-1509.189) (-1509.128) (-1514.158) [-1512.631] * (-1512.362) (-1508.440) (-1510.408) [-1515.518] -- 0:01:10
      484000 -- (-1510.811) [-1509.412] (-1511.826) (-1514.915) * (-1507.728) [-1508.784] (-1506.856) (-1509.643) -- 0:01:10
      484500 -- (-1517.177) (-1508.469) [-1508.081] (-1505.985) * (-1507.093) (-1509.652) [-1515.431] (-1511.573) -- 0:01:10
      485000 -- (-1519.564) [-1503.633] (-1514.029) (-1506.723) * (-1506.804) (-1509.464) (-1517.175) [-1514.982] -- 0:01:10

      Average standard deviation of split frequencies: 0.014550

      485500 -- (-1515.748) [-1508.588] (-1513.269) (-1508.206) * (-1507.521) (-1509.613) (-1513.612) [-1513.055] -- 0:01:09
      486000 -- [-1509.738] (-1506.163) (-1508.763) (-1512.373) * (-1508.037) [-1507.964] (-1508.418) (-1504.350) -- 0:01:09
      486500 -- [-1512.456] (-1508.420) (-1513.385) (-1508.342) * (-1507.771) (-1505.541) (-1511.653) [-1508.092] -- 0:01:09
      487000 -- (-1516.430) (-1515.753) (-1510.787) [-1506.843] * (-1506.748) [-1507.788] (-1511.507) (-1514.980) -- 0:01:09
      487500 -- (-1517.818) (-1511.467) [-1510.953] (-1505.044) * [-1508.925] (-1511.070) (-1510.023) (-1506.710) -- 0:01:09
      488000 -- (-1516.069) (-1515.477) [-1507.310] (-1507.765) * (-1508.738) [-1505.930] (-1510.670) (-1510.159) -- 0:01:10
      488500 -- (-1515.153) [-1514.335] (-1509.335) (-1506.802) * (-1511.195) [-1509.663] (-1509.084) (-1507.065) -- 0:01:10
      489000 -- (-1519.177) (-1503.797) (-1511.141) [-1506.425] * [-1511.234] (-1512.605) (-1510.988) (-1509.584) -- 0:01:10
      489500 -- (-1515.843) (-1506.488) [-1516.665] (-1514.391) * (-1513.298) (-1509.717) (-1523.855) [-1505.931] -- 0:01:09
      490000 -- (-1516.752) [-1510.790] (-1509.664) (-1510.555) * [-1504.661] (-1508.210) (-1512.389) (-1512.280) -- 0:01:09

      Average standard deviation of split frequencies: 0.011529

      490500 -- (-1512.009) (-1509.086) [-1510.926] (-1507.933) * (-1515.701) (-1509.342) (-1521.961) [-1512.813] -- 0:01:09
      491000 -- [-1508.982] (-1507.395) (-1507.937) (-1508.783) * (-1512.357) [-1505.034] (-1511.346) (-1507.048) -- 0:01:09
      491500 -- (-1510.432) (-1511.859) [-1514.792] (-1511.920) * (-1509.341) (-1511.404) [-1510.230] (-1508.052) -- 0:01:09
      492000 -- [-1503.585] (-1508.575) (-1512.934) (-1506.046) * (-1513.526) (-1508.015) (-1514.251) [-1505.213] -- 0:01:09
      492500 -- (-1509.021) (-1508.832) (-1512.044) [-1508.990] * (-1511.733) [-1505.616] (-1507.444) (-1506.720) -- 0:01:09
      493000 -- [-1509.236] (-1508.506) (-1510.186) (-1509.555) * (-1513.460) (-1511.513) [-1509.462] (-1507.041) -- 0:01:08
      493500 -- (-1508.962) (-1508.407) [-1506.771] (-1506.066) * (-1508.978) (-1510.153) (-1509.192) [-1508.448] -- 0:01:08
      494000 -- (-1510.551) [-1506.478] (-1511.046) (-1508.299) * (-1509.575) (-1511.850) (-1510.536) [-1508.948] -- 0:01:08
      494500 -- [-1507.610] (-1515.535) (-1512.219) (-1505.952) * [-1506.700] (-1509.433) (-1511.769) (-1516.834) -- 0:01:08
      495000 -- (-1509.006) [-1506.040] (-1507.543) (-1506.120) * [-1510.821] (-1510.013) (-1513.903) (-1513.598) -- 0:01:08

      Average standard deviation of split frequencies: 0.009504

      495500 -- (-1512.446) (-1507.684) (-1508.917) [-1510.764] * (-1514.115) [-1507.062] (-1507.206) (-1515.504) -- 0:01:09
      496000 -- (-1513.355) (-1510.023) [-1507.039] (-1506.318) * (-1509.810) [-1507.868] (-1509.862) (-1516.090) -- 0:01:09
      496500 -- (-1512.577) (-1510.049) [-1509.302] (-1507.097) * (-1507.479) (-1506.760) (-1506.367) [-1512.287] -- 0:01:08
      497000 -- (-1511.292) (-1516.171) (-1515.719) [-1505.231] * (-1510.410) (-1510.922) [-1507.069] (-1511.072) -- 0:01:08
      497500 -- (-1507.644) (-1516.825) (-1512.459) [-1503.164] * (-1505.953) (-1510.312) (-1511.675) [-1509.066] -- 0:01:08
      498000 -- (-1511.977) (-1509.594) [-1511.187] (-1511.069) * [-1506.020] (-1509.645) (-1508.586) (-1508.681) -- 0:01:08
      498500 -- (-1510.686) (-1513.053) (-1510.409) [-1506.958] * (-1508.304) (-1512.701) [-1508.243] (-1508.795) -- 0:01:08
      499000 -- [-1509.575] (-1514.002) (-1512.657) (-1508.281) * (-1510.574) (-1511.637) [-1504.982] (-1504.205) -- 0:01:08
      499500 -- (-1506.553) (-1505.451) [-1512.887] (-1509.353) * (-1504.654) (-1514.668) [-1510.427] (-1509.501) -- 0:01:08
      500000 -- (-1508.682) (-1508.579) [-1508.876] (-1507.780) * (-1507.660) [-1509.280] (-1510.530) (-1509.694) -- 0:01:08

      Average standard deviation of split frequencies: 0.008945

      500500 -- (-1513.634) (-1510.942) (-1513.504) [-1504.415] * (-1506.335) (-1505.760) (-1510.164) [-1511.018] -- 0:01:07
      501000 -- (-1509.378) (-1506.916) [-1503.804] (-1508.693) * (-1507.401) (-1503.800) [-1513.772] (-1509.694) -- 0:01:07
      501500 -- (-1505.820) (-1515.034) [-1506.942] (-1505.890) * (-1506.986) (-1514.585) (-1509.418) [-1508.044] -- 0:01:07
      502000 -- (-1510.150) [-1508.483] (-1506.222) (-1508.122) * (-1508.062) (-1515.491) [-1506.239] (-1514.721) -- 0:01:07
      502500 -- (-1513.466) (-1506.923) (-1509.371) [-1506.515] * (-1510.858) (-1512.681) (-1504.957) [-1506.372] -- 0:01:08
      503000 -- [-1506.318] (-1509.047) (-1507.498) (-1509.644) * (-1506.232) (-1511.789) [-1508.734] (-1510.442) -- 0:01:08
      503500 -- [-1503.882] (-1511.544) (-1507.577) (-1508.201) * (-1506.556) (-1508.346) [-1502.976] (-1510.821) -- 0:01:08
      504000 -- [-1507.617] (-1505.654) (-1514.073) (-1514.937) * (-1514.539) [-1510.390] (-1508.399) (-1512.863) -- 0:01:07
      504500 -- [-1511.346] (-1507.537) (-1516.011) (-1510.633) * (-1505.370) (-1511.203) (-1504.917) [-1507.372] -- 0:01:07
      505000 -- (-1518.197) (-1508.936) (-1509.933) [-1509.016] * (-1507.493) (-1508.861) (-1506.018) [-1507.186] -- 0:01:07

      Average standard deviation of split frequencies: 0.008850

      505500 -- [-1513.992] (-1509.569) (-1510.204) (-1510.025) * (-1510.781) [-1506.302] (-1514.090) (-1508.637) -- 0:01:07
      506000 -- [-1510.514] (-1512.824) (-1507.614) (-1506.867) * [-1507.215] (-1509.721) (-1510.372) (-1508.593) -- 0:01:07
      506500 -- (-1509.923) (-1514.149) (-1507.786) [-1505.451] * (-1517.542) (-1507.802) [-1515.356] (-1510.026) -- 0:01:07
      507000 -- (-1522.730) [-1505.123] (-1518.880) (-1506.975) * (-1507.516) [-1510.421] (-1508.028) (-1509.541) -- 0:01:07
      507500 -- (-1511.593) [-1506.471] (-1511.101) (-1509.129) * (-1511.329) [-1506.837] (-1513.341) (-1504.477) -- 0:01:06
      508000 -- [-1506.253] (-1515.855) (-1508.311) (-1507.033) * [-1506.857] (-1509.697) (-1510.302) (-1508.467) -- 0:01:06
      508500 -- (-1511.470) (-1507.674) (-1505.707) [-1502.545] * (-1504.855) (-1504.665) (-1505.731) [-1507.421] -- 0:01:06
      509000 -- (-1510.149) [-1508.563] (-1504.918) (-1510.230) * (-1506.416) (-1514.562) (-1506.762) [-1504.659] -- 0:01:06
      509500 -- [-1509.062] (-1512.186) (-1505.434) (-1505.374) * (-1507.172) (-1515.458) [-1507.752] (-1509.293) -- 0:01:06
      510000 -- (-1508.349) (-1509.761) (-1505.324) [-1506.708] * (-1507.925) (-1516.624) (-1508.439) [-1509.924] -- 0:01:07

      Average standard deviation of split frequencies: 0.006923

      510500 -- (-1509.110) (-1506.854) [-1508.325] (-1506.341) * (-1512.647) [-1511.974] (-1508.153) (-1512.746) -- 0:01:07
      511000 -- (-1508.752) [-1507.040] (-1504.946) (-1513.336) * (-1510.367) [-1506.543] (-1512.689) (-1508.649) -- 0:01:06
      511500 -- (-1511.125) [-1506.665] (-1506.429) (-1506.459) * (-1508.573) [-1504.535] (-1509.331) (-1503.483) -- 0:01:06
      512000 -- (-1510.557) (-1510.874) (-1509.919) [-1508.101] * (-1508.156) (-1504.785) (-1511.743) [-1504.814] -- 0:01:06
      512500 -- (-1509.776) (-1508.189) [-1508.231] (-1508.687) * [-1507.291] (-1509.067) (-1507.849) (-1510.335) -- 0:01:06
      513000 -- (-1504.284) [-1508.000] (-1507.959) (-1516.329) * [-1507.223] (-1517.687) (-1510.965) (-1512.980) -- 0:01:06
      513500 -- (-1504.680) (-1511.428) (-1507.501) [-1511.047] * [-1506.229] (-1515.097) (-1513.723) (-1510.343) -- 0:01:06
      514000 -- [-1517.107] (-1506.201) (-1506.853) (-1510.572) * [-1508.314] (-1504.156) (-1511.374) (-1507.903) -- 0:01:06
      514500 -- (-1511.131) [-1510.354] (-1503.588) (-1506.291) * (-1510.247) [-1508.007] (-1515.027) (-1517.824) -- 0:01:06
      515000 -- (-1513.865) [-1507.649] (-1509.100) (-1507.813) * [-1509.812] (-1509.839) (-1510.449) (-1510.837) -- 0:01:05

      Average standard deviation of split frequencies: 0.006852

      515500 -- (-1511.717) [-1509.158] (-1506.546) (-1509.248) * [-1504.567] (-1512.060) (-1513.116) (-1508.269) -- 0:01:05
      516000 -- (-1515.267) (-1512.017) (-1509.990) [-1511.185] * (-1508.797) (-1510.726) (-1512.757) [-1516.288] -- 0:01:05
      516500 -- (-1513.027) (-1505.634) (-1510.005) [-1509.600] * [-1508.399] (-1508.480) (-1518.474) (-1510.101) -- 0:01:05
      517000 -- (-1508.521) [-1513.473] (-1508.798) (-1508.648) * (-1507.666) (-1507.279) (-1512.157) [-1510.408] -- 0:01:05
      517500 -- [-1506.320] (-1514.547) (-1511.714) (-1506.495) * (-1507.600) (-1517.622) [-1506.780] (-1512.724) -- 0:01:06
      518000 -- (-1509.748) [-1508.927] (-1507.180) (-1518.051) * (-1518.854) [-1511.869] (-1509.675) (-1509.350) -- 0:01:06
      518500 -- (-1506.445) [-1506.823] (-1509.301) (-1506.877) * [-1509.503] (-1507.705) (-1511.819) (-1512.005) -- 0:01:05
      519000 -- [-1508.738] (-1506.620) (-1505.936) (-1506.479) * (-1510.690) [-1505.368] (-1508.324) (-1509.228) -- 0:01:05
      519500 -- (-1506.123) (-1519.802) (-1516.130) [-1506.899] * [-1510.695] (-1508.395) (-1511.217) (-1508.609) -- 0:01:05
      520000 -- [-1508.094] (-1520.461) (-1514.519) (-1513.891) * (-1508.741) [-1507.730] (-1509.747) (-1515.682) -- 0:01:05

