--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Nov 22 06:20:27 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/3/Acp32CD-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1506.27 -1514.69
2 -1506.53 -1514.86
--------------------------------------
TOTAL -1506.39 -1514.78
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.252387 0.003678 0.151895 0.373944 0.243768 1021.00 1142.94 1.000
r(A<->C){all} 0.131809 0.002224 0.045839 0.223297 0.127497 790.78 860.67 1.000
r(A<->G){all} 0.168353 0.002592 0.076695 0.266294 0.163026 901.31 960.42 1.000
r(A<->T){all} 0.084589 0.002439 0.003556 0.175050 0.077775 952.94 955.71 1.000
r(C<->G){all} 0.027743 0.000535 0.000001 0.073973 0.021818 849.71 982.55 1.000
r(C<->T){all} 0.420456 0.006083 0.281410 0.581248 0.418123 663.09 828.14 1.000
r(G<->T){all} 0.167050 0.002576 0.069914 0.259796 0.162658 1011.87 1138.42 1.000
pi(A){all} 0.245924 0.000227 0.217041 0.274699 0.245829 1416.84 1433.73 1.000
pi(C){all} 0.264489 0.000217 0.234881 0.291627 0.264310 1283.26 1365.28 1.000
pi(G){all} 0.333021 0.000263 0.304681 0.366913 0.332981 1297.41 1303.89 1.000
pi(T){all} 0.156566 0.000149 0.132433 0.180000 0.156183 1327.24 1377.41 1.000
alpha{1,2} 0.120116 0.013610 0.000119 0.314541 0.092237 1129.48 1304.32 1.000
alpha{3} 0.991351 0.320546 0.202877 2.166851 0.859633 1003.38 1168.65 1.000
pinvar{all} 0.438533 0.018065 0.162445 0.687206 0.453138 1016.73 1099.08 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1367.619309
Model 2: PositiveSelection -1361.945148
Model 0: one-ratio -1384.388692
Model 3: discrete -1361.945148
Model 7: beta -1367.73075
Model 8: beta&w>1 -1361.945575
Model 0 vs 1 33.53876600000012
Model 2 vs 1 11.348321999999825
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp32CD-PA)
Pr(w>1) post mean +- SE for w
20 Q 0.564 2.730
54 G 0.533 2.588
62 P 0.517 2.510
65 G 0.766 3.679
66 T 0.605 2.924
67 G 0.708 3.406
69 H 0.983* 4.695
81 N 0.985* 4.706
101 I 0.988* 4.720
105 E 0.999** 4.767
108 G 0.990* 4.726
112 G 0.981* 4.687
113 K 0.973* 4.648
116 S 0.578 2.797
147 Q 0.990* 4.726
148 D 0.999** 4.769
153 G 0.995** 4.750
154 Q 0.983* 4.693
215 D 1.000** 4.772
219 V 0.552 2.676
226 Q 0.991** 4.731
241 E 0.733 3.524
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp32CD-PA)
Pr(w>1) post mean +- SE for w
65 G 0.553 3.600 +- 3.067
69 H 0.768 4.945 +- 2.864
81 N 0.811 5.243 +- 2.816
101 I 0.819 5.272 +- 2.781
105 E 0.893 5.716 +- 2.574
108 G 0.860 5.558 +- 2.704
112 G 0.744 4.779 +- 2.878
113 K 0.724 4.699 +- 2.935
147 Q 0.841 5.415 +- 2.741
148 D 0.966* 6.193 +- 2.297
153 G 0.915 5.894 +- 2.524
154 Q 0.762 4.899 +- 2.866
215 D 0.948 6.078 +- 2.380
226 Q 0.858 5.534 +- 2.701
Model 8 vs 7 11.570349999999962
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp32CD-PA)
Pr(w>1) post mean +- SE for w
20 Q 0.562 2.730
54 G 0.532 2.588
62 P 0.515 2.510
65 G 0.765 3.679
66 T 0.604 2.924
67 G 0.707 3.405
69 H 0.982* 4.693
81 N 0.984* 4.704
101 I 0.987* 4.719
105 E 0.998** 4.771
108 G 0.989* 4.726
112 G 0.980* 4.685
113 K 0.971* 4.643
116 S 0.576 2.797
147 Q 0.989* 4.726
148 D 0.999** 4.773
153 G 0.994** 4.752
154 Q 0.981* 4.691
215 D 0.999** 4.776
219 V 0.551 2.675
226 Q 0.990* 4.731
241 E 0.731 3.519
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp32CD-PA)
Pr(w>1) post mean +- SE for w
65 G 0.554 3.502 +- 3.219
69 H 0.819 5.250 +- 2.976
81 N 0.859 5.548 +- 2.892
101 I 0.867 5.587 +- 2.853
105 E 0.940 6.075 +- 2.563
108 G 0.901 5.844 +- 2.751
112 G 0.795 5.074 +- 3.010
113 K 0.774 4.967 +- 3.078
147 Q 0.886 5.722 +- 2.798
148 D 0.983* 6.375 +- 2.352
153 G 0.946 6.141 +- 2.555
154 Q 0.812 5.198 +- 2.984
215 D 0.975* 6.321 +- 2.394
226 Q 0.901 5.830 +- 2.748
>C1
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGTGDSPHSQEGDGSAATDNPNDDHATSADNSLAT
DGDAIGKKESGGGSDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKDR
QDKEEEAGQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSGS
NAGSNQRDNGARESSQENQDAKEVASEAPAQRAGNVPDGPETGAKEDDYE
EMoo
>C2
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGPGDHSQDGDGSAATDSPNDDHATSADNSLATDG
DAIGKKESGNGSDGKSDAKDSSGGNDATPANGHDDDNDDSDSKDAKDRKS
KEEEAGQEGKRNDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSGSNA
GSNQRDNGARESSQENQEAKEVVSEAPAQRAALAAGNVPDGPETGAKDDD
YEEM
>C3
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGPGDRSQDGDGSAATDSPNDDHATSADNSLATDG
DAIGKKESGNGSDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKDRKS
KEEEAVQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSGSNA
GSNQRDNGARESSQENQDAKEVASEAPAQRAALAAGNVPDGPETGAKDDD
YEEM
>C4
MWRMRMRLLTGYLVLLALGHLPEHGALGQKYYMNFAFNNNNPDGEGGTGA
DGGAAGGGPAGAGGATSDRSQEGDGSAATDRPNDDHATSADNSLATDGDA
GDKKSSGDGKSDSDSDSKDSSGGNAATPANGHDDDNDDSDSKDVKDRHSK
EDAAAEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSGSNAGS
NQRDSGARDSSQETQTAKEMASEAPAARAPRVAGNVPDGPETGAKEDDYE
EMoo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=259
C1 MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
C2 MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
C3 MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
C4 MWRMRMRLLTGYLVLLALGHLPEHGALGQKYYMNFAFNNNNPDGEGGTGA
*******************:*****************************.
C1 DGGGGGAGGGAAGPGGGTGDSPHSQEGDGSAATDNPNDDHATSADNSLAT
C2 DGGGGGAGGGAAGPGGGPGD--HSQDGDGSAATDSPNDDHATSADNSLAT
C3 DGGGGGAGGGAAGPGGGPGD--RSQDGDGSAATDSPNDDHATSADNSLAT
C4 DG--GAAGGGPAGAGGATSD--RSQEGDGSAATDRPNDDHATSADNSLAT
** *.****.**.**...* :**:******** ***************
C1 DGDAIGKKESGGG-SDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD
C2 DGDAIGKKESGNG-SDGKSDAKDSSGGNDATPANGHDDDNDDSDSKDAKD
C3 DGDAIGKKESGNG-SDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD
C4 DGDAGDKKSSGDGKSDSDSDSKDSSGGNAATPANGHDDDNDDSDSKDVKD
**** .**.**.* **..**:******* ******************.**
C1 RQDKEEEAGQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
C2 RKSKEEEAGQEGKRNDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
C3 RKSKEEEAVQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
C4 RHSKED-AAAEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
*:.**: * ****.***********************************
C1 SNAGSNQRDNGARESSQENQDAKEVASEAPAQR----AGNVPDGPETGAK
C2 SNAGSNQRDNGARESSQENQEAKEVVSEAPAQRAALAAGNVPDGPETGAK
C3 SNAGSNQRDNGARESSQENQDAKEVASEAPAQRAALAAGNVPDGPETGAK
C4 SNAGSNQRDSGARDSSQETQTAKEMASEAPAARAPRVAGNVPDGPETGAK
*********.***:****.* ***:.***** * *************
C1 EDDYEEMoo
C2 DDDYEEM--
C3 DDDYEEM--
C4 EDDYEEMoo
:******
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 254 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 254 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3286]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [3286]--->[3230]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.228 Mb, Max= 30.475 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGTGDSPHSQEGDGSAATDNPNDDHATSADNSLAT
DGDAIGKKESGGG-SDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD
RQDKEEEAGQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDNGARESSQENQDAKEVASEAPAQR----AGNVPDGPETGAK
EDDYEEMoo
>C2
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGPGD--HSQDGDGSAATDSPNDDHATSADNSLAT
DGDAIGKKESGNG-SDGKSDAKDSSGGNDATPANGHDDDNDDSDSKDAKD
RKSKEEEAGQEGKRNDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDNGARESSQENQEAKEVVSEAPAQRAALAAGNVPDGPETGAK
DDDYEEM--
>C3
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGPGD--RSQDGDGSAATDSPNDDHATSADNSLAT
DGDAIGKKESGNG-SDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD
RKSKEEEAVQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDNGARESSQENQDAKEVASEAPAQRAALAAGNVPDGPETGAK
DDDYEEM--
>C4
MWRMRMRLLTGYLVLLALGHLPEHGALGQKYYMNFAFNNNNPDGEGGTGA
DG--GAAGGGPAGAGGATSD--RSQEGDGSAATDRPNDDHATSADNSLAT
DGDAGDKKSSGDGKSDSDSDSKDSSGGNAATPANGHDDDNDDSDSKDVKD
RHSKED-AAAEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDSGARDSSQETQTAKEMASEAPAARAPRVAGNVPDGPETGAK
EDDYEEMoo
FORMAT of file /tmp/tmp5728493890385587781aln Not Supported[FATAL:T-COFFEE]
>C1
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGTGDSPHSQEGDGSAATDNPNDDHATSADNSLAT
DGDAIGKKESGGG-SDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD
RQDKEEEAGQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDNGARESSQENQDAKEVASEAPAQR----AGNVPDGPETGAK
EDDYEEMoo
>C2
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGPGD--HSQDGDGSAATDSPNDDHATSADNSLAT