      Average standard deviation of split frequencies: 0.009054

      520500 -- (-1510.843) (-1513.745) [-1507.475] (-1506.257) * (-1508.289) (-1509.120) [-1509.525] (-1508.130) -- 0:01:05
      521000 -- (-1509.179) (-1511.036) (-1514.133) [-1508.290] * (-1510.312) (-1507.945) [-1505.075] (-1505.292) -- 0:01:05
      521500 -- (-1507.090) [-1509.299] (-1509.702) (-1511.086) * (-1513.545) (-1508.433) [-1505.217] (-1506.632) -- 0:01:05
      522000 -- (-1510.088) [-1506.888] (-1510.453) (-1513.151) * [-1506.849] (-1506.157) (-1516.978) (-1512.313) -- 0:01:05
      522500 -- (-1510.466) (-1508.329) [-1510.747] (-1513.425) * (-1508.864) [-1504.642] (-1519.167) (-1514.627) -- 0:01:04
      523000 -- (-1508.925) [-1508.724] (-1508.124) (-1515.153) * (-1513.516) [-1511.827] (-1508.441) (-1508.285) -- 0:01:04
      523500 -- [-1506.778] (-1512.655) (-1513.195) (-1511.497) * (-1508.553) (-1507.858) (-1513.401) [-1508.856] -- 0:01:04
      524000 -- (-1507.089) (-1511.271) [-1511.864] (-1510.536) * (-1510.129) (-1512.444) [-1515.885] (-1515.115) -- 0:01:04
      524500 -- [-1504.031] (-1506.124) (-1510.296) (-1517.090) * (-1507.651) (-1515.888) (-1509.543) [-1511.202] -- 0:01:04
      525000 -- [-1505.527] (-1515.392) (-1509.958) (-1512.987) * [-1509.555] (-1518.204) (-1506.094) (-1506.716) -- 0:01:05

      Average standard deviation of split frequencies: 0.007618

      525500 -- [-1508.613] (-1511.253) (-1509.810) (-1511.664) * (-1511.288) (-1509.103) (-1508.412) [-1505.822] -- 0:01:05
      526000 -- (-1510.251) [-1509.012] (-1507.342) (-1514.372) * (-1512.069) [-1510.175] (-1511.899) (-1510.043) -- 0:01:04
      526500 -- (-1511.575) (-1506.481) [-1509.831] (-1511.979) * (-1509.002) (-1507.126) (-1510.011) [-1512.264] -- 0:01:04
      527000 -- (-1510.616) (-1507.102) (-1507.604) [-1510.290] * (-1509.708) (-1506.221) [-1505.748] (-1512.576) -- 0:01:04
      527500 -- [-1509.938] (-1505.104) (-1511.512) (-1504.974) * [-1511.346] (-1506.346) (-1510.165) (-1507.490) -- 0:01:04
      528000 -- (-1505.235) [-1506.630] (-1507.400) (-1506.385) * (-1507.934) (-1513.823) [-1506.695] (-1507.422) -- 0:01:04
      528500 -- (-1511.112) [-1506.563] (-1505.833) (-1513.848) * [-1511.294] (-1507.935) (-1506.266) (-1506.463) -- 0:01:04
      529000 -- (-1509.345) (-1510.173) [-1509.346] (-1513.228) * [-1507.321] (-1508.427) (-1508.019) (-1508.224) -- 0:01:04
      529500 -- (-1509.378) (-1510.372) (-1512.788) [-1509.108] * (-1512.866) (-1507.326) [-1506.625] (-1512.075) -- 0:01:03
      530000 -- (-1511.748) (-1507.192) [-1507.926] (-1506.671) * (-1508.684) (-1508.879) [-1504.558] (-1513.669) -- 0:01:03

      Average standard deviation of split frequencies: 0.005774

      530500 -- (-1506.289) (-1507.831) (-1512.462) [-1507.456] * (-1511.041) (-1508.443) [-1504.640] (-1507.439) -- 0:01:03
      531000 -- (-1510.453) (-1513.318) (-1508.903) [-1510.565] * (-1509.637) (-1507.168) (-1507.992) [-1505.922] -- 0:01:03
      531500 -- (-1506.039) (-1507.880) [-1507.162] (-1516.633) * (-1509.812) [-1509.328] (-1507.569) (-1511.462) -- 0:01:03
      532000 -- (-1510.661) [-1507.105] (-1506.113) (-1515.981) * (-1508.595) (-1508.141) (-1507.284) [-1505.468] -- 0:01:04
      532500 -- (-1507.909) (-1512.662) [-1506.944] (-1510.993) * [-1503.622] (-1507.761) (-1511.834) (-1509.783) -- 0:01:04
      533000 -- (-1510.233) [-1506.919] (-1508.464) (-1520.091) * [-1513.932] (-1511.893) (-1507.332) (-1509.707) -- 0:01:03
      533500 -- (-1507.512) [-1507.027] (-1505.788) (-1506.777) * [-1505.371] (-1509.500) (-1506.828) (-1510.434) -- 0:01:03
      534000 -- (-1507.472) [-1506.657] (-1510.155) (-1509.461) * (-1508.079) (-1510.949) [-1509.540] (-1512.176) -- 0:01:03
      534500 -- (-1512.615) [-1506.302] (-1506.255) (-1511.433) * (-1508.257) [-1514.808] (-1511.421) (-1507.504) -- 0:01:03
      535000 -- (-1513.001) (-1504.432) [-1508.467] (-1512.449) * [-1506.748] (-1524.737) (-1511.959) (-1507.633) -- 0:01:03

      Average standard deviation of split frequencies: 0.005717

      535500 -- (-1512.566) (-1511.790) [-1511.341] (-1509.401) * [-1506.019] (-1521.135) (-1509.067) (-1511.007) -- 0:01:03
      536000 -- (-1508.358) (-1513.509) (-1528.222) [-1508.941] * (-1505.849) (-1518.810) (-1509.141) [-1506.173] -- 0:01:03
      536500 -- [-1506.900] (-1512.460) (-1509.836) (-1509.580) * [-1505.125] (-1525.199) (-1518.805) (-1509.313) -- 0:01:03
      537000 -- (-1507.412) (-1511.357) [-1507.327] (-1511.812) * (-1515.029) (-1520.590) [-1517.283] (-1513.304) -- 0:01:02
      537500 -- [-1507.861] (-1517.401) (-1509.601) (-1512.364) * (-1510.341) (-1508.735) (-1520.201) [-1507.954] -- 0:01:02
      538000 -- [-1508.107] (-1515.597) (-1506.079) (-1507.035) * [-1510.711] (-1512.791) (-1512.419) (-1514.776) -- 0:01:02
      538500 -- (-1511.893) (-1522.572) (-1507.194) [-1506.142] * (-1506.220) (-1507.673) (-1517.152) [-1507.101] -- 0:01:02
      539000 -- [-1511.893] (-1513.024) (-1514.153) (-1504.675) * (-1506.804) (-1508.829) (-1523.610) [-1509.750] -- 0:01:02
      539500 -- (-1509.868) [-1512.638] (-1506.303) (-1507.818) * [-1510.244] (-1512.205) (-1511.851) (-1507.354) -- 0:01:03
      540000 -- (-1507.283) (-1513.662) [-1511.354] (-1509.278) * (-1511.777) (-1509.283) [-1511.483] (-1509.826) -- 0:01:03

      Average standard deviation of split frequencies: 0.006103

      540500 -- [-1507.114] (-1510.856) (-1510.301) (-1519.225) * (-1511.482) [-1508.311] (-1506.145) (-1512.445) -- 0:01:02
      541000 -- (-1515.890) (-1506.893) (-1511.985) [-1509.298] * (-1512.177) (-1508.234) (-1510.699) [-1506.457] -- 0:01:02
      541500 -- (-1510.206) (-1513.024) [-1507.088] (-1509.424) * (-1516.747) (-1506.272) (-1508.387) [-1510.257] -- 0:01:02
      542000 -- (-1505.983) [-1507.377] (-1513.220) (-1506.076) * [-1506.191] (-1506.323) (-1516.146) (-1514.138) -- 0:01:02
      542500 -- [-1509.486] (-1506.410) (-1510.961) (-1510.592) * (-1508.148) (-1512.817) (-1511.919) [-1508.971] -- 0:01:02
      543000 -- (-1512.407) (-1508.669) [-1509.147] (-1509.047) * (-1509.220) (-1514.041) [-1511.636] (-1521.968) -- 0:01:02
      543500 -- (-1507.464) (-1512.832) [-1513.028] (-1508.638) * [-1509.198] (-1515.765) (-1515.319) (-1510.667) -- 0:01:02
      544000 -- (-1511.654) (-1506.718) (-1512.051) [-1513.081] * (-1508.793) [-1506.668] (-1513.939) (-1515.827) -- 0:01:02
      544500 -- (-1514.626) (-1507.482) (-1506.483) [-1509.234] * [-1511.431] (-1506.649) (-1512.550) (-1518.487) -- 0:01:01
      545000 -- (-1512.248) (-1510.076) [-1511.114] (-1511.321) * (-1505.957) [-1504.733] (-1512.181) (-1509.576) -- 0:01:01

      Average standard deviation of split frequencies: 0.004317

      545500 -- (-1514.302) (-1513.075) (-1510.247) [-1506.384] * (-1511.615) [-1505.892] (-1509.588) (-1508.449) -- 0:01:01
      546000 -- (-1514.516) (-1512.194) (-1511.901) [-1505.357] * (-1513.516) [-1510.588] (-1515.984) (-1511.605) -- 0:01:01
      546500 -- (-1514.849) (-1509.884) (-1506.286) [-1509.081] * [-1510.338] (-1509.059) (-1506.086) (-1512.119) -- 0:01:01
      547000 -- (-1507.604) (-1514.023) [-1510.595] (-1507.996) * (-1512.953) [-1506.818] (-1507.985) (-1514.041) -- 0:01:02
      547500 -- (-1509.979) (-1514.878) [-1511.663] (-1509.218) * [-1512.616] (-1510.057) (-1508.785) (-1514.517) -- 0:01:01
      548000 -- [-1510.254] (-1511.616) (-1511.589) (-1508.766) * (-1509.850) (-1505.658) (-1512.318) [-1514.070] -- 0:01:01
      548500 -- (-1508.882) (-1509.368) (-1509.478) [-1508.602] * (-1507.749) [-1514.856] (-1510.431) (-1511.226) -- 0:01:01
      549000 -- [-1509.432] (-1510.638) (-1510.011) (-1510.489) * [-1509.344] (-1510.531) (-1509.822) (-1509.461) -- 0:01:01
      549500 -- (-1509.933) (-1505.023) (-1511.866) [-1510.858] * (-1509.964) [-1507.518] (-1507.296) (-1510.235) -- 0:01:01
      550000 -- (-1510.241) [-1506.511] (-1513.442) (-1508.234) * (-1507.686) (-1511.132) [-1506.356] (-1506.872) -- 0:01:01

      Average standard deviation of split frequencies: 0.008989

      550500 -- (-1511.711) (-1510.585) (-1507.373) [-1514.348] * (-1506.259) (-1508.930) (-1504.212) [-1508.563] -- 0:01:01
      551000 -- (-1515.517) [-1513.674] (-1509.692) (-1509.469) * (-1510.750) (-1507.886) (-1504.919) [-1508.051] -- 0:01:01
      551500 -- [-1506.455] (-1511.193) (-1515.797) (-1507.244) * (-1510.786) (-1519.429) [-1512.414] (-1509.868) -- 0:01:00
      552000 -- (-1512.076) (-1512.113) [-1510.157] (-1506.176) * [-1509.120] (-1514.669) (-1510.794) (-1504.531) -- 0:01:00
      552500 -- (-1507.500) [-1510.770] (-1506.828) (-1508.872) * (-1509.700) [-1507.378] (-1511.680) (-1512.583) -- 0:01:00
      553000 -- [-1505.600] (-1520.195) (-1504.294) (-1510.302) * [-1511.980] (-1506.155) (-1511.015) (-1512.080) -- 0:01:00
      553500 -- (-1507.126) (-1511.911) [-1511.899] (-1511.544) * [-1508.442] (-1508.621) (-1512.746) (-1508.163) -- 0:01:00
      554000 -- (-1514.471) (-1509.457) [-1509.996] (-1508.766) * (-1505.979) (-1509.959) (-1507.122) [-1506.728] -- 0:01:00
      554500 -- (-1520.414) (-1511.869) [-1508.418] (-1512.893) * (-1507.609) (-1512.055) (-1513.149) [-1506.304] -- 0:01:01
      555000 -- [-1512.147] (-1511.091) (-1509.028) (-1513.289) * (-1508.696) (-1505.071) (-1506.553) [-1510.163] -- 0:01:00

      Average standard deviation of split frequencies: 0.008055

      555500 -- (-1508.470) (-1511.081) [-1510.137] (-1512.242) * (-1506.344) (-1508.139) [-1511.008] (-1509.584) -- 0:01:00
      556000 -- (-1517.401) [-1505.338] (-1507.437) (-1514.797) * [-1509.801] (-1511.003) (-1507.796) (-1507.647) -- 0:01:00
      556500 -- (-1510.221) (-1511.074) [-1509.016] (-1510.161) * (-1511.074) (-1507.360) [-1513.425] (-1512.534) -- 0:01:00
      557000 -- (-1512.576) (-1509.415) [-1507.450] (-1510.487) * (-1509.706) (-1506.456) (-1509.195) [-1519.957] -- 0:01:00
      557500 -- (-1519.078) [-1507.808] (-1512.809) (-1514.370) * (-1509.934) (-1519.767) (-1508.386) [-1509.160] -- 0:01:00
      558000 -- (-1516.896) (-1511.882) (-1507.671) [-1513.884] * (-1511.425) (-1507.027) [-1508.786] (-1508.776) -- 0:01:00
      558500 -- [-1519.746] (-1506.719) (-1511.741) (-1512.876) * (-1507.271) (-1508.703) [-1505.474] (-1510.948) -- 0:01:00
      559000 -- [-1509.306] (-1506.871) (-1507.076) (-1507.609) * (-1509.576) [-1507.906] (-1510.339) (-1511.519) -- 0:00:59
      559500 -- (-1510.515) [-1505.882] (-1507.495) (-1511.851) * [-1507.661] (-1511.171) (-1509.861) (-1512.421) -- 0:00:59
      560000 -- (-1511.287) (-1509.541) [-1505.110] (-1508.296) * (-1514.781) (-1513.087) (-1506.532) [-1511.832] -- 0:00:59