DGDAIGKKESGNG-SDGKSDAKDSSGGNDATPANGHDDDNDDSDSKDAKD
RKSKEEEAGQEGKRNDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDNGARESSQENQEAKEVVSEAPAQRAALAAGNVPDGPETGAK
DDDYEEM--
>C3
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGPGD--RSQDGDGSAATDSPNDDHATSADNSLAT
DGDAIGKKESGNG-SDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD
RKSKEEEAVQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDNGARESSQENQDAKEVASEAPAQRAALAAGNVPDGPETGAK
DDDYEEM--
>C4
MWRMRMRLLTGYLVLLALGHLPEHGALGQKYYMNFAFNNNNPDGEGGTGA
DG--GAAGGGPAGAGGATSD--RSQEGDGSAATDRPNDDHATSADNSLAT
DGDAGDKKSSGDGKSDSDSDSKDSSGGNAATPANGHDDDNDDSDSKDVKD
RHSKED-AAAEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDSGARDSSQETQTAKEMASEAPAARAPRVAGNVPDGPETGAK
EDDYEEMoo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:259 S:98 BS:259
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES
BOT 0 1 95.60 C1 C2 95.60
TOP 1 0 95.60 C2 C1 95.60
BOT 0 2 96.40 C1 C3 96.40
TOP 2 0 96.40 C3 C1 96.40
BOT 0 3 88.76 C1 C4 88.76
TOP 3 0 88.76 C4 C1 88.76
BOT 1 2 97.64 C2 C3 97.64
TOP 2 1 97.64 C3 C2 97.64
BOT 1 3 85.66 C2 C4 85.66
TOP 3 1 85.66 C4 C2 85.66
BOT 2 3 87.25 C3 C4 87.25
TOP 3 2 87.25 C4 C3 87.25
AVG 0 C1 * 93.58
AVG 1 C2 * 92.97
AVG 2 C3 * 93.76
AVG 3 C4 * 87.22
TOT TOT * 91.88
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC
C2 ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC
C3 ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC
C4 ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC
**************************************************
C1 CCTCGGCCAACTGCCGGAGCATGGCGCTCTGGGCCAGAAGTACTACATGA
C2 CCTCGGCCAACTGCCGGAGCATGGCGCTCTGGGCCAGAAGTATTACATGA
C3 CCTCGGCCAACTGCCGGAGCATGGCGCTCTGGGCCAGAAGTATTACATGA
C4 CCTCGGCCATCTGCCGGAGCATGGCGCTCTGGGCCAGAAGTACTACATGA
*********:******************************** *******
C1 ACTTTGCCTTCAACAACAATAATCCGGATGGCGAAGGAGGCACCGGCGTC
C2 ACTTTGCCTTCAACAACAATAATCCGGATGGCGAAGGAGGCACCGGCGTC
C3 ACTTTGCCTTCAACAACAATAATCCGGATGGCGAAGGAGGCACCGGCGTC
C4 ACTTCGCCTTCAACAACAATAATCCGGATGGAGAAGGAGGCACCGGCGCC
**** **************************.**************** *
C1 GATGGTGGCGGTGGTGGTGCTGGTGGTGGTGCCGCTGGTCCCGGCGGTGG
C2 GATGGTGGCGGTGGTGGTGCTGGTGGTGGTGCCGCTGGTCCCGGCGGTGG
C3 GATGGTGGCGGTGGTGGTGCTGGCGGTGGTGCCGCTGGTCCCGGCGGTGG
C4 GATGGT------GGCGCTGCTGGTGGTGGTCCCGCTGGTGCCGGTGGTGC
****** ** * ****** ****** ******** **** ****
C1 AACCGGGGATTCGCCTCATTCACAAGAAGGTGACGGTAGTGCTGCGACGG
C2 ACCCGGGGAT------CATTCACAAGATGGTGACGGTAGTGCTGCGACGG
C3 ACCCGGTGAT------CGTTCACAAGATGGTGACGGTAGTGCTGCGACGG
C4 AACCAGTGAT------CGTTCACAAGAAGGTGACGGTAGTGCGGCGACGG
*.**.* *** *.*********:************** *******
C1 ATAACCCCAATGACGACCACGCTACATCTGCTGATAATAGTTTGGCTACC
C2 ATAGCCCCAATGACGACCACGCTACATCTGCTGATAATAGTTTGGCTACT
C3 ATAGCCCCAATGACGACCACGCTACATCTGCTGATAATAGTTTGGCTACT
C4 ATCGTCCCAATGACGACCACGCTACATCCGCTGATAATAGTTTGGCTACT
**.. *********************** ********************
C1 GATGGCGATGCCATTGGTAAGAAGGAAAGCGGCGGTGGT---AGCGATGG
C2 GATGGCGATGCCATTGGTAAGAAGGAAAGCGGCAATGGT---AGCGATGG
C3 GATGGCGATGCCATTGGTAAGAAGGAAAGCGGCAATGGT---AGCGATGG
C4 GATGGCGATGCCGGTGATAAGAAAAGTAGTGGAGATGGCAAGAGCGACTC
************. **.******...:** **...*** *****
C1 CAAGAGCGACTCCAAAGACTCGAGCGGAGGCAATGATGCCACGCCAGCGA
C2 CAAAAGCGACGCCAAAGACTCGAGCGGAGGCAATGATGCCACGCCAGCGA
C3 CAAAAGCGACTCCAAAGACTCGAGCGGAGGCAATGATGCCACGCCAGCGA
C4 CGACAGCGATTCCAAAGACTCGAGCGGAGGCAATGCTGCCACGCCAGCGA
*.* ***** ************************.**************
C1 ATGGTCATGACGATGACAACGATGACAGCGACAGCAAGGATGCCAAGGAT
C2 ATGGTCATGACGATGACAACGATGACAGCGACAGCAAGGATGCCAAGGAT
C3 ATGGTCATGACGATGACAACGATGACAGCGACAGCAAGGATGCCAAGGAT
C4 ATGGTCATGACGATGATAACGATGACAGCGACAGCAAGGATGTCAAGGAT
**************** ************************* *******
C1 CGACAAGATAAGGAAGAGGAGGCCGGACAGGAGGGGAAGCGCACCGATCA
C2 CGAAAATCGAAGGAGGAGGAGGCCGGACAGGAGGGGAAGCGCAACGATCA
C3 CGAAAATCGAAGGAGGAGGAGGCCGTACAGGAGGGGAAGCGCACCGATCA
C4 CGGCATTCGAAGGAGGAT---GCCGCAGCGGAGGGTAAACGCACCGATCA
**..*: . *****.** **** * .****** **.****.******
C1 CAGCCATCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC
C2 CAGCCATCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC
C3 CAGCCATCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC
C4 CAGCCACCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC
****** *******************************************
C1 GGTACGTGCGGTCCATTTACGAGAGCAGCGAGAGCCACGGACATTCCGGC
C2 GGTACGTGCGGTCCATTTACGAGAGCAGCGAGAGCCACGGACATTCCGGC
C3 GGTACGTGCGGTCCATTTACGAGAGCAGCGAGAGCCACGGACATTCCGGC
C4 GCTACGTGCGCTCCATTTACGAGAGCAGCGAGAGCCACGGCCACTCCGGC
* ******** *****************************.** ******
C1 AGCAATGCCGGCTCCAATCAGCGGGACAATGGAGCCCGTGAGAGCAGTCA
C2 AGCAATGCCGGCTCCAATCAGCGGGACAACGGAGCCCGTGAGAGCAGTCA
C3 AGCAATGCCGGCTCCAATCAGCGGGACAACGGAGCCCGTGAGAGCAGTCA
C4 AGCAATGCCGGCTCCAATCAGCGGGACAGCGGAGCCCGCGATAGCAGTCA
****************************. ******** ** ********
C1 GGAGAACCAGGATGCCAAGGAAGTGGCCAGCGAAGCGCCTGCTCAACGG-
C2 GGAGAACCAGGAGGCCAAGGAAGTGGTTAGCGAAGCGCCTGCTCAACGGG
C3 GGAGAACCAGGATGCCAAGGAAGTGGCCAGCGAAGCGCCTGCTCAACGGG
C4 GGAGACCCAGACCGCCAAGGAAATGGCCAGTGAAGCCCCTGCTGCACGGG
*****.****.. *********.*** ** ***** ****** .****
C1 -----------GCAGGCAACGTGCCAGATGGACCCGAAACTGGAGCCAAG
C2 CAGCTCTCGCCGCTGGCAATGTGCCGGATGGACCCGAAACTGGAGCCAAG
C3 CAGCTCTCGCCGCTGGCAATGTGCCGGATGGACCCGAAACTGGAGCCAAG
C4 CACCTCGCGTCGCTGGCAACGTGCCGGATGGGCCCGAAACTGGAGCCAAG
**:***** *****.*****.******************
C1 GAAGATGACTACGAGGAGATG------
C2 GACGATGACTACGAGGAGATG------
C3 GACGATGACTACGAGGAGATG------
C4 GAGGATGACTACGAGGAAATG------
** **************.***
>C1
ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC
CCTCGGCCAACTGCCGGAGCATGGCGCTCTGGGCCAGAAGTACTACATGA
ACTTTGCCTTCAACAACAATAATCCGGATGGCGAAGGAGGCACCGGCGTC
GATGGTGGCGGTGGTGGTGCTGGTGGTGGTGCCGCTGGTCCCGGCGGTGG
AACCGGGGATTCGCCTCATTCACAAGAAGGTGACGGTAGTGCTGCGACGG
ATAACCCCAATGACGACCACGCTACATCTGCTGATAATAGTTTGGCTACC
GATGGCGATGCCATTGGTAAGAAGGAAAGCGGCGGTGGT---AGCGATGG
CAAGAGCGACTCCAAAGACTCGAGCGGAGGCAATGATGCCACGCCAGCGA
ATGGTCATGACGATGACAACGATGACAGCGACAGCAAGGATGCCAAGGAT
CGACAAGATAAGGAAGAGGAGGCCGGACAGGAGGGGAAGCGCACCGATCA
CAGCCATCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC
GGTACGTGCGGTCCATTTACGAGAGCAGCGAGAGCCACGGACATTCCGGC
AGCAATGCCGGCTCCAATCAGCGGGACAATGGAGCCCGTGAGAGCAGTCA
GGAGAACCAGGATGCCAAGGAAGTGGCCAGCGAAGCGCCTGCTCAACGG-
-----------GCAGGCAACGTGCCAGATGGACCCGAAACTGGAGCCAAG
GAAGATGACTACGAGGAGATG------
>C2
ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC
CCTCGGCCAACTGCCGGAGCATGGCGCTCTGGGCCAGAAGTATTACATGA
ACTTTGCCTTCAACAACAATAATCCGGATGGCGAAGGAGGCACCGGCGTC
GATGGTGGCGGTGGTGGTGCTGGTGGTGGTGCCGCTGGTCCCGGCGGTGG
ACCCGGGGAT------CATTCACAAGATGGTGACGGTAGTGCTGCGACGG
ATAGCCCCAATGACGACCACGCTACATCTGCTGATAATAGTTTGGCTACT
GATGGCGATGCCATTGGTAAGAAGGAAAGCGGCAATGGT---AGCGATGG
CAAAAGCGACGCCAAAGACTCGAGCGGAGGCAATGATGCCACGCCAGCGA
ATGGTCATGACGATGACAACGATGACAGCGACAGCAAGGATGCCAAGGAT
CGAAAATCGAAGGAGGAGGAGGCCGGACAGGAGGGGAAGCGCAACGATCA
CAGCCATCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC
GGTACGTGCGGTCCATTTACGAGAGCAGCGAGAGCCACGGACATTCCGGC
AGCAATGCCGGCTCCAATCAGCGGGACAACGGAGCCCGTGAGAGCAGTCA
GGAGAACCAGGAGGCCAAGGAAGTGGTTAGCGAAGCGCCTGCTCAACGGG
CAGCTCTCGCCGCTGGCAATGTGCCGGATGGACCCGAAACTGGAGCCAAG
GACGATGACTACGAGGAGATG------
>C3
ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC
CCTCGGCCAACTGCCGGAGCATGGCGCTCTGGGCCAGAAGTATTACATGA
ACTTTGCCTTCAACAACAATAATCCGGATGGCGAAGGAGGCACCGGCGTC
GATGGTGGCGGTGGTGGTGCTGGCGGTGGTGCCGCTGGTCCCGGCGGTGG
ACCCGGTGAT------CGTTCACAAGATGGTGACGGTAGTGCTGCGACGG
ATAGCCCCAATGACGACCACGCTACATCTGCTGATAATAGTTTGGCTACT
GATGGCGATGCCATTGGTAAGAAGGAAAGCGGCAATGGT---AGCGATGG
CAAAAGCGACTCCAAAGACTCGAGCGGAGGCAATGATGCCACGCCAGCGA
ATGGTCATGACGATGACAACGATGACAGCGACAGCAAGGATGCCAAGGAT
CGAAAATCGAAGGAGGAGGAGGCCGTACAGGAGGGGAAGCGCACCGATCA
CAGCCATCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC
GGTACGTGCGGTCCATTTACGAGAGCAGCGAGAGCCACGGACATTCCGGC
AGCAATGCCGGCTCCAATCAGCGGGACAACGGAGCCCGTGAGAGCAGTCA
GGAGAACCAGGATGCCAAGGAAGTGGCCAGCGAAGCGCCTGCTCAACGGG