      Average standard deviation of split frequencies: 0.007147

      560500 -- (-1511.963) [-1509.198] (-1511.037) (-1509.063) * [-1507.983] (-1514.429) (-1508.929) (-1508.537) -- 0:00:59
      561000 -- (-1511.444) [-1508.597] (-1510.005) (-1513.063) * (-1509.060) (-1512.922) [-1512.436] (-1506.913) -- 0:00:59
      561500 -- (-1506.152) (-1511.734) (-1507.657) [-1513.424] * (-1511.593) (-1513.935) [-1504.986] (-1506.113) -- 0:01:00
      562000 -- (-1518.247) (-1511.881) [-1505.235] (-1508.373) * (-1509.581) (-1506.078) (-1510.729) [-1511.775] -- 0:01:00
      562500 -- (-1512.410) (-1510.188) [-1509.436] (-1511.400) * (-1511.388) (-1515.939) (-1508.084) [-1511.391] -- 0:00:59
      563000 -- (-1509.003) (-1510.301) [-1508.258] (-1511.349) * (-1508.240) [-1507.902] (-1508.194) (-1515.323) -- 0:00:59
      563500 -- [-1512.889] (-1512.553) (-1509.237) (-1510.088) * (-1507.158) (-1508.110) (-1509.376) [-1510.364] -- 0:00:59
      564000 -- (-1513.599) (-1510.757) [-1507.601] (-1513.461) * (-1511.403) (-1505.795) (-1511.146) [-1509.155] -- 0:00:59
      564500 -- (-1512.060) [-1513.057] (-1508.070) (-1511.953) * (-1514.576) (-1510.671) (-1504.119) [-1510.256] -- 0:00:59
      565000 -- (-1516.015) (-1514.032) [-1509.379] (-1504.936) * (-1514.728) (-1504.281) [-1505.236] (-1509.891) -- 0:00:59

      Average standard deviation of split frequencies: 0.008745

      565500 -- (-1510.703) [-1512.960] (-1516.177) (-1507.971) * (-1511.504) (-1508.474) (-1506.861) [-1511.919] -- 0:00:59
      566000 -- (-1513.753) [-1507.395] (-1507.801) (-1512.073) * (-1508.168) (-1506.622) [-1505.204] (-1513.207) -- 0:00:59
      566500 -- (-1510.182) (-1505.132) (-1519.404) [-1507.854] * (-1510.112) [-1510.599] (-1507.867) (-1510.763) -- 0:00:58
      567000 -- (-1511.322) (-1507.288) [-1510.181] (-1507.779) * (-1516.658) [-1512.725] (-1511.250) (-1516.229) -- 0:00:58
      567500 -- (-1511.058) (-1521.880) (-1515.300) [-1511.897] * [-1508.982] (-1510.128) (-1511.832) (-1508.864) -- 0:00:58
      568000 -- [-1510.295] (-1515.644) (-1511.150) (-1510.464) * (-1506.050) [-1515.240] (-1509.827) (-1515.580) -- 0:00:58
      568500 -- [-1509.567] (-1506.996) (-1505.213) (-1511.771) * [-1509.267] (-1511.594) (-1505.842) (-1510.111) -- 0:00:59
      569000 -- (-1508.687) (-1512.784) [-1515.986] (-1508.927) * (-1508.963) (-1516.129) [-1516.933] (-1510.590) -- 0:00:59
      569500 -- [-1510.983] (-1507.427) (-1511.769) (-1513.184) * (-1513.990) (-1510.009) (-1511.131) [-1507.811] -- 0:00:58
      570000 -- [-1511.509] (-1508.509) (-1514.328) (-1511.322) * (-1504.447) [-1506.062] (-1508.607) (-1514.015) -- 0:00:58

      Average standard deviation of split frequencies: 0.009500

      570500 -- [-1511.248] (-1506.077) (-1511.347) (-1507.120) * (-1511.584) (-1504.033) [-1510.396] (-1517.870) -- 0:00:58
      571000 -- (-1515.771) [-1511.871] (-1519.515) (-1511.314) * [-1505.806] (-1515.364) (-1509.656) (-1511.176) -- 0:00:58
      571500 -- (-1507.544) (-1515.728) (-1514.008) [-1507.380] * (-1505.200) [-1506.703] (-1505.421) (-1517.465) -- 0:00:58
      572000 -- (-1507.117) [-1505.161] (-1511.918) (-1507.839) * (-1508.067) (-1512.652) (-1508.164) [-1504.261] -- 0:00:58
      572500 -- [-1512.724] (-1509.956) (-1517.146) (-1508.847) * [-1514.237] (-1509.120) (-1511.613) (-1509.132) -- 0:00:58
      573000 -- (-1517.933) [-1508.154] (-1507.623) (-1508.826) * (-1504.771) (-1505.880) [-1506.989] (-1513.126) -- 0:00:58
      573500 -- (-1518.795) [-1509.327] (-1506.162) (-1513.412) * (-1504.981) (-1505.042) [-1507.948] (-1510.616) -- 0:00:58
      574000 -- (-1512.117) (-1507.802) (-1508.232) [-1515.036] * (-1508.014) [-1506.502] (-1509.508) (-1510.561) -- 0:00:57
      574500 -- (-1504.380) (-1508.741) [-1507.121] (-1513.424) * (-1511.368) (-1514.098) (-1507.478) [-1509.112] -- 0:00:57
      575000 -- [-1506.279] (-1507.274) (-1507.310) (-1513.953) * (-1508.561) (-1509.311) (-1512.232) [-1507.369] -- 0:00:57

      Average standard deviation of split frequencies: 0.012276

      575500 -- [-1510.859] (-1506.771) (-1506.815) (-1509.735) * (-1511.126) [-1510.797] (-1506.679) (-1507.702) -- 0:00:58
      576000 -- (-1514.748) (-1507.781) [-1510.285] (-1508.628) * (-1511.968) (-1512.995) [-1507.660] (-1513.233) -- 0:00:58
      576500 -- [-1506.575] (-1508.976) (-1511.855) (-1521.437) * (-1507.519) [-1509.227] (-1508.714) (-1508.085) -- 0:00:58
      577000 -- (-1512.805) [-1507.789] (-1518.009) (-1514.663) * (-1510.508) [-1507.004] (-1505.053) (-1510.888) -- 0:00:57
      577500 -- (-1510.480) [-1509.276] (-1523.320) (-1510.327) * (-1507.395) (-1508.078) [-1508.492] (-1514.403) -- 0:00:57
      578000 -- (-1516.133) (-1514.013) (-1508.808) [-1509.602] * (-1508.435) (-1509.574) [-1509.214] (-1518.384) -- 0:00:57
      578500 -- (-1508.739) (-1509.175) [-1508.339] (-1514.788) * (-1511.146) (-1512.361) [-1511.301] (-1512.246) -- 0:00:57
      579000 -- (-1511.977) [-1509.150] (-1511.482) (-1513.892) * [-1510.092] (-1503.987) (-1514.913) (-1509.836) -- 0:00:57
      579500 -- (-1521.982) (-1515.352) [-1509.779] (-1515.020) * (-1514.890) (-1509.508) [-1510.425] (-1517.511) -- 0:00:57
      580000 -- (-1518.245) (-1508.218) (-1506.751) [-1511.250] * (-1508.445) (-1506.039) [-1506.654] (-1516.377) -- 0:00:57

      Average standard deviation of split frequencies: 0.015019

      580500 -- (-1509.257) (-1510.069) (-1506.451) [-1509.146] * [-1508.289] (-1511.175) (-1506.593) (-1505.251) -- 0:00:57
      581000 -- [-1508.228] (-1508.806) (-1512.937) (-1512.550) * [-1510.698] (-1510.345) (-1507.453) (-1506.432) -- 0:00:56
      581500 -- [-1505.278] (-1515.897) (-1511.688) (-1507.808) * (-1507.994) (-1508.959) (-1504.016) [-1506.806] -- 0:00:56
      582000 -- (-1510.520) (-1511.088) [-1504.243] (-1503.521) * (-1516.037) (-1510.411) [-1508.422] (-1508.135) -- 0:00:56
      582500 -- (-1507.753) (-1506.791) (-1516.050) [-1508.318] * (-1512.210) (-1506.259) (-1510.761) [-1511.855] -- 0:00:57
      583000 -- [-1507.377] (-1508.709) (-1509.210) (-1506.213) * (-1506.716) (-1513.225) (-1509.488) [-1508.703] -- 0:00:57
      583500 -- (-1506.592) (-1505.902) [-1511.293] (-1505.510) * [-1507.640] (-1514.129) (-1511.250) (-1505.826) -- 0:00:57
      584000 -- [-1505.770] (-1507.971) (-1515.863) (-1508.613) * (-1513.354) [-1509.093] (-1515.134) (-1511.436) -- 0:00:56
      584500 -- (-1511.430) (-1512.621) (-1518.772) [-1513.423] * [-1504.943] (-1504.879) (-1512.303) (-1508.045) -- 0:00:56
      585000 -- (-1509.812) (-1510.661) [-1510.015] (-1512.412) * (-1507.854) (-1507.474) [-1508.418] (-1508.943) -- 0:00:56

      Average standard deviation of split frequencies: 0.014882

      585500 -- (-1512.375) (-1508.916) [-1508.042] (-1505.778) * (-1517.829) (-1511.082) (-1511.945) [-1510.101] -- 0:00:56
      586000 -- [-1510.019] (-1511.098) (-1510.303) (-1510.496) * (-1510.159) (-1507.240) (-1511.987) [-1508.668] -- 0:00:56
      586500 -- (-1510.198) (-1511.552) (-1509.535) [-1509.367] * (-1510.159) (-1509.052) (-1510.168) [-1507.347] -- 0:00:56
      587000 -- (-1515.447) (-1510.110) (-1511.646) [-1506.534] * (-1518.252) [-1504.928] (-1513.045) (-1508.404) -- 0:00:56
      587500 -- (-1506.774) (-1513.981) (-1518.390) [-1505.926] * (-1510.272) (-1517.474) (-1511.326) [-1504.351] -- 0:00:56
      588000 -- (-1512.974) (-1510.503) (-1513.253) [-1507.932] * (-1507.957) [-1507.693] (-1508.800) (-1510.176) -- 0:00:56
      588500 -- (-1510.354) [-1511.932] (-1508.316) (-1515.242) * [-1505.126] (-1509.667) (-1513.839) (-1506.486) -- 0:00:55
      589000 -- (-1515.522) (-1521.004) [-1504.995] (-1510.637) * (-1512.027) (-1508.093) (-1504.937) [-1510.024] -- 0:00:55
      589500 -- (-1514.923) (-1510.813) [-1508.980] (-1509.718) * (-1508.402) (-1516.321) [-1509.329] (-1507.237) -- 0:00:56
      590000 -- (-1512.687) (-1508.959) [-1509.929] (-1506.629) * (-1509.631) (-1507.870) [-1504.732] (-1508.659) -- 0:00:56

      Average standard deviation of split frequencies: 0.015962

      590500 -- (-1506.622) (-1507.424) (-1505.945) [-1510.540] * (-1512.252) (-1512.154) [-1506.028] (-1509.588) -- 0:00:56
      591000 -- (-1507.269) [-1507.297] (-1506.974) (-1514.524) * (-1505.756) (-1515.579) (-1516.602) [-1508.392] -- 0:00:56
      591500 -- [-1504.862] (-1509.958) (-1508.707) (-1507.920) * [-1507.213] (-1519.202) (-1513.010) (-1505.815) -- 0:00:55
      592000 -- (-1504.850) (-1509.812) (-1512.627) [-1507.085] * (-1506.421) [-1508.781] (-1513.475) (-1509.566) -- 0:00:55
      592500 -- (-1515.989) [-1509.196] (-1512.978) (-1511.605) * (-1505.084) [-1508.849] (-1513.446) (-1506.552) -- 0:00:55
      593000 -- (-1507.580) (-1507.272) (-1503.006) [-1506.775] * (-1507.168) (-1510.406) (-1508.237) [-1506.250] -- 0:00:55
      593500 -- (-1508.199) [-1506.440] (-1515.306) (-1513.845) * (-1506.369) (-1511.284) [-1510.709] (-1507.436) -- 0:00:55
      594000 -- (-1507.179) (-1511.795) [-1509.096] (-1518.078) * (-1506.256) [-1509.934] (-1510.568) (-1507.369) -- 0:00:55
      594500 -- [-1505.345] (-1509.913) (-1512.589) (-1519.673) * [-1510.478] (-1511.993) (-1510.487) (-1508.471) -- 0:00:55
      595000 -- (-1505.463) [-1509.351] (-1515.540) (-1516.038) * (-1510.228) (-1507.360) (-1509.295) [-1511.552] -- 0:00:55

      Average standard deviation of split frequencies: 0.018192

      595500 -- (-1508.319) (-1513.152) (-1510.665) [-1507.454] * [-1508.804] (-1509.846) (-1508.181) (-1507.541) -- 0:00:55
      596000 -- (-1508.117) (-1509.737) [-1508.367] (-1521.986) * (-1513.324) [-1509.603] (-1510.285) (-1507.503) -- 0:00:55
      596500 -- [-1509.566] (-1509.657) (-1506.363) (-1512.450) * (-1512.870) (-1510.206) (-1513.610) [-1506.179] -- 0:00:55
      597000 -- [-1504.157] (-1507.610) (-1508.706) (-1506.544) * (-1506.250) (-1506.934) (-1507.916) [-1510.851] -- 0:00:55
      597500 -- [-1509.299] (-1508.716) (-1504.192) (-1507.931) * [-1506.739] (-1510.512) (-1510.059) (-1516.461) -- 0:00:55
      598000 -- (-1513.316) (-1512.070) [-1508.928] (-1510.556) * (-1506.977) (-1512.417) [-1504.373] (-1516.383) -- 0:00:55
      598500 -- (-1510.103) (-1511.113) [-1507.596] (-1512.793) * [-1509.062] (-1508.023) (-1512.927) (-1510.964) -- 0:00:55
      599000 -- (-1511.956) (-1506.662) (-1505.243) [-1507.123] * (-1509.077) (-1510.540) (-1510.691) [-1509.410] -- 0:00:54
      599500 -- (-1509.496) (-1515.632) [-1506.994] (-1506.813) * [-1511.826] (-1507.176) (-1508.709) (-1504.934) -- 0:00:54
      600000 -- [-1510.041] (-1516.551) (-1507.167) (-1507.798) * (-1512.386) (-1508.336) (-1515.577) [-1510.009] -- 0:00:54

      Average standard deviation of split frequencies: 0.017266

      600500 -- (-1510.365) (-1515.631) (-1510.356) [-1507.968] * (-1505.281) [-1511.247] (-1509.014) (-1509.718) -- 0:00:54
      601000 -- [-1506.435] (-1512.595) (-1509.514) (-1508.324) * (-1515.741) (-1514.053) (-1507.382) [-1508.573] -- 0:00:54
      601500 -- [-1506.808] (-1509.467) (-1508.529) (-1511.273) * (-1509.117) (-1507.067) [-1510.113] (-1507.345) -- 0:00:54
      602000 -- (-1510.459) [-1511.083] (-1515.634) (-1510.050) * (-1507.048) (-1511.217) [-1504.706] (-1511.004) -- 0:00:54
      602500 -- (-1514.696) (-1511.866) [-1507.091] (-1508.075) * (-1508.906) [-1505.108] (-1506.986) (-1512.271) -- 0:00:54
      603000 -- (-1511.775) (-1510.539) [-1507.836] (-1508.152) * (-1511.935) (-1507.798) [-1507.525] (-1510.623) -- 0:00:54
      603500 -- (-1514.790) (-1511.476) [-1505.485] (-1508.607) * (-1509.669) [-1509.612] (-1509.260) (-1507.020) -- 0:00:54
      604000 -- (-1506.161) (-1510.703) (-1511.026) [-1507.642] * [-1510.012] (-1517.599) (-1506.376) (-1506.009) -- 0:00:54
      604500 -- (-1505.854) (-1507.686) (-1509.485) [-1505.582] * [-1504.449] (-1516.264) (-1507.463) (-1505.443) -- 0:00:54
      605000 -- [-1505.113] (-1511.778) (-1507.424) (-1517.330) * (-1506.375) (-1516.963) [-1508.970] (-1507.643) -- 0:00:54

      Average standard deviation of split frequencies: 0.019447

      605500 -- (-1509.733) (-1503.930) (-1512.314) [-1508.359] * (-1511.465) (-1508.080) [-1514.980] (-1509.437) -- 0:00:54
      606000 -- (-1508.331) [-1509.379] (-1512.555) (-1518.988) * (-1514.611) [-1508.918] (-1513.084) (-1507.500) -- 0:00:53
      606500 -- (-1510.696) (-1511.473) [-1508.423] (-1513.883) * (-1509.576) (-1513.516) [-1509.361] (-1509.765) -- 0:00:53
      607000 -- [-1507.682] (-1509.596) (-1516.277) (-1506.354) * (-1517.168) (-1517.913) [-1506.135] (-1510.360) -- 0:00:53
      607500 -- (-1511.858) [-1506.512] (-1511.297) (-1504.960) * (-1509.781) (-1510.929) [-1505.996] (-1525.315) -- 0:00:53
      608000 -- (-1516.124) (-1509.241) (-1512.251) [-1510.963] * (-1509.281) (-1509.641) (-1506.886) [-1512.643] -- 0:00:53
      608500 -- (-1507.848) (-1508.032) [-1506.093] (-1505.840) * (-1508.078) (-1515.091) [-1508.376] (-1507.831) -- 0:00:53
      609000 -- (-1505.930) [-1507.891] (-1504.070) (-1514.062) * (-1509.712) [-1506.812] (-1509.537) (-1509.376) -- 0:00:53
      609500 -- (-1512.498) (-1509.424) [-1512.073] (-1508.711) * (-1507.224) (-1507.986) (-1510.020) [-1515.394] -- 0:00:53
      610000 -- (-1522.595) (-1506.117) (-1509.461) [-1512.558] * (-1511.607) (-1506.701) [-1511.455] (-1511.993) -- 0:00:53

      Average standard deviation of split frequencies: 0.021229

      610500 -- [-1510.359] (-1508.963) (-1509.706) (-1514.921) * (-1513.737) [-1510.552] (-1510.014) (-1509.865) -- 0:00:53
      611000 -- (-1508.299) [-1508.724] (-1508.628) (-1511.194) * [-1506.222] (-1518.061) (-1518.690) (-1509.952) -- 0:00:53
      611500 -- (-1514.106) (-1509.404) (-1503.780) [-1507.252] * [-1509.351] (-1519.299) (-1517.281) (-1511.148) -- 0:00:53
      612000 -- (-1512.278) [-1512.594] (-1505.738) (-1511.920) * (-1507.762) [-1509.476] (-1518.205) (-1516.366) -- 0:00:53
      612500 -- (-1511.719) (-1507.865) (-1508.871) [-1512.271] * (-1514.193) [-1508.427] (-1509.588) (-1509.292) -- 0:00:53
      613000 -- (-1509.753) (-1512.280) [-1508.323] (-1507.357) * [-1510.195] (-1508.712) (-1510.616) (-1513.723) -- 0:00:53
      613500 -- (-1507.666) (-1509.638) [-1510.350] (-1506.763) * [-1508.329] (-1517.860) (-1511.918) (-1511.365) -- 0:00:52
      614000 -- (-1506.314) [-1507.321] (-1513.808) (-1513.648) * [-1506.845] (-1510.336) (-1507.201) (-1514.746) -- 0:00:52
      614500 -- (-1508.833) [-1507.897] (-1510.627) (-1510.216) * [-1505.698] (-1510.998) (-1516.161) (-1510.977) -- 0:00:52
      615000 -- (-1508.573) (-1508.944) [-1509.591] (-1515.223) * [-1509.495] (-1510.167) (-1514.925) (-1511.428) -- 0:00:52

      Average standard deviation of split frequencies: 0.019132

      615500 -- (-1511.074) [-1509.475] (-1509.524) (-1509.730) * (-1514.006) (-1503.850) (-1515.073) [-1506.702] -- 0:00:52
      616000 -- (-1505.942) [-1515.127] (-1516.711) (-1509.569) * (-1510.923) (-1510.009) (-1508.217) [-1512.195] -- 0:00:52
      616500 -- [-1505.130] (-1513.326) (-1519.120) (-1508.847) * (-1509.629) (-1506.015) (-1513.014) [-1507.576] -- 0:00:52
      617000 -- (-1506.768) [-1507.213] (-1509.860) (-1506.778) * (-1512.155) (-1509.892) (-1511.240) [-1509.819] -- 0:00:52
      617500 -- (-1510.314) [-1505.620] (-1509.368) (-1508.655) * (-1511.366) (-1511.785) [-1508.629] (-1510.909) -- 0:00:52
      618000 -- [-1512.571] (-1507.428) (-1507.468) (-1506.846) * (-1504.888) (-1511.019) [-1509.417] (-1512.973) -- 0:00:52
      618500 -- (-1515.166) (-1510.764) (-1509.127) [-1505.808] * (-1509.292) [-1511.641] (-1509.704) (-1512.013) -- 0:00:52
      619000 -- (-1509.772) (-1514.405) [-1506.852] (-1508.620) * (-1509.036) (-1510.205) [-1508.078] (-1509.476) -- 0:00:52
      619500 -- [-1507.020] (-1513.032) (-1510.869) (-1510.119) * [-1504.859] (-1509.153) (-1513.613) (-1509.926) -- 0:00:52
      620000 -- (-1510.130) (-1507.219) (-1505.517) [-1504.203] * (-1508.347) [-1505.914] (-1507.269) (-1509.037) -- 0:00:52

      Average standard deviation of split frequencies: 0.020507

      620500 -- (-1515.684) (-1509.639) (-1506.579) [-1508.320] * [-1509.277] (-1513.000) (-1508.426) (-1508.041) -- 0:00:51
      621000 -- (-1516.119) (-1506.477) [-1505.384] (-1508.898) * (-1511.931) (-1508.253) [-1509.824] (-1511.485) -- 0:00:51
      621500 -- (-1514.874) (-1510.212) (-1508.491) [-1509.898] * (-1513.905) (-1513.661) [-1511.808] (-1516.040) -- 0:00:51
      622000 -- [-1506.440] (-1512.176) (-1505.320) (-1516.137) * [-1516.292] (-1513.687) (-1509.332) (-1515.680) -- 0:00:51
      622500 -- (-1507.498) (-1516.354) [-1510.904] (-1515.417) * (-1517.205) (-1510.020) (-1506.133) [-1508.650] -- 0:00:51
      623000 -- [-1506.494] (-1507.774) (-1510.054) (-1508.038) * [-1512.172] (-1507.365) (-1507.294) (-1507.532) -- 0:00:51
      623500 -- (-1506.509) (-1512.092) (-1516.234) [-1504.403] * (-1507.768) [-1512.717] (-1506.940) (-1510.635) -- 0:00:51
      624000 -- [-1516.638] (-1509.894) (-1513.206) (-1511.406) * (-1510.399) (-1509.774) [-1509.607] (-1521.519) -- 0:00:51
      624500 -- (-1507.200) [-1507.596] (-1510.874) (-1508.653) * [-1513.730] (-1507.423) (-1505.649) (-1515.332) -- 0:00:51
      625000 -- (-1505.774) (-1510.873) (-1507.247) [-1506.754] * [-1511.947] (-1505.181) (-1511.872) (-1512.167) -- 0:00:51

      Average standard deviation of split frequencies: 0.019579

      625500 -- (-1503.509) (-1512.801) [-1510.716] (-1515.805) * (-1506.744) [-1509.851] (-1510.693) (-1509.699) -- 0:00:51
      626000 -- (-1509.504) (-1513.290) (-1509.774) [-1507.276] * [-1506.178] (-1513.769) (-1510.057) (-1515.839) -- 0:00:51
      626500 -- (-1509.297) (-1510.910) (-1507.833) [-1507.487] * (-1509.787) (-1511.457) (-1509.419) [-1507.488] -- 0:00:51
      627000 -- (-1511.832) (-1511.579) [-1507.805] (-1506.887) * (-1515.104) [-1511.720] (-1510.158) (-1508.700) -- 0:00:51
      627500 -- (-1505.804) [-1507.924] (-1507.259) (-1510.812) * (-1503.859) [-1509.786] (-1502.413) (-1507.851) -- 0:00:51
      628000 -- [-1503.019] (-1507.838) (-1511.787) (-1514.152) * (-1508.913) [-1509.636] (-1513.188) (-1511.267) -- 0:00:50
      628500 -- (-1519.736) (-1506.799) [-1509.079] (-1515.268) * [-1508.229] (-1509.472) (-1510.821) (-1506.189) -- 0:00:50
      629000 -- (-1508.487) (-1511.417) [-1512.861] (-1509.769) * (-1508.931) (-1506.050) (-1510.629) [-1507.724] -- 0:00:50
      629500 -- [-1508.827] (-1508.975) (-1512.537) (-1510.938) * (-1510.132) (-1505.163) [-1507.810] (-1509.330) -- 0:00:50
      630000 -- [-1505.760] (-1512.445) (-1511.510) (-1508.010) * (-1512.867) (-1507.736) [-1511.814] (-1505.274) -- 0:00:50

      Average standard deviation of split frequencies: 0.021677

      630500 -- (-1506.095) (-1510.087) (-1509.213) [-1511.101] * (-1508.844) (-1505.558) [-1508.696] (-1507.545) -- 0:00:50
      631000 -- (-1514.408) (-1512.324) [-1508.097] (-1515.170) * (-1504.820) (-1514.081) [-1513.247] (-1507.704) -- 0:00:50
      631500 -- (-1507.602) (-1508.315) [-1507.956] (-1513.345) * [-1507.161] (-1514.490) (-1509.873) (-1509.749) -- 0:00:50
      632000 -- (-1508.691) (-1513.417) (-1518.522) [-1511.267] * [-1508.510] (-1508.426) (-1516.648) (-1508.999) -- 0:00:50
      632500 -- [-1509.395] (-1510.946) (-1514.659) (-1505.759) * (-1513.111) (-1509.087) (-1510.875) [-1513.598] -- 0:00:50
      633000 -- [-1508.552] (-1510.323) (-1512.232) (-1512.864) * [-1509.398] (-1510.666) (-1509.591) (-1512.711) -- 0:00:50
      633500 -- (-1506.222) [-1512.869] (-1511.618) (-1512.107) * [-1508.278] (-1513.033) (-1513.329) (-1510.744) -- 0:00:50
      634000 -- (-1510.322) [-1507.518] (-1509.806) (-1506.053) * [-1516.664] (-1514.090) (-1509.277) (-1512.688) -- 0:00:50
      634500 -- (-1505.036) [-1505.894] (-1512.819) (-1508.021) * (-1509.664) (-1509.280) [-1516.227] (-1509.698) -- 0:00:50
      635000 -- [-1503.481] (-1505.412) (-1516.124) (-1511.420) * [-1508.431] (-1506.948) (-1524.178) (-1510.650) -- 0:00:50

      Average standard deviation of split frequencies: 0.020383

      635500 -- (-1509.513) (-1506.282) (-1508.511) [-1511.932] * (-1507.523) (-1515.654) (-1513.590) [-1504.301] -- 0:00:49
      636000 -- (-1510.091) [-1506.406] (-1513.783) (-1512.425) * [-1503.777] (-1507.339) (-1510.016) (-1504.425) -- 0:00:49
      636500 -- [-1508.970] (-1509.370) (-1511.441) (-1513.635) * (-1509.951) (-1504.819) (-1511.025) [-1512.417] -- 0:00:49
      637000 -- (-1509.240) [-1507.167] (-1505.818) (-1517.161) * (-1510.730) [-1509.374] (-1513.725) (-1508.472) -- 0:00:49
      637500 -- (-1506.848) (-1510.407) [-1511.575] (-1510.462) * (-1507.311) (-1511.216) (-1515.345) [-1505.219] -- 0:00:50
      638000 -- [-1506.711] (-1513.415) (-1509.361) (-1517.104) * (-1508.979) (-1506.302) (-1508.521) [-1509.974] -- 0:00:49
      638500 -- (-1506.003) (-1508.249) [-1509.786] (-1508.269) * (-1510.109) (-1514.556) [-1508.845] (-1512.676) -- 0:00:49
      639000 -- [-1506.358] (-1510.607) (-1514.265) (-1510.242) * [-1512.115] (-1511.800) (-1508.710) (-1511.411) -- 0:00:49
      639500 -- (-1509.378) (-1505.595) [-1506.496] (-1516.290) * (-1507.886) (-1508.527) [-1510.587] (-1515.272) -- 0:00:49
      640000 -- (-1508.130) (-1507.186) [-1512.226] (-1510.757) * (-1508.815) (-1511.945) (-1507.311) [-1510.159] -- 0:00:49