CAGCTCTCGCCGCTGGCAATGTGCCGGATGGACCCGAAACTGGAGCCAAG
GACGATGACTACGAGGAGATG------
>C4
ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC
CCTCGGCCATCTGCCGGAGCATGGCGCTCTGGGCCAGAAGTACTACATGA
ACTTCGCCTTCAACAACAATAATCCGGATGGAGAAGGAGGCACCGGCGCC
GATGGT------GGCGCTGCTGGTGGTGGTCCCGCTGGTGCCGGTGGTGC
AACCAGTGAT------CGTTCACAAGAAGGTGACGGTAGTGCGGCGACGG
ATCGTCCCAATGACGACCACGCTACATCCGCTGATAATAGTTTGGCTACT
GATGGCGATGCCGGTGATAAGAAAAGTAGTGGAGATGGCAAGAGCGACTC
CGACAGCGATTCCAAAGACTCGAGCGGAGGCAATGCTGCCACGCCAGCGA
ATGGTCATGACGATGATAACGATGACAGCGACAGCAAGGATGTCAAGGAT
CGGCATTCGAAGGAGGAT---GCCGCAGCGGAGGGTAAACGCACCGATCA
CAGCCACCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC
GCTACGTGCGCTCCATTTACGAGAGCAGCGAGAGCCACGGCCACTCCGGC
AGCAATGCCGGCTCCAATCAGCGGGACAGCGGAGCCCGCGATAGCAGTCA
GGAGACCCAGACCGCCAAGGAAATGGCCAGTGAAGCCCCTGCTGCACGGG
CACCTCGCGTCGCTGGCAACGTGCCGGATGGGCCCGAAACTGGAGCCAAG
GAGGATGACTACGAGGAAATG------
>C1
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGTGDSPHSQEGDGSAATDNPNDDHATSADNSLAT
DGDAIGKKESGGGoSDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD
RQDKEEEAGQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDNGARESSQENQDAKEVASEAPAQRooooAGNVPDGPETGAK
EDDYEEM
>C2
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGPGDooHSQDGDGSAATDSPNDDHATSADNSLAT
DGDAIGKKESGNGoSDGKSDAKDSSGGNDATPANGHDDDNDDSDSKDAKD
RKSKEEEAGQEGKRNDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDNGARESSQENQEAKEVVSEAPAQRAALAAGNVPDGPETGAK
DDDYEEM
>C3
MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
DGGGGGAGGGAAGPGGGPGDooRSQDGDGSAATDSPNDDHATSADNSLAT
DGDAIGKKESGNGoSDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD
RKSKEEEAVQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDNGARESSQENQDAKEVASEAPAQRAALAAGNVPDGPETGAK
DDDYEEM
>C4
MWRMRMRLLTGYLVLLALGHLPEHGALGQKYYMNFAFNNNNPDGEGGTGA
DGooGAAGGGPAGAGGATSDooRSQEGDGSAATDRPNDDHATSADNSLAT
DGDAGDKKSSGDGKSDSDSDSKDSSGGNAATPANGHDDDNDDSDSKDVKD
RHSKEDoAAAEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
SNAGSNQRDSGARDSSQETQTAKEMASEAPAARAPRVAGNVPDGPETGAK
EDDYEEM
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 777 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479795438
Setting output file names to "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 87832147
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4878404043
Seed = 2102598681
Swapseed = 1479795438
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.35 % Dirichlet(Revmat{all})
1.35 % Slider(Revmat{all})
1.35 % Dirichlet(Pi{all})
1.35 % Slider(Pi{all})
2.70 % Multiplier(Alpha{1,2})
2.70 % Multiplier(Alpha{3})
2.70 % Slider(Pinvar{all})
13.51 % NNI(Tau{all},V{all})
13.51 % ParsSPR(Tau{all},V{all})
40.54 % Multiplier(V{all})
13.51 % Nodeslider(V{all})
5.41 % TLMultiplier(V{all})
Division 1 has 23 unique site patterns
Division 2 has 26 unique site patterns
Division 3 has 37 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1756.756316 -- -26.620141
Chain 2 -- -1762.066364 -- -26.620141
Chain 3 -- -1743.184710 -- -26.620141
Chain 4 -- -1762.066364 -- -26.620141
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1756.756316 -- -26.620141
Chain 2 -- -1743.184710 -- -26.620141
Chain 3 -- -1762.066364 -- -26.620141
Chain 4 -- -1743.184710 -- -26.620141
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1756.756] (-1762.066) (-1743.185) (-1762.066) * [-1756.756] (-1743.185) (-1762.066) (-1743.185)
500 -- [-1520.809] (-1525.637) (-1530.702) (-1522.773) * (-1530.771) (-1521.257) (-1524.513) [-1519.252] -- 0:00:00
1000 -- [-1513.330] (-1523.451) (-1529.328) (-1517.531) * (-1513.097) (-1519.221) [-1519.136] (-1519.407) -- 0:00:00
1500 -- [-1514.507] (-1522.262) (-1523.084) (-1513.783) * [-1517.243] (-1522.747) (-1516.125) (-1521.470) -- 0:00:00
2000 -- (-1515.031) [-1519.908] (-1525.244) (-1509.505) * [-1512.451] (-1511.605) (-1516.491) (-1529.371) -- 0:00:00
2500 -- [-1512.669] (-1521.519) (-1520.508) (-1507.437) * (-1512.609) (-1513.418) [-1513.859] (-1523.535) -- 0:00:00
3000 -- [-1514.224] (-1521.806) (-1515.318) (-1513.582) * (-1508.877) [-1507.933] (-1517.487) (-1514.583) -- 0:00:00
3500 -- [-1515.905] (-1513.358) (-1514.842) (-1514.571) * (-1512.757) (-1515.973) (-1515.634) [-1509.304] -- 0:00:00
4000 -- (-1511.418) [-1513.228] (-1517.415) (-1516.048) * [-1506.544] (-1514.418) (-1511.607) (-1512.992) -- 0:00:00
4500 -- (-1512.775) (-1511.210) (-1510.298) [-1508.401] * (-1507.673) (-1515.651) (-1511.162) [-1512.758] -- 0:00:00
5000 -- [-1505.913] (-1510.620) (-1515.139) (-1507.871) * (-1511.669) (-1510.272) (-1518.466) [-1513.312] -- 0:00:00
Average standard deviation of split frequencies: 0.078567
5500 -- (-1509.404) (-1510.020) (-1517.526) [-1514.301] * [-1508.951] (-1514.211) (-1521.849) (-1512.413) -- 0:00:00
6000 -- (-1505.519) [-1506.828] (-1523.114) (-1509.466) * [-1507.342] (-1511.905) (-1509.833) (-1511.498) -- 0:00:00
6500 -- (-1511.420) (-1514.892) (-1512.708) [-1507.713] * [-1504.163] (-1519.103) (-1512.961) (-1509.880) -- 0:02:32
7000 -- (-1509.402) (-1513.097) (-1514.648) [-1508.016] * (-1504.656) (-1514.314) [-1507.535] (-1510.508) -- 0:02:21
7500 -- (-1510.414) (-1511.092) (-1509.805) [-1507.275] * (-1511.104) (-1511.237) [-1506.917] (-1512.457) -- 0:02:12
8000 -- (-1508.021) [-1511.213] (-1508.089) (-1507.540) * (-1508.735) (-1508.746) [-1510.273] (-1508.235) -- 0:02:04
8500 -- (-1512.965) (-1507.901) (-1509.511) [-1511.763] * (-1507.468) [-1505.772] (-1510.948) (-1512.192) -- 0:01:56
9000 -- (-1509.827) (-1508.944) (-1505.646) [-1507.413] * (-1512.764) (-1509.924) (-1509.680) [-1510.031] -- 0:01:50
9500 -- (-1509.389) (-1511.440) (-1512.780) [-1505.552] * (-1506.470) [-1508.661] (-1509.980) (-1514.168) -- 0:01:44
10000 -- (-1511.050) (-1512.777) (-1505.036) [-1504.947] * (-1511.501) (-1513.915) [-1508.323] (-1515.343) -- 0:01:39
Average standard deviation of split frequencies: 0.088388
10500 -- [-1507.854] (-1506.455) (-1507.639) (-1509.371) * [-1509.463] (-1517.954) (-1513.332) (-1516.651) -- 0:01:34
11000 -- [-1503.801] (-1507.371) (-1505.162) (-1508.728) * [-1505.711] (-1508.240) (-1510.486) (-1515.403) -- 0:01:29
11500 -- (-1509.444) [-1509.241] (-1506.251) (-1508.922) * [-1507.639] (-1506.604) (-1509.618) (-1515.873) -- 0:01:25
12000 -- [-1507.583] (-1510.077) (-1507.134) (-1509.556) * (-1510.252) (-1509.465) [-1511.421] (-1513.151) -- 0:01:22
12500 -- (-1513.233) [-1506.928] (-1507.601) (-1509.756) * (-1511.069) [-1505.352] (-1510.179) (-1510.191) -- 0:01:19
13000 -- (-1509.416) [-1503.572] (-1507.748) (-1510.415) * (-1515.212) (-1505.417) [-1510.157] (-1518.056) -- 0:01:15
13500 -- (-1509.407) (-1514.417) [-1509.234] (-1510.057) * (-1508.313) (-1510.216) (-1508.961) [-1510.330] -- 0:01:13
14000 -- (-1510.610) [-1510.918] (-1507.309) (-1507.763) * (-1513.873) (-1509.231) (-1507.946) [-1509.864] -- 0:02:20
14500 -- [-1505.963] (-1505.725) (-1506.736) (-1510.670) * (-1514.985) (-1512.514) [-1510.820] (-1511.912) -- 0:02:15
15000 -- (-1512.699) (-1512.326) [-1508.777] (-1509.483) * (-1512.347) [-1509.696] (-1510.285) (-1508.569) -- 0:02:11
Average standard deviation of split frequencies: 0.103120
15500 -- [-1508.908] (-1512.663) (-1508.897) (-1513.734) * (-1506.614) (-1510.575) (-1507.619) [-1506.770] -- 0:02:07
16000 -- [-1505.145] (-1517.465) (-1510.835) (-1513.838) * (-1506.409) [-1509.047] (-1509.890) (-1509.791) -- 0:02:03
16500 -- (-1507.904) (-1525.156) [-1510.995] (-1512.283) * [-1510.089] (-1514.246) (-1514.279) (-1507.031) -- 0:01:59
17000 -- [-1508.117] (-1520.519) (-1513.942) (-1507.742) * (-1508.163) [-1509.307] (-1510.756) (-1513.473) -- 0:01:55
17500 -- (-1510.777) (-1515.390) (-1515.418) [-1505.040] * (-1510.463) [-1506.945] (-1509.471) (-1513.709) -- 0:01:52
18000 -- (-1508.074) (-1517.363) [-1515.540] (-1510.067) * (-1507.663) [-1508.420] (-1512.372) (-1511.986) -- 0:01:49