      Average standard deviation of split frequencies: 0.019499

      640500 -- [-1511.972] (-1513.097) (-1507.386) (-1508.960) * (-1507.166) (-1521.004) (-1506.785) [-1508.630] -- 0:00:49
      641000 -- (-1510.661) (-1509.668) [-1505.735] (-1507.637) * (-1506.018) [-1508.725] (-1507.658) (-1509.124) -- 0:00:49
      641500 -- (-1510.465) [-1515.050] (-1507.196) (-1511.859) * (-1504.432) [-1505.196] (-1514.908) (-1511.327) -- 0:00:49
      642000 -- [-1508.231] (-1505.811) (-1510.712) (-1515.179) * (-1506.924) (-1507.326) [-1509.546] (-1512.843) -- 0:00:49
      642500 -- [-1508.208] (-1509.004) (-1514.086) (-1511.514) * (-1512.005) [-1505.373] (-1504.985) (-1513.741) -- 0:00:48
      643000 -- [-1509.261] (-1508.713) (-1513.882) (-1505.045) * (-1509.656) [-1505.727] (-1505.287) (-1509.879) -- 0:00:48
      643500 -- (-1507.559) (-1511.373) [-1508.888] (-1508.895) * (-1511.868) (-1507.292) [-1506.413] (-1506.841) -- 0:00:48
      644000 -- (-1512.361) (-1504.170) [-1509.500] (-1508.367) * (-1509.648) (-1504.666) [-1509.301] (-1503.542) -- 0:00:48
      644500 -- (-1510.249) [-1507.541] (-1509.528) (-1510.280) * (-1507.480) [-1506.608] (-1508.760) (-1506.006) -- 0:00:49
      645000 -- [-1508.414] (-1506.026) (-1516.544) (-1511.288) * [-1517.214] (-1509.629) (-1509.638) (-1506.841) -- 0:00:48

      Average standard deviation of split frequencies: 0.018608

      645500 -- (-1509.463) [-1507.897] (-1514.018) (-1511.311) * (-1512.588) (-1510.129) [-1512.134] (-1508.687) -- 0:00:48
      646000 -- (-1503.001) (-1513.528) (-1511.667) [-1512.607] * (-1505.420) (-1508.676) (-1511.004) [-1509.790] -- 0:00:48
      646500 -- [-1506.350] (-1506.477) (-1509.304) (-1507.059) * (-1512.719) (-1507.415) (-1507.572) [-1511.070] -- 0:00:48
      647000 -- [-1506.889] (-1510.364) (-1510.730) (-1515.366) * (-1510.025) [-1509.850] (-1509.383) (-1508.250) -- 0:00:48
      647500 -- [-1505.569] (-1512.176) (-1512.063) (-1507.434) * (-1513.266) (-1512.621) (-1517.907) [-1505.948] -- 0:00:48
      648000 -- (-1516.693) (-1505.290) (-1513.507) [-1509.124] * (-1512.821) (-1509.869) [-1508.698] (-1510.528) -- 0:00:48
      648500 -- (-1510.211) (-1508.440) [-1511.792] (-1514.689) * (-1509.327) [-1511.021] (-1512.076) (-1508.773) -- 0:00:48
      649000 -- (-1512.252) (-1508.363) (-1507.379) [-1504.994] * (-1513.746) [-1511.179] (-1505.277) (-1505.808) -- 0:00:48
      649500 -- (-1517.351) [-1505.103] (-1512.373) (-1509.590) * (-1508.717) (-1506.892) [-1508.049] (-1509.194) -- 0:00:48
      650000 -- (-1511.607) (-1508.634) (-1507.491) [-1506.651] * (-1515.518) (-1508.512) (-1506.244) [-1508.316] -- 0:00:47

      Average standard deviation of split frequencies: 0.022459

      650500 -- [-1508.763] (-1511.777) (-1505.297) (-1511.067) * [-1506.096] (-1513.804) (-1506.999) (-1514.477) -- 0:00:47
      651000 -- (-1511.695) (-1516.269) (-1503.220) [-1507.260] * (-1504.542) (-1506.769) [-1514.321] (-1515.186) -- 0:00:47
      651500 -- (-1506.182) (-1515.722) (-1507.600) [-1504.852] * (-1509.987) (-1511.272) (-1510.772) [-1514.731] -- 0:00:48
      652000 -- (-1505.712) (-1508.394) (-1507.140) [-1508.284] * [-1510.032] (-1515.645) (-1508.144) (-1513.718) -- 0:00:48
      652500 -- [-1505.908] (-1506.452) (-1508.779) (-1504.953) * (-1512.276) (-1517.305) [-1507.711] (-1512.900) -- 0:00:47
      653000 -- (-1507.408) (-1511.291) [-1509.629] (-1509.256) * [-1507.064] (-1506.659) (-1511.233) (-1509.416) -- 0:00:47
      653500 -- (-1505.799) (-1507.946) (-1508.905) [-1506.052] * [-1509.489] (-1511.145) (-1514.614) (-1515.878) -- 0:00:47
      654000 -- (-1511.607) [-1511.448] (-1508.765) (-1508.257) * (-1510.712) (-1512.156) (-1516.085) [-1514.607] -- 0:00:47
      654500 -- (-1511.360) (-1516.027) [-1511.890] (-1511.114) * (-1511.056) (-1508.146) (-1512.332) [-1509.038] -- 0:00:47
      655000 -- (-1508.992) (-1505.684) (-1504.344) [-1509.967] * [-1506.691] (-1507.924) (-1507.216) (-1503.985) -- 0:00:47

      Average standard deviation of split frequencies: 0.020121

      655500 -- (-1505.174) (-1509.876) [-1507.625] (-1517.208) * (-1514.884) [-1510.047] (-1510.256) (-1512.846) -- 0:00:47
      656000 -- (-1503.667) [-1511.937] (-1511.674) (-1510.089) * (-1509.994) (-1509.331) [-1511.352] (-1506.971) -- 0:00:47
      656500 -- (-1514.378) [-1509.911] (-1511.756) (-1510.064) * [-1509.248] (-1510.667) (-1513.292) (-1507.575) -- 0:00:47
      657000 -- [-1510.313] (-1507.940) (-1519.043) (-1511.164) * (-1512.830) (-1508.496) (-1509.666) [-1509.552] -- 0:00:46
      657500 -- (-1514.616) (-1506.994) (-1510.199) [-1509.588] * (-1516.250) (-1504.774) [-1510.869] (-1508.906) -- 0:00:46
      658000 -- (-1510.447) (-1512.550) (-1506.682) [-1506.653] * (-1511.926) (-1511.006) [-1512.761] (-1512.900) -- 0:00:47
      658500 -- (-1508.736) (-1512.358) [-1510.114] (-1511.089) * [-1512.350] (-1510.168) (-1511.621) (-1513.386) -- 0:00:47
      659000 -- (-1505.444) [-1508.122] (-1509.131) (-1510.737) * (-1504.013) (-1509.018) [-1510.065] (-1508.759) -- 0:00:47
      659500 -- (-1506.991) [-1504.849] (-1510.049) (-1509.702) * (-1508.037) (-1514.371) (-1510.507) [-1506.582] -- 0:00:46
      660000 -- (-1509.071) (-1508.555) (-1509.048) [-1506.691] * (-1510.002) (-1508.802) [-1511.154] (-1508.060) -- 0:00:46

      Average standard deviation of split frequencies: 0.022119

      660500 -- [-1511.932] (-1511.185) (-1510.287) (-1507.200) * (-1510.438) (-1507.035) [-1504.809] (-1510.589) -- 0:00:46
      661000 -- (-1512.390) (-1511.459) (-1515.654) [-1505.588] * [-1511.217] (-1507.664) (-1509.420) (-1508.620) -- 0:00:46
      661500 -- (-1513.972) [-1505.422] (-1515.671) (-1508.367) * (-1507.423) [-1505.907] (-1510.837) (-1511.924) -- 0:00:46
      662000 -- (-1514.335) [-1510.224] (-1509.170) (-1510.585) * [-1508.769] (-1510.532) (-1510.380) (-1507.230) -- 0:00:46
      662500 -- (-1508.624) [-1512.033] (-1509.973) (-1509.827) * (-1512.049) [-1508.285] (-1510.189) (-1510.553) -- 0:00:46
      663000 -- [-1508.486] (-1506.431) (-1507.638) (-1506.490) * (-1508.294) (-1510.182) [-1507.117] (-1508.325) -- 0:00:46
      663500 -- [-1508.980] (-1508.849) (-1507.109) (-1516.404) * (-1507.589) (-1510.238) (-1508.453) [-1510.020] -- 0:00:46
      664000 -- (-1505.903) (-1515.701) (-1508.021) [-1507.920] * (-1506.347) (-1518.446) [-1509.316] (-1513.100) -- 0:00:46
      664500 -- (-1506.461) (-1506.424) (-1504.561) [-1512.022] * [-1506.595] (-1511.634) (-1513.114) (-1507.873) -- 0:00:45
      665000 -- [-1511.451] (-1507.640) (-1504.914) (-1510.198) * (-1507.151) [-1510.039] (-1513.164) (-1510.834) -- 0:00:46

      Average standard deviation of split frequencies: 0.020881

      665500 -- (-1509.759) (-1506.732) [-1510.513] (-1505.007) * (-1509.488) (-1516.095) (-1512.309) [-1507.429] -- 0:00:46
      666000 -- [-1507.715] (-1515.178) (-1510.279) (-1509.296) * (-1506.797) (-1507.893) [-1520.730] (-1510.106) -- 0:00:46
      666500 -- (-1509.057) [-1514.905] (-1511.049) (-1511.292) * (-1504.855) [-1511.526] (-1510.837) (-1509.990) -- 0:00:46
      667000 -- [-1511.184] (-1508.314) (-1513.241) (-1506.761) * [-1507.741] (-1505.499) (-1508.046) (-1512.639) -- 0:00:45
      667500 -- (-1508.726) (-1504.545) (-1507.595) [-1514.260] * (-1505.523) [-1508.300] (-1511.920) (-1509.992) -- 0:00:45
      668000 -- (-1507.306) (-1507.577) (-1508.427) [-1512.151] * (-1509.481) (-1509.152) (-1505.883) [-1508.882] -- 0:00:45
      668500 -- (-1515.309) [-1511.761] (-1506.312) (-1506.388) * (-1519.670) (-1510.155) [-1510.815] (-1507.269) -- 0:00:45
      669000 -- (-1512.529) (-1504.393) [-1508.525] (-1507.392) * (-1529.965) (-1510.734) [-1508.984] (-1513.230) -- 0:00:45
      669500 -- (-1510.657) (-1508.330) [-1510.093] (-1509.444) * (-1516.285) (-1512.997) (-1506.618) [-1508.730] -- 0:00:45
      670000 -- (-1505.896) [-1506.743] (-1511.860) (-1512.752) * (-1506.089) (-1509.628) [-1506.769] (-1508.806) -- 0:00:45

      Average standard deviation of split frequencies: 0.024601

      670500 -- [-1510.053] (-1505.343) (-1514.316) (-1510.753) * (-1511.511) [-1507.739] (-1510.564) (-1508.969) -- 0:00:45
      671000 -- (-1510.507) (-1511.065) (-1511.627) [-1509.778] * (-1510.224) (-1508.854) [-1508.121] (-1517.567) -- 0:00:45
      671500 -- [-1509.141] (-1507.659) (-1506.468) (-1507.282) * [-1508.978] (-1506.914) (-1512.765) (-1510.012) -- 0:00:45
      672000 -- (-1507.316) (-1517.233) [-1505.154] (-1512.216) * (-1509.274) [-1512.250] (-1512.443) (-1512.562) -- 0:00:45
      672500 -- [-1509.220] (-1513.888) (-1510.893) (-1514.023) * (-1513.555) [-1506.375] (-1509.995) (-1510.378) -- 0:00:45
      673000 -- (-1507.794) (-1518.899) (-1514.261) [-1505.768] * (-1514.530) (-1509.203) (-1507.580) [-1507.392] -- 0:00:45
      673500 -- (-1508.063) (-1509.975) (-1511.285) [-1506.923] * [-1508.685] (-1510.648) (-1510.883) (-1507.976) -- 0:00:45
      674000 -- (-1510.646) (-1508.646) [-1506.872] (-1507.484) * (-1508.061) (-1510.963) (-1513.359) [-1503.935] -- 0:00:44
      674500 -- [-1508.834] (-1509.087) (-1511.311) (-1507.174) * (-1509.906) (-1509.174) (-1521.725) [-1506.480] -- 0:00:44
      675000 -- [-1508.038] (-1510.431) (-1509.872) (-1513.048) * (-1515.692) (-1508.251) (-1520.613) [-1510.708] -- 0:00:44

      Average standard deviation of split frequencies: 0.019526

      675500 -- [-1510.733] (-1507.235) (-1509.446) (-1507.396) * [-1512.462] (-1505.090) (-1517.385) (-1511.285) -- 0:00:44
      676000 -- [-1510.622] (-1514.144) (-1506.200) (-1507.531) * (-1512.209) (-1512.401) [-1518.310] (-1507.281) -- 0:00:44
      676500 -- (-1513.300) (-1507.377) [-1515.129] (-1511.158) * (-1510.942) (-1511.688) (-1513.343) [-1510.182] -- 0:00:44
      677000 -- (-1515.085) [-1510.642] (-1510.821) (-1511.965) * [-1507.504] (-1508.775) (-1510.077) (-1508.203) -- 0:00:44
      677500 -- [-1509.017] (-1509.679) (-1512.644) (-1507.436) * (-1505.281) (-1512.752) [-1508.350] (-1507.158) -- 0:00:44
      678000 -- [-1512.297] (-1520.232) (-1514.862) (-1507.162) * (-1511.612) (-1507.374) [-1510.838] (-1509.606) -- 0:00:44
      678500 -- (-1510.369) [-1507.405] (-1513.483) (-1510.024) * (-1508.646) (-1507.012) (-1512.132) [-1507.171] -- 0:00:44
      679000 -- (-1511.549) [-1510.446] (-1516.017) (-1512.629) * (-1512.074) (-1508.097) [-1506.950] (-1507.042) -- 0:00:44
      679500 -- (-1507.986) (-1508.853) (-1510.442) [-1504.969] * [-1508.131] (-1511.372) (-1509.158) (-1510.558) -- 0:00:44
      680000 -- (-1507.839) (-1504.261) [-1509.560] (-1509.997) * (-1508.587) (-1509.892) (-1510.493) [-1510.146] -- 0:00:44