18500 -- (-1516.065) (-1515.916) (-1513.863) [-1509.107] * (-1506.768) (-1508.041) [-1507.774] (-1518.045) -- 0:01:46
19000 -- (-1515.387) (-1513.530) (-1518.687) [-1507.469] * (-1507.654) (-1508.858) [-1509.259] (-1512.365) -- 0:01:43
19500 -- (-1519.143) (-1510.781) (-1510.768) [-1508.132] * (-1505.571) (-1505.220) [-1508.282] (-1513.972) -- 0:01:40
20000 -- (-1517.001) (-1509.245) [-1507.799] (-1509.496) * (-1508.969) (-1512.480) [-1510.980] (-1507.716) -- 0:01:38
Average standard deviation of split frequencies: 0.102645
20500 -- (-1510.243) (-1514.789) (-1510.146) [-1510.102] * [-1507.369] (-1507.686) (-1512.024) (-1511.176) -- 0:01:35
21000 -- (-1507.807) (-1509.032) (-1505.390) [-1509.659] * (-1507.963) (-1509.092) [-1506.672] (-1508.503) -- 0:02:19
21500 -- [-1508.326] (-1509.380) (-1506.016) (-1509.657) * (-1511.628) (-1505.342) [-1509.252] (-1506.054) -- 0:02:16
22000 -- (-1515.461) (-1506.248) [-1507.906] (-1508.846) * (-1509.884) [-1506.273] (-1508.980) (-1507.119) -- 0:02:13
22500 -- (-1510.934) (-1506.028) [-1507.446] (-1515.630) * (-1511.806) (-1515.550) (-1517.104) [-1511.551] -- 0:02:10
23000 -- [-1510.582] (-1505.447) (-1511.396) (-1520.760) * [-1509.322] (-1512.064) (-1509.348) (-1512.190) -- 0:02:07
23500 -- (-1511.512) (-1510.350) (-1511.105) [-1510.918] * [-1509.382] (-1524.301) (-1509.722) (-1513.451) -- 0:02:04
24000 -- (-1507.117) (-1508.151) [-1510.098] (-1509.666) * [-1506.870] (-1515.112) (-1511.426) (-1502.484) -- 0:02:02
24500 -- (-1512.215) (-1509.191) (-1510.958) [-1507.721] * (-1509.926) [-1511.283] (-1507.998) (-1507.525) -- 0:01:59
25000 -- (-1510.905) (-1508.087) [-1505.697] (-1506.447) * (-1511.683) (-1510.811) [-1514.168] (-1512.259) -- 0:01:57
Average standard deviation of split frequencies: 0.036262
25500 -- [-1507.220] (-1507.475) (-1507.681) (-1515.724) * (-1512.631) (-1507.434) [-1509.024] (-1508.508) -- 0:01:54
26000 -- [-1513.733] (-1506.858) (-1510.864) (-1507.925) * (-1512.996) (-1509.350) [-1511.396] (-1508.077) -- 0:01:52
26500 -- [-1510.697] (-1506.960) (-1510.807) (-1513.958) * (-1519.376) (-1509.626) (-1514.245) [-1509.015] -- 0:01:50
27000 -- [-1507.628] (-1513.584) (-1511.960) (-1511.553) * (-1514.574) (-1508.089) [-1506.328] (-1509.113) -- 0:01:48
27500 -- (-1516.794) (-1511.468) (-1511.581) [-1511.854] * (-1514.401) (-1511.588) [-1508.243] (-1510.353) -- 0:01:46
28000 -- (-1513.879) [-1509.911] (-1508.902) (-1509.854) * [-1510.692] (-1512.159) (-1510.286) (-1515.611) -- 0:01:44
28500 -- (-1506.728) (-1513.929) [-1506.126] (-1507.737) * (-1512.019) (-1508.713) [-1509.942] (-1511.208) -- 0:02:16
29000 -- (-1510.799) [-1512.765] (-1510.775) (-1509.791) * [-1514.681] (-1508.871) (-1509.078) (-1509.515) -- 0:02:13
29500 -- (-1513.494) (-1517.131) [-1513.488] (-1505.319) * [-1513.750] (-1512.895) (-1516.002) (-1511.068) -- 0:02:11
30000 -- [-1512.513] (-1513.978) (-1512.609) (-1510.751) * (-1515.365) (-1515.222) (-1511.997) [-1514.200] -- 0:02:09
Average standard deviation of split frequencies: 0.053802
30500 -- (-1508.970) (-1515.198) [-1508.952] (-1511.397) * (-1513.827) [-1504.655] (-1517.025) (-1518.497) -- 0:02:07
31000 -- (-1515.737) (-1520.622) [-1507.619] (-1511.249) * (-1516.266) (-1512.447) [-1513.548] (-1514.417) -- 0:02:05
31500 -- [-1507.887] (-1517.640) (-1507.402) (-1512.259) * (-1509.675) (-1513.260) (-1511.638) [-1512.834] -- 0:02:02
32000 -- [-1508.373] (-1518.832) (-1514.908) (-1505.819) * (-1512.741) (-1512.020) (-1510.567) [-1510.874] -- 0:02:01
32500 -- (-1511.443) [-1512.399] (-1508.459) (-1510.103) * (-1510.393) (-1509.820) (-1508.976) [-1511.166] -- 0:01:59
33000 -- (-1513.846) (-1509.899) [-1506.883] (-1506.342) * (-1514.103) (-1505.680) [-1507.600] (-1511.481) -- 0:01:57
33500 -- (-1514.172) (-1512.372) (-1510.186) [-1506.199] * (-1514.001) (-1505.450) (-1518.066) [-1512.460] -- 0:01:55
34000 -- (-1509.208) (-1509.833) (-1506.715) [-1507.615] * (-1506.152) [-1507.437] (-1512.752) (-1511.941) -- 0:01:53