      Average standard deviation of split frequencies: 0.022855

      680500 -- (-1506.337) (-1509.510) (-1515.109) [-1508.394] * (-1508.223) [-1510.454] (-1511.635) (-1509.721) -- 0:00:44
      681000 -- (-1505.673) [-1505.921] (-1511.339) (-1510.941) * (-1516.379) [-1511.584] (-1514.326) (-1505.044) -- 0:00:44
      681500 -- [-1509.524] (-1507.471) (-1505.426) (-1506.816) * (-1506.612) [-1512.917] (-1510.852) (-1521.035) -- 0:00:43
      682000 -- (-1513.360) (-1509.193) (-1515.753) [-1509.943] * (-1513.936) (-1508.235) [-1509.491] (-1514.620) -- 0:00:43
      682500 -- (-1510.027) (-1513.063) [-1510.806] (-1513.152) * (-1520.977) [-1511.118] (-1508.828) (-1511.033) -- 0:00:43
      683000 -- [-1507.826] (-1512.085) (-1517.452) (-1510.969) * (-1514.769) [-1508.880] (-1512.843) (-1511.235) -- 0:00:43
      683500 -- (-1507.602) [-1512.154] (-1516.242) (-1515.599) * (-1514.416) (-1508.864) [-1506.578] (-1506.282) -- 0:00:43
      684000 -- (-1509.807) (-1516.951) [-1513.389] (-1510.031) * (-1517.377) (-1512.254) [-1512.787] (-1506.359) -- 0:00:43
      684500 -- (-1510.947) (-1507.804) [-1511.006] (-1512.812) * (-1515.028) [-1504.336] (-1513.736) (-1507.568) -- 0:00:43
      685000 -- (-1512.281) (-1511.655) (-1509.386) [-1508.423] * (-1511.278) [-1508.521] (-1507.769) (-1506.971) -- 0:00:43

      Average standard deviation of split frequencies: 0.023708

      685500 -- (-1512.518) (-1511.825) [-1510.564] (-1511.866) * (-1502.915) [-1507.024] (-1511.731) (-1508.633) -- 0:00:43
      686000 -- (-1514.728) (-1511.641) [-1504.397] (-1510.318) * (-1505.805) (-1505.074) [-1508.200] (-1514.628) -- 0:00:43
      686500 -- [-1512.265] (-1509.634) (-1506.707) (-1514.151) * (-1506.851) (-1509.606) [-1507.545] (-1508.398) -- 0:00:43
      687000 -- (-1513.031) (-1505.351) (-1512.054) [-1510.706] * (-1507.662) (-1512.777) [-1506.100] (-1506.135) -- 0:00:43
      687500 -- (-1513.053) (-1510.200) [-1508.978] (-1510.761) * (-1510.402) (-1508.044) [-1505.267] (-1505.540) -- 0:00:43
      688000 -- (-1509.121) (-1511.995) [-1509.524] (-1512.134) * (-1508.392) [-1509.477] (-1508.802) (-1513.119) -- 0:00:43
      688500 -- [-1504.499] (-1509.114) (-1504.507) (-1506.477) * (-1511.892) (-1523.562) [-1506.172] (-1507.228) -- 0:00:42
      689000 -- (-1506.353) (-1507.728) (-1510.646) [-1505.597] * [-1504.599] (-1509.168) (-1509.249) (-1512.344) -- 0:00:42
      689500 -- [-1505.561] (-1505.655) (-1515.109) (-1510.904) * [-1511.457] (-1511.452) (-1507.848) (-1505.196) -- 0:00:42
      690000 -- (-1514.460) (-1511.863) (-1507.039) [-1507.642] * (-1510.720) [-1507.863] (-1505.971) (-1509.217) -- 0:00:42

      Average standard deviation of split frequencies: 0.023206

      690500 -- (-1513.709) (-1512.385) (-1511.170) [-1506.422] * [-1507.602] (-1512.200) (-1508.082) (-1510.018) -- 0:00:42
      691000 -- (-1515.207) (-1512.518) (-1510.770) [-1505.586] * (-1507.110) (-1512.647) [-1507.593] (-1511.393) -- 0:00:42
      691500 -- (-1514.014) [-1509.466] (-1512.824) (-1509.357) * [-1513.487] (-1510.459) (-1512.729) (-1508.239) -- 0:00:42
      692000 -- (-1514.611) (-1515.478) [-1509.651] (-1510.601) * (-1511.905) [-1509.382] (-1508.892) (-1514.962) -- 0:00:42
      692500 -- (-1524.943) (-1514.227) (-1508.938) [-1509.166] * [-1510.420] (-1511.588) (-1508.318) (-1510.621) -- 0:00:42
      693000 -- (-1522.733) (-1516.255) [-1505.260] (-1507.456) * (-1513.896) (-1510.176) [-1505.534] (-1508.657) -- 0:00:42
      693500 -- (-1519.929) (-1508.665) [-1508.291] (-1518.669) * (-1511.715) (-1517.634) [-1509.300] (-1511.018) -- 0:00:42
      694000 -- (-1522.266) (-1511.430) (-1505.426) [-1509.357] * (-1516.708) (-1522.888) [-1508.027] (-1508.160) -- 0:00:42
      694500 -- (-1518.662) [-1507.189] (-1507.164) (-1512.115) * (-1513.593) (-1517.822) [-1511.950] (-1509.770) -- 0:00:42
      695000 -- (-1516.143) (-1509.530) (-1509.300) [-1505.411] * (-1508.698) (-1511.808) (-1512.073) [-1510.055] -- 0:00:42

      Average standard deviation of split frequencies: 0.024383

      695500 -- (-1524.205) [-1503.528] (-1509.137) (-1508.644) * (-1511.876) (-1511.816) [-1507.827] (-1506.618) -- 0:00:42
      696000 -- [-1513.953] (-1515.540) (-1508.484) (-1507.141) * (-1510.959) (-1509.493) [-1509.514] (-1511.387) -- 0:00:41
      696500 -- (-1507.912) (-1504.777) [-1510.812] (-1509.716) * (-1510.052) (-1510.265) (-1506.869) [-1509.938] -- 0:00:41
      697000 -- (-1516.025) [-1507.780] (-1507.570) (-1515.671) * (-1508.023) (-1510.636) (-1514.260) [-1508.143] -- 0:00:41
      697500 -- (-1513.987) [-1507.661] (-1510.022) (-1513.137) * (-1505.446) [-1506.231] (-1513.304) (-1510.467) -- 0:00:42
      698000 -- (-1509.027) (-1506.221) [-1506.904] (-1510.709) * [-1510.227] (-1506.565) (-1518.794) (-1512.689) -- 0:00:41
      698500 -- (-1508.859) (-1510.779) (-1506.316) [-1508.158] * (-1505.605) (-1508.016) [-1507.755] (-1512.525) -- 0:00:41
      699000 -- (-1505.725) [-1507.920] (-1508.448) (-1514.528) * [-1503.838] (-1512.136) (-1506.370) (-1508.929) -- 0:00:41
      699500 -- (-1512.153) (-1504.647) (-1514.589) [-1513.534] * [-1506.658] (-1512.828) (-1508.999) (-1509.091) -- 0:00:41
      700000 -- (-1507.296) (-1507.996) (-1509.995) [-1511.213] * (-1514.811) (-1505.807) (-1507.425) [-1504.673] -- 0:00:41

      Average standard deviation of split frequencies: 0.022539

      700500 -- (-1510.311) (-1513.498) (-1508.455) [-1512.082] * [-1511.998] (-1508.608) (-1508.672) (-1510.558) -- 0:00:41
      701000 -- (-1512.345) (-1509.932) [-1509.712] (-1509.361) * (-1513.197) [-1506.920] (-1508.613) (-1510.315) -- 0:00:41
      701500 -- (-1507.394) (-1509.748) (-1512.151) [-1508.178] * (-1511.383) (-1509.526) (-1508.885) [-1513.135] -- 0:00:41
      702000 -- [-1506.370] (-1506.617) (-1510.321) (-1511.124) * (-1507.951) (-1509.239) (-1509.534) [-1507.963] -- 0:00:41
      702500 -- (-1507.798) [-1510.180] (-1513.884) (-1505.877) * [-1510.202] (-1505.704) (-1509.550) (-1511.770) -- 0:00:41
      703000 -- (-1508.339) (-1508.057) [-1509.474] (-1509.941) * (-1510.749) (-1506.392) (-1505.253) [-1508.857] -- 0:00:40
      703500 -- [-1507.314] (-1506.795) (-1511.148) (-1507.276) * (-1509.322) (-1505.808) [-1505.644] (-1509.509) -- 0:00:40
      704000 -- (-1506.988) [-1512.567] (-1510.615) (-1514.080) * (-1507.929) (-1507.975) (-1512.291) [-1508.185] -- 0:00:41
      704500 -- (-1517.089) [-1508.476] (-1517.458) (-1510.702) * (-1512.467) (-1507.700) [-1508.516] (-1513.245) -- 0:00:41
      705000 -- (-1512.010) [-1510.346] (-1511.437) (-1511.597) * (-1511.772) [-1507.257] (-1513.073) (-1512.199) -- 0:00:41

      Average standard deviation of split frequencies: 0.018362

      705500 -- [-1506.672] (-1507.245) (-1512.893) (-1509.949) * (-1508.617) (-1510.062) (-1511.209) [-1507.098] -- 0:00:40
      706000 -- [-1512.560] (-1509.059) (-1510.845) (-1513.063) * (-1510.469) (-1505.465) (-1511.832) [-1510.966] -- 0:00:40
      706500 -- (-1510.575) (-1516.907) (-1513.174) [-1510.338] * (-1507.368) [-1504.305] (-1516.399) (-1505.341) -- 0:00:40
      707000 -- [-1507.537] (-1512.030) (-1508.237) (-1514.331) * [-1510.427] (-1508.594) (-1510.637) (-1509.909) -- 0:00:40
      707500 -- (-1511.431) (-1516.335) [-1508.195] (-1508.561) * (-1506.728) (-1510.271) (-1517.000) [-1509.338] -- 0:00:40
      708000 -- [-1508.919] (-1513.078) (-1506.764) (-1507.251) * [-1506.178] (-1506.804) (-1510.828) (-1505.941) -- 0:00:40
      708500 -- (-1510.773) [-1508.214] (-1506.420) (-1508.231) * (-1507.383) (-1510.757) (-1512.779) [-1505.781] -- 0:00:40
      709000 -- (-1507.262) [-1506.138] (-1509.440) (-1513.187) * (-1509.063) (-1516.025) (-1512.731) [-1510.677] -- 0:00:40
      709500 -- (-1512.251) (-1505.252) [-1510.268] (-1509.100) * (-1506.163) (-1508.392) (-1510.346) [-1514.650] -- 0:00:40
      710000 -- (-1512.293) [-1504.825] (-1518.790) (-1507.676) * (-1506.136) [-1508.185] (-1508.681) (-1519.240) -- 0:00:40

      Average standard deviation of split frequencies: 0.019236

      710500 -- [-1508.650] (-1504.300) (-1508.958) (-1508.401) * [-1506.704] (-1510.771) (-1509.563) (-1510.081) -- 0:00:40
      711000 -- (-1506.651) (-1508.316) [-1510.463] (-1513.464) * (-1509.266) (-1505.474) (-1507.107) [-1512.030] -- 0:00:40
      711500 -- (-1514.123) (-1508.329) [-1509.233] (-1510.060) * [-1516.197] (-1508.172) (-1509.965) (-1505.983) -- 0:00:40
      712000 -- (-1508.891) (-1511.349) [-1507.710] (-1509.764) * (-1509.480) [-1510.908] (-1508.593) (-1506.533) -- 0:00:40
      712500 -- [-1509.509] (-1507.105) (-1510.074) (-1506.971) * (-1513.495) [-1507.742] (-1508.513) (-1507.364) -- 0:00:39
      713000 -- (-1518.700) [-1507.336] (-1515.053) (-1510.526) * [-1510.183] (-1509.574) (-1511.472) (-1509.485) -- 0:00:39
      713500 -- (-1516.893) (-1511.000) [-1509.259] (-1508.406) * (-1509.720) (-1508.962) (-1512.385) [-1508.166] -- 0:00:39
      714000 -- (-1508.860) (-1504.719) (-1512.177) [-1506.799] * (-1508.842) (-1511.559) [-1518.924] (-1508.760) -- 0:00:39
      714500 -- (-1512.670) (-1508.860) [-1513.819] (-1509.811) * (-1507.637) (-1508.679) [-1509.735] (-1513.783) -- 0:00:39
      715000 -- (-1510.610) [-1506.040] (-1508.026) (-1511.080) * (-1507.563) (-1510.572) [-1504.420] (-1510.707) -- 0:00:39

      Average standard deviation of split frequencies: 0.019752

      715500 -- (-1514.342) (-1512.958) [-1504.995] (-1510.318) * [-1509.641] (-1508.478) (-1507.360) (-1507.394) -- 0:00:39
      716000 -- (-1511.878) (-1507.762) [-1510.574] (-1509.960) * (-1514.293) (-1511.860) [-1507.405] (-1505.644) -- 0:00:39
      716500 -- (-1510.907) [-1516.145] (-1513.223) (-1510.085) * (-1510.654) (-1511.504) (-1509.477) [-1506.888] -- 0:00:39
      717000 -- [-1510.941] (-1515.684) (-1511.808) (-1511.739) * (-1514.463) [-1505.283] (-1507.628) (-1504.830) -- 0:00:39
      717500 -- (-1513.508) (-1511.315) (-1512.679) [-1506.257] * (-1515.045) (-1526.973) (-1513.264) [-1505.320] -- 0:00:39
      718000 -- (-1516.364) (-1506.493) [-1506.977] (-1505.299) * (-1509.893) (-1513.752) [-1510.954] (-1510.274) -- 0:00:39
      718500 -- [-1513.082] (-1508.261) (-1508.764) (-1505.917) * (-1517.527) [-1507.109] (-1511.902) (-1505.446) -- 0:00:39
      719000 -- (-1513.002) [-1507.136] (-1507.740) (-1511.933) * (-1512.037) (-1510.614) [-1511.359] (-1511.120) -- 0:00:39
      719500 -- (-1517.000) (-1506.363) (-1506.475) [-1510.332] * [-1506.448] (-1506.852) (-1511.237) (-1508.948) -- 0:00:38
      720000 -- (-1512.045) (-1504.875) [-1506.170] (-1512.672) * [-1510.726] (-1511.815) (-1505.287) (-1508.841) -- 0:00:38

      Average standard deviation of split frequencies: 0.019297

      720500 -- (-1514.701) (-1504.998) (-1517.197) [-1511.301] * (-1506.539) (-1510.640) [-1506.960] (-1507.003) -- 0:00:38
      721000 -- (-1515.403) [-1507.291] (-1508.124) (-1507.003) * (-1504.153) (-1509.080) (-1514.457) [-1515.277] -- 0:00:38
      721500 -- (-1522.031) (-1509.421) (-1511.167) [-1504.599] * (-1507.409) (-1509.428) [-1506.902] (-1506.157) -- 0:00:38
      722000 -- (-1507.247) (-1509.217) [-1506.149] (-1510.355) * (-1506.851) (-1507.816) (-1511.493) [-1510.099] -- 0:00:38
      722500 -- (-1507.657) (-1511.143) (-1511.866) [-1506.116] * (-1512.782) (-1508.901) (-1513.467) [-1505.481] -- 0:00:38
      723000 -- (-1512.048) (-1510.052) [-1506.587] (-1509.489) * (-1512.921) (-1503.225) (-1506.888) [-1508.315] -- 0:00:38
      723500 -- [-1506.218] (-1512.553) (-1508.609) (-1508.308) * (-1507.096) [-1510.374] (-1507.835) (-1509.091) -- 0:00:38
      724000 -- [-1512.091] (-1506.362) (-1508.016) (-1508.398) * [-1507.895] (-1507.444) (-1508.384) (-1506.451) -- 0:00:38
      724500 -- [-1507.145] (-1510.030) (-1514.950) (-1515.161) * (-1514.064) (-1506.704) (-1509.497) [-1511.857] -- 0:00:38
      725000 -- (-1507.617) [-1507.754] (-1511.459) (-1506.641) * (-1507.348) [-1506.087] (-1517.274) (-1513.680) -- 0:00:38

      Average standard deviation of split frequencies: 0.022726

      725500 -- [-1504.569] (-1507.314) (-1512.461) (-1513.894) * (-1507.171) (-1505.712) [-1508.815] (-1509.414) -- 0:00:38
      726000 -- (-1509.623) (-1509.619) [-1507.119] (-1508.437) * (-1511.944) [-1506.341] (-1510.840) (-1508.454) -- 0:00:38
      726500 -- (-1506.769) [-1513.733] (-1508.381) (-1509.580) * (-1516.710) (-1510.889) [-1509.820] (-1512.826) -- 0:00:38
      727000 -- [-1506.206] (-1507.945) (-1505.385) (-1508.779) * (-1507.780) [-1510.081] (-1513.630) (-1508.206) -- 0:00:37
      727500 -- (-1509.620) (-1514.525) (-1511.245) [-1509.426] * [-1508.373] (-1510.080) (-1511.375) (-1507.118) -- 0:00:37
      728000 -- (-1509.055) [-1517.892] (-1512.920) (-1508.979) * (-1506.204) (-1510.523) (-1506.053) [-1511.127] -- 0:00:37
      728500 -- (-1505.570) (-1512.809) (-1507.828) [-1511.026] * (-1512.525) (-1508.809) (-1509.932) [-1508.969] -- 0:00:37
      729000 -- [-1505.499] (-1515.928) (-1505.587) (-1508.988) * [-1508.027] (-1509.018) (-1510.441) (-1508.909) -- 0:00:37
      729500 -- (-1508.378) (-1516.746) [-1505.269] (-1506.461) * (-1510.093) (-1510.454) [-1509.929] (-1508.834) -- 0:00:37
      730000 -- (-1510.224) [-1509.449] (-1509.516) (-1507.719) * (-1511.154) (-1512.479) (-1507.052) [-1510.050] -- 0:00:37

      Average standard deviation of split frequencies: 0.020645

      730500 -- (-1511.631) [-1506.979] (-1507.354) (-1514.209) * (-1510.031) (-1506.141) [-1509.436] (-1510.200) -- 0:00:37
      731000 -- (-1510.924) (-1508.474) [-1508.580] (-1512.164) * [-1507.323] (-1505.094) (-1505.590) (-1512.904) -- 0:00:37
      731500 -- (-1511.196) [-1507.877] (-1509.395) (-1508.113) * (-1514.081) [-1508.544] (-1514.367) (-1511.985) -- 0:00:37
      732000 -- (-1510.584) (-1510.602) (-1512.890) [-1506.626] * (-1513.752) (-1512.315) [-1508.026] (-1513.062) -- 0:00:37
      732500 -- (-1505.173) (-1512.185) (-1511.749) [-1509.557] * (-1507.941) (-1510.739) (-1504.607) [-1509.011] -- 0:00:37
      733000 -- (-1512.124) [-1511.662] (-1506.192) (-1507.855) * (-1507.564) (-1512.301) [-1506.615] (-1509.006) -- 0:00:37
      733500 -- (-1507.691) (-1506.787) [-1508.961] (-1512.147) * (-1508.529) (-1513.141) [-1508.975] (-1512.102) -- 0:00:37
      734000 -- [-1508.836] (-1517.992) (-1510.601) (-1506.974) * (-1509.198) (-1509.115) [-1506.369] (-1506.482) -- 0:00:36
      734500 -- (-1512.333) (-1510.348) (-1507.058) [-1509.674] * [-1504.705] (-1508.358) (-1511.924) (-1507.918) -- 0:00:36
      735000 -- (-1512.900) (-1509.288) [-1514.139] (-1507.868) * (-1509.760) [-1507.372] (-1515.601) (-1519.003) -- 0:00:36

      Average standard deviation of split frequencies: 0.019215

      735500 -- (-1514.482) (-1513.876) (-1513.830) [-1512.883] * (-1509.365) (-1510.805) [-1509.571] (-1515.424) -- 0:00:36
      736000 -- (-1507.316) (-1513.755) [-1507.809] (-1513.002) * (-1514.817) [-1511.119] (-1517.371) (-1509.332) -- 0:00:36
      736500 -- (-1511.788) (-1516.072) [-1511.457] (-1519.503) * (-1507.907) (-1512.811) (-1514.879) [-1505.505] -- 0:00:36
      737000 -- (-1508.822) [-1509.618] (-1509.701) (-1507.287) * (-1506.189) [-1508.516] (-1507.465) (-1510.967) -- 0:00:36
      737500 -- (-1505.691) (-1512.772) [-1510.917] (-1508.618) * (-1511.047) (-1507.102) [-1509.393] (-1509.449) -- 0:00:36
      738000 -- [-1506.345] (-1508.653) (-1511.886) (-1514.821) * [-1508.579] (-1510.343) (-1511.164) (-1510.908) -- 0:00:36
      738500 -- (-1511.397) (-1510.803) (-1505.514) [-1508.113] * (-1507.072) (-1511.571) (-1516.886) [-1515.462] -- 0:00:36
      739000 -- (-1507.432) [-1508.550] (-1511.988) (-1511.123) * (-1509.042) [-1507.290] (-1512.307) (-1515.595) -- 0:00:36
      739500 -- (-1512.660) (-1518.018) (-1514.037) [-1508.924] * (-1504.953) (-1507.173) (-1510.600) [-1505.417] -- 0:00:36
      740000 -- (-1508.660) (-1509.714) [-1511.177] (-1507.093) * [-1508.628] (-1513.556) (-1510.645) (-1511.584) -- 0:00:36

      Average standard deviation of split frequencies: 0.019094

      740500 -- (-1513.717) [-1507.650] (-1512.851) (-1506.212) * (-1508.004) [-1508.346] (-1507.796) (-1512.380) -- 0:00:36
      741000 -- [-1511.626] (-1507.833) (-1514.567) (-1510.887) * (-1513.153) [-1511.371] (-1509.059) (-1508.245) -- 0:00:36
      741500 -- (-1507.487) (-1509.427) [-1514.125] (-1507.941) * (-1511.611) [-1511.324] (-1511.133) (-1508.442) -- 0:00:35
      742000 -- (-1508.351) (-1511.517) [-1508.354] (-1506.008) * [-1506.929] (-1510.037) (-1510.004) (-1509.356) -- 0:00:35
      742500 -- [-1507.675] (-1511.762) (-1513.584) (-1505.374) * (-1513.924) (-1514.606) (-1508.625) [-1511.212] -- 0:00:35
      743000 -- (-1509.586) (-1510.375) [-1510.186] (-1514.783) * (-1511.596) (-1506.581) (-1510.622) [-1507.620] -- 0:00:35
      743500 -- (-1507.995) (-1509.053) [-1509.325] (-1516.844) * (-1516.208) (-1510.217) (-1508.890) [-1514.199] -- 0:00:35
      744000 -- (-1507.738) (-1504.586) [-1513.911] (-1512.420) * [-1512.140] (-1516.282) (-1506.564) (-1509.732) -- 0:00:35
      744500 -- (-1512.825) [-1508.055] (-1511.618) (-1515.712) * (-1506.922) [-1507.372] (-1510.561) (-1515.869) -- 0:00:35
      745000 -- (-1512.447) (-1505.472) [-1509.107] (-1507.999) * [-1504.040] (-1511.875) (-1510.167) (-1511.752) -- 0:00:35

      Average standard deviation of split frequencies: 0.018641

      745500 -- (-1512.724) (-1508.808) (-1511.706) [-1503.932] * [-1506.831] (-1516.053) (-1511.714) (-1512.353) -- 0:00:35
      746000 -- (-1510.910) (-1512.022) [-1511.017] (-1510.587) * (-1508.438) [-1507.269] (-1511.955) (-1508.902) -- 0:00:35
      746500 -- [-1504.774] (-1515.496) (-1513.833) (-1513.836) * (-1524.680) (-1507.626) (-1507.013) [-1512.365] -- 0:00:35
      747000 -- (-1509.961) (-1512.466) [-1505.750] (-1509.570) * (-1512.110) (-1510.995) (-1511.887) [-1509.055] -- 0:00:35
      747500 -- (-1506.801) [-1508.766] (-1516.776) (-1508.319) * (-1515.346) [-1509.171] (-1509.772) (-1509.037) -- 0:00:35
      748000 -- (-1510.702) [-1510.652] (-1512.891) (-1510.843) * (-1515.235) (-1520.149) (-1513.494) [-1509.450] -- 0:00:35
      748500 -- (-1514.457) (-1507.158) (-1515.377) [-1513.212] * [-1504.701] (-1525.521) (-1507.345) (-1507.332) -- 0:00:34
      749000 -- (-1506.680) (-1505.100) (-1511.421) [-1510.311] * (-1505.349) (-1522.622) [-1508.959] (-1510.931) -- 0:00:34
      749500 -- [-1505.358] (-1509.317) (-1510.032) (-1512.288) * (-1506.637) (-1512.577) [-1511.962] (-1510.046) -- 0:00:34
      750000 -- (-1506.463) (-1511.654) [-1509.758] (-1510.644) * (-1512.816) (-1515.324) [-1510.316] (-1508.759) -- 0:00:35

      Average standard deviation of split frequencies: 0.017897

      750500 -- (-1504.923) [-1513.846] (-1504.644) (-1508.586) * (-1511.353) (-1514.888) (-1509.337) [-1506.508] -- 0:00:34
      751000 -- (-1508.916) (-1511.684) [-1509.649] (-1509.932) * (-1504.956) [-1511.810] (-1506.796) (-1512.065) -- 0:00:34
      751500 -- [-1510.523] (-1512.991) (-1516.127) (-1504.822) * (-1512.961) (-1512.827) [-1510.070] (-1506.213) -- 0:00:34
      752000 -- (-1510.621) [-1509.910] (-1508.876) (-1506.717) * [-1509.690] (-1511.589) (-1506.664) (-1511.007) -- 0:00:34
      752500 -- (-1510.205) (-1504.216) (-1508.724) [-1511.669] * (-1513.388) (-1512.137) (-1513.261) [-1508.707] -- 0:00:34
      753000 -- (-1510.856) [-1507.757] (-1507.005) (-1514.748) * (-1511.798) (-1508.433) (-1510.212) [-1513.204] -- 0:00:34
      753500 -- (-1514.540) (-1509.267) (-1509.057) [-1507.629] * (-1514.701) (-1512.565) (-1508.337) [-1506.961] -- 0:00:34
      754000 -- (-1514.444) [-1507.823] (-1511.640) (-1507.308) * (-1509.389) [-1509.447] (-1514.556) (-1509.005) -- 0:00:34
      754500 -- (-1508.047) [-1509.135] (-1513.562) (-1504.649) * (-1507.228) (-1513.378) (-1509.969) [-1505.948] -- 0:00:34
      755000 -- (-1507.897) [-1504.953] (-1511.165) (-1513.999) * [-1505.962] (-1510.278) (-1508.004) (-1513.812) -- 0:00:34

      Average standard deviation of split frequencies: 0.015589

      755500 -- (-1513.121) (-1510.394) [-1507.536] (-1513.469) * [-1505.366] (-1508.016) (-1511.589) (-1506.559) -- 0:00:33
      756000 -- (-1513.414) (-1507.517) (-1505.769) [-1513.452] * [-1507.033] (-1510.895) (-1512.788) (-1513.936) -- 0:00:33
      756500 -- (-1514.737) (-1510.328) (-1514.413) [-1508.495] * [-1503.508] (-1511.979) (-1506.319) (-1508.042) -- 0:00:33
      757000 -- (-1511.347) (-1511.374) (-1510.621) [-1510.789] * (-1503.649) [-1512.746] (-1516.175) (-1514.738) -- 0:00:34
      757500 -- (-1507.594) (-1509.944) (-1509.449) [-1510.332] * (-1506.080) (-1509.342) [-1506.379] (-1507.197) -- 0:00:33
      758000 -- (-1505.958) (-1510.300) [-1508.511] (-1511.764) * (-1511.298) (-1512.348) (-1505.494) [-1511.647] -- 0:00:33
      758500 -- (-1510.707) [-1512.032] (-1506.790) (-1513.652) * (-1510.674) (-1509.735) (-1517.950) [-1505.154] -- 0:00:33
      759000 -- [-1509.657] (-1513.389) (-1513.021) (-1513.089) * (-1508.265) (-1510.643) (-1506.383) [-1505.519] -- 0:00:33
      759500 -- (-1518.995) (-1508.484) (-1514.069) [-1515.712] * [-1503.692] (-1509.719) (-1512.846) (-1506.190) -- 0:00:33
      760000 -- [-1507.296] (-1507.162) (-1511.860) (-1510.932) * (-1505.953) (-1510.631) [-1507.690] (-1511.754) -- 0:00:33