34500 -- (-1511.004) (-1508.028) (-1506.920) [-1506.360] * (-1506.727) (-1511.458) (-1516.354) [-1514.314] -- 0:01:51
35000 -- (-1509.269) (-1509.016) (-1510.040) [-1506.417] * (-1505.140) [-1511.136] (-1510.121) (-1506.332) -- 0:01:50
Average standard deviation of split frequencies: 0.052378
35500 -- (-1512.876) (-1509.192) (-1507.313) [-1511.457] * [-1511.689] (-1511.100) (-1517.154) (-1508.862) -- 0:02:15
36000 -- (-1513.741) [-1508.965] (-1509.735) (-1508.761) * [-1505.730] (-1513.880) (-1513.124) (-1506.993) -- 0:02:13
36500 -- (-1515.311) (-1512.448) [-1506.208] (-1513.465) * (-1506.665) [-1510.450] (-1508.942) (-1507.190) -- 0:02:11
37000 -- (-1519.259) (-1507.690) (-1502.279) [-1513.487] * (-1505.846) [-1510.341] (-1511.530) (-1506.473) -- 0:02:10
37500 -- (-1507.634) [-1508.089] (-1506.440) (-1508.992) * (-1507.271) (-1516.671) [-1517.636] (-1508.769) -- 0:02:08
38000 -- [-1505.690] (-1511.365) (-1507.510) (-1509.395) * [-1505.950] (-1508.688) (-1515.133) (-1507.525) -- 0:02:06
38500 -- (-1508.376) (-1515.911) (-1524.644) [-1507.428] * [-1509.796] (-1509.139) (-1513.422) (-1508.012) -- 0:02:04
39000 -- [-1505.461] (-1512.177) (-1519.576) (-1504.971) * (-1512.246) (-1506.637) (-1515.358) [-1509.182] -- 0:02:03
39500 -- (-1506.365) [-1509.710] (-1513.989) (-1506.908) * (-1513.497) (-1511.525) (-1514.655) [-1508.716] -- 0:02:01
40000 -- (-1505.710) (-1514.817) (-1512.655) [-1506.409] * (-1511.504) [-1508.766] (-1511.191) (-1514.982) -- 0:02:00
Average standard deviation of split frequencies: 0.046368
40500 -- (-1503.460) [-1509.719] (-1516.955) (-1510.767) * (-1511.524) [-1506.849] (-1510.453) (-1508.003) -- 0:01:58
41000 -- (-1510.484) [-1509.531] (-1514.062) (-1515.235) * [-1508.643] (-1505.450) (-1508.847) (-1509.428) -- 0:01:56
41500 -- [-1509.013] (-1506.819) (-1513.084) (-1511.758) * (-1510.861) (-1507.510) [-1510.288] (-1508.401) -- 0:01:55
42000 -- (-1507.979) (-1512.792) [-1506.816] (-1511.008) * (-1511.096) [-1508.048] (-1508.154) (-1507.706) -- 0:01:54
42500 -- (-1516.468) (-1512.645) (-1508.786) [-1508.379] * (-1506.431) (-1509.085) [-1511.255] (-1506.852) -- 0:01:52
43000 -- (-1515.043) [-1514.999] (-1509.091) (-1506.673) * (-1507.155) (-1512.032) (-1509.031) [-1504.625] -- 0:02:13
43500 -- (-1511.085) (-1508.682) [-1510.520] (-1507.144) * (-1509.816) [-1508.100] (-1514.278) (-1506.000) -- 0:02:11
44000 -- (-1513.666) (-1508.152) (-1507.631) [-1504.732] * (-1507.092) (-1512.070) [-1508.784] (-1505.377) -- 0:02:10
44500 -- (-1516.339) [-1511.202] (-1504.079) (-1506.923) * [-1509.346] (-1509.217) (-1512.136) (-1507.193) -- 0:02:08
45000 -- (-1512.894) (-1509.003) (-1506.312) [-1510.121] * (-1511.161) (-1506.883) [-1511.785] (-1510.230) -- 0:02:07
Average standard deviation of split frequencies: 0.010248
45500 -- [-1507.617] (-1511.333) (-1510.422) (-1511.388) * (-1511.187) (-1510.110) [-1515.743] (-1514.074) -- 0:02:05
46000 -- [-1505.778] (-1508.717) (-1508.971) (-1514.714) * (-1510.157) (-1516.501) (-1508.199) [-1512.717] -- 0:02:04
46500 -- [-1505.074] (-1508.212) (-1509.860) (-1515.515) * (-1512.407) (-1507.512) [-1515.434] (-1508.661) -- 0:02:03
47000 -- (-1506.650) (-1512.752) [-1507.081] (-1509.880) * [-1509.680] (-1507.923) (-1508.771) (-1507.956) -- 0:02:01
47500 -- (-1507.642) (-1512.749) (-1510.502) [-1514.628] * (-1521.359) [-1504.268] (-1505.998) (-1512.884) -- 0:02:00
48000 -- (-1514.234) (-1507.876) [-1512.880] (-1512.736) * (-1510.584) [-1503.915] (-1510.940) (-1514.227) -- 0:01:59
48500 -- (-1504.010) [-1504.353] (-1505.411) (-1510.906) * [-1510.543] (-1505.653) (-1518.639) (-1511.287) -- 0:01:57
49000 -- [-1507.379] (-1506.380) (-1508.405) (-1511.668) * (-1510.601) (-1515.197) [-1509.379] (-1509.715) -- 0:01:56
49500 -- (-1509.554) (-1509.280) [-1507.484] (-1509.881) * (-1508.776) (-1512.183) (-1512.316) [-1506.842] -- 0:01:55
50000 -- [-1508.457] (-1507.173) (