      Average standard deviation of split frequencies: 0.014873

      760500 -- (-1509.594) (-1511.028) [-1507.657] (-1514.793) * [-1506.620] (-1508.438) (-1509.716) (-1513.679) -- 0:00:33
      761000 -- (-1508.970) [-1510.812] (-1510.120) (-1510.459) * (-1507.688) (-1513.932) (-1508.201) [-1506.451] -- 0:00:33
      761500 -- (-1507.303) (-1516.509) (-1510.449) [-1510.589] * [-1506.244] (-1510.053) (-1510.224) (-1513.806) -- 0:00:33
      762000 -- (-1508.718) (-1512.226) [-1511.467] (-1509.047) * (-1507.987) [-1511.408] (-1507.060) (-1511.250) -- 0:00:33
      762500 -- (-1511.326) (-1506.083) [-1506.256] (-1511.300) * (-1511.450) (-1511.723) [-1513.897] (-1511.221) -- 0:00:33
      763000 -- (-1505.785) (-1513.658) [-1507.927] (-1513.870) * [-1510.998] (-1512.480) (-1510.329) (-1510.853) -- 0:00:32
      763500 -- (-1511.066) [-1509.781] (-1515.694) (-1518.360) * (-1513.029) (-1511.135) (-1506.673) [-1509.085] -- 0:00:33
      764000 -- [-1511.316] (-1506.996) (-1517.676) (-1508.185) * (-1514.784) [-1511.279] (-1509.062) (-1510.649) -- 0:00:33
      764500 -- [-1507.123] (-1511.371) (-1509.439) (-1507.961) * (-1511.727) (-1509.985) (-1506.184) [-1504.842] -- 0:00:32
      765000 -- (-1507.451) [-1507.532] (-1517.090) (-1510.299) * (-1509.290) [-1505.742] (-1506.926) (-1521.112) -- 0:00:32

      Average standard deviation of split frequencies: 0.015385

      765500 -- [-1507.757] (-1512.580) (-1507.702) (-1510.404) * (-1513.651) (-1510.781) [-1511.572] (-1510.229) -- 0:00:32
      766000 -- [-1507.141] (-1505.723) (-1518.749) (-1516.003) * (-1515.565) (-1506.319) [-1507.330] (-1507.292) -- 0:00:32
      766500 -- (-1507.180) (-1511.865) [-1508.147] (-1507.291) * (-1512.742) [-1513.473] (-1508.003) (-1507.251) -- 0:00:32
      767000 -- [-1506.081] (-1510.841) (-1508.537) (-1506.150) * (-1518.785) (-1512.531) (-1510.148) [-1508.319] -- 0:00:32
      767500 -- (-1510.006) [-1507.208] (-1512.836) (-1506.593) * (-1516.173) (-1509.710) (-1506.572) [-1508.849] -- 0:00:32
      768000 -- (-1510.137) [-1508.351] (-1511.462) (-1507.435) * (-1512.054) (-1510.284) (-1507.381) [-1513.562] -- 0:00:32
      768500 -- (-1508.361) (-1517.223) (-1512.933) [-1509.769] * [-1515.952] (-1509.543) (-1507.238) (-1508.909) -- 0:00:32
      769000 -- (-1512.561) (-1511.731) [-1514.068] (-1507.574) * [-1511.014] (-1509.556) (-1509.894) (-1509.055) -- 0:00:32
      769500 -- [-1509.995] (-1514.261) (-1512.405) (-1508.495) * (-1513.791) (-1507.913) (-1507.131) [-1507.841] -- 0:00:32
      770000 -- (-1508.860) (-1515.711) [-1510.396] (-1514.653) * (-1515.784) (-1509.199) [-1509.962] (-1509.398) -- 0:00:32

      Average standard deviation of split frequencies: 0.013151

      770500 -- (-1506.237) (-1509.676) [-1508.867] (-1509.604) * (-1504.794) (-1508.894) (-1509.171) [-1505.619] -- 0:00:32
      771000 -- (-1508.526) (-1505.469) (-1508.967) [-1506.896] * (-1510.666) [-1508.926] (-1514.864) (-1508.551) -- 0:00:32
      771500 -- [-1511.212] (-1508.917) (-1508.034) (-1510.983) * (-1510.604) [-1512.464] (-1513.355) (-1508.302) -- 0:00:31
      772000 -- (-1510.833) (-1508.909) (-1515.705) [-1506.821] * [-1514.887] (-1505.976) (-1514.726) (-1508.237) -- 0:00:31
      772500 -- (-1514.665) (-1511.108) (-1511.130) [-1509.825] * (-1510.917) (-1509.045) [-1505.681] (-1513.841) -- 0:00:31
      773000 -- (-1511.303) (-1511.857) [-1512.657] (-1508.560) * (-1512.354) (-1509.656) [-1510.020] (-1509.652) -- 0:00:31
      773500 -- [-1506.308] (-1511.058) (-1513.864) (-1509.760) * (-1509.876) [-1508.242] (-1516.840) (-1507.475) -- 0:00:31
      774000 -- (-1506.096) (-1511.018) (-1518.301) [-1510.180] * (-1507.560) (-1511.576) [-1507.332] (-1519.730) -- 0:00:31
      774500 -- [-1507.864] (-1511.750) (-1510.290) (-1514.187) * (-1513.691) [-1507.561] (-1505.586) (-1518.162) -- 0:00:31
      775000 -- [-1507.386] (-1504.701) (-1514.748) (-1508.048) * (-1507.549) [-1508.678] (-1510.427) (-1511.668) -- 0:00:31

      Average standard deviation of split frequencies: 0.013972

      775500 -- (-1512.844) [-1508.455] (-1512.717) (-1506.125) * [-1510.004] (-1514.045) (-1511.687) (-1513.350) -- 0:00:31
      776000 -- (-1520.445) (-1511.166) [-1505.998] (-1505.329) * (-1508.663) (-1509.203) (-1510.700) [-1503.911] -- 0:00:31
      776500 -- (-1519.192) [-1508.218] (-1505.621) (-1509.009) * (-1509.554) (-1511.037) [-1506.676] (-1505.682) -- 0:00:31
      777000 -- (-1513.666) (-1508.497) (-1511.364) [-1505.360] * (-1514.558) [-1511.233] (-1509.946) (-1510.818) -- 0:00:31
      777500 -- [-1514.267] (-1503.192) (-1508.256) (-1506.352) * (-1512.048) (-1514.614) [-1508.074] (-1503.772) -- 0:00:31
      778000 -- [-1509.798] (-1503.735) (-1509.348) (-1513.808) * (-1511.177) [-1518.467] (-1509.735) (-1509.079) -- 0:00:31
      778500 -- (-1507.244) [-1507.375] (-1506.684) (-1507.687) * (-1510.093) [-1515.192] (-1511.774) (-1519.910) -- 0:00:31
      779000 -- (-1509.668) (-1507.873) [-1505.262] (-1508.958) * (-1506.678) (-1512.658) [-1512.916] (-1511.412) -- 0:00:30
      779500 -- (-1506.654) (-1503.407) (-1511.168) [-1510.412] * (-1506.955) (-1511.017) (-1508.131) [-1513.027] -- 0:00:30
      780000 -- [-1506.192] (-1517.368) (-1508.171) (-1515.836) * (-1511.799) [-1509.678] (-1508.576) (-1506.132) -- 0:00:30

      Average standard deviation of split frequencies: 0.013889

      780500 -- (-1506.068) (-1506.659) [-1510.355] (-1511.945) * (-1511.844) (-1505.468) (-1506.971) [-1508.408] -- 0:00:30
      781000 -- [-1507.484] (-1508.084) (-1508.724) (-1507.461) * (-1517.160) [-1510.043] (-1507.841) (-1507.710) -- 0:00:30
      781500 -- (-1504.392) (-1505.252) (-1512.280) [-1511.203] * [-1513.253] (-1510.465) (-1504.660) (-1510.538) -- 0:00:30
      782000 -- (-1512.649) (-1511.403) (-1518.946) [-1509.910] * [-1509.588] (-1514.782) (-1507.583) (-1520.249) -- 0:00:30
      782500 -- (-1511.912) (-1510.958) (-1510.533) [-1508.758] * (-1506.626) [-1511.457] (-1509.511) (-1515.563) -- 0:00:30
      783000 -- (-1519.191) [-1507.632] (-1514.046) (-1505.965) * [-1514.946] (-1510.354) (-1518.944) (-1518.694) -- 0:00:30
      783500 -- (-1515.699) (-1515.135) [-1504.940] (-1520.774) * [-1507.182] (-1510.886) (-1508.849) (-1518.615) -- 0:00:30
      784000 -- (-1508.908) (-1510.171) (-1514.607) [-1507.275] * [-1509.273] (-1507.484) (-1503.848) (-1511.303) -- 0:00:30
      784500 -- (-1508.728) [-1503.124] (-1510.131) (-1513.436) * [-1512.480] (-1508.051) (-1509.054) (-1511.666) -- 0:00:30
      785000 -- (-1511.585) (-1507.127) [-1508.157] (-1516.005) * (-1511.419) [-1504.620] (-1513.475) (-1507.028) -- 0:00:30

      Average standard deviation of split frequencies: 0.014394

      785500 -- (-1514.249) [-1511.922] (-1506.975) (-1523.151) * (-1506.023) (-1507.138) (-1510.319) [-1509.764] -- 0:00:30
      786000 -- (-1512.414) (-1508.906) [-1506.117] (-1513.238) * (-1507.767) [-1506.583] (-1513.343) (-1510.138) -- 0:00:29
      786500 -- (-1510.952) [-1506.583] (-1511.712) (-1510.144) * (-1508.578) [-1504.434] (-1513.380) (-1515.505) -- 0:00:29
      787000 -- [-1509.589] (-1510.097) (-1503.458) (-1509.817) * [-1508.919] (-1516.299) (-1511.233) (-1512.400) -- 0:00:29
      787500 -- [-1508.939] (-1511.638) (-1508.508) (-1512.567) * (-1508.715) [-1510.055] (-1509.648) (-1507.604) -- 0:00:29
      788000 -- (-1513.372) (-1507.439) [-1506.364] (-1510.124) * (-1509.266) (-1512.560) [-1507.553] (-1512.646) -- 0:00:29
      788500 -- (-1507.881) (-1513.510) (-1513.937) [-1509.310] * [-1506.020] (-1511.587) (-1505.906) (-1517.374) -- 0:00:29
      789000 -- (-1509.363) [-1505.672] (-1507.585) (-1510.565) * [-1506.589] (-1506.405) (-1505.699) (-1508.059) -- 0:00:29
      789500 -- (-1507.449) (-1509.415) (-1505.162) [-1505.044] * (-1512.455) [-1509.387] (-1505.245) (-1512.122) -- 0:00:29
      790000 -- [-1506.382] (-1513.548) (-1514.143) (-1516.626) * (-1505.691) [-1511.193] (-1507.721) (-1508.184) -- 0:00:29

      Average standard deviation of split frequencies: 0.014905

      790500 -- [-1505.843] (-1512.011) (-1520.349) (-1512.408) * (-1506.836) (-1516.581) [-1511.421] (-1513.628) -- 0:00:29
      791000 -- [-1506.513] (-1511.796) (-1515.585) (-1510.383) * (-1508.389) (-1511.236) [-1511.280] (-1509.691) -- 0:00:29
      791500 -- (-1512.178) [-1509.320] (-1510.772) (-1525.238) * (-1508.993) [-1507.867] (-1512.599) (-1512.602) -- 0:00:29
      792000 -- [-1506.582] (-1513.851) (-1515.123) (-1511.996) * (-1508.834) (-1512.988) (-1510.051) [-1506.693] -- 0:00:29
      792500 -- [-1507.147] (-1506.931) (-1517.552) (-1504.751) * [-1506.749] (-1513.576) (-1510.867) (-1506.374) -- 0:00:29
      793000 -- (-1511.767) (-1509.054) [-1504.614] (-1509.269) * (-1509.033) [-1514.339] (-1508.242) (-1506.665) -- 0:00:28
      793500 -- (-1509.361) (-1512.560) (-1505.530) [-1505.321] * (-1506.796) [-1510.661] (-1509.444) (-1514.347) -- 0:00:28
      794000 -- (-1517.012) (-1505.842) (-1512.485) [-1505.046] * (-1508.402) (-1506.952) (-1507.347) [-1508.024] -- 0:00:28
      794500 -- (-1513.706) (-1513.492) (-1512.929) [-1506.482] * (-1505.927) (-1510.205) [-1507.201] (-1510.996) -- 0:00:28
      795000 -- (-1511.888) [-1508.416] (-1507.577) (-1514.325) * (-1512.929) [-1508.983] (-1508.046) (-1506.128) -- 0:00:28

      Average standard deviation of split frequencies: 0.014509

      795500 -- (-1519.641) [-1508.264] (-1507.369) (-1507.311) * (-1506.195) (-1512.769) [-1507.145] (-1507.861) -- 0:00:28
      796000 -- (-1511.362) [-1507.767] (-1512.427) (-1511.919) * (-1508.967) (-1504.803) (-1510.271) [-1506.642] -- 0:00:28
      796500 -- [-1506.210] (-1506.024) (-1516.373) (-1513.218) * (-1511.039) (-1508.508) (-1513.322) [-1507.828] -- 0:00:28
      797000 -- [-1507.151] (-1506.635) (-1508.603) (-1512.047) * [-1510.862] (-1505.716) (-1512.250) (-1511.771) -- 0:00:28
      797500 -- (-1508.920) (-1519.011) [-1509.397] (-1505.944) * (-1513.004) [-1512.275] (-1505.000) (-1509.437) -- 0:00:28
      798000 -- (-1506.278) (-1507.411) [-1506.800] (-1511.408) * (-1515.464) (-1509.985) [-1507.172] (-1509.074) -- 0:00:28
      798500 -- (-1509.395) [-1514.116] (-1507.999) (-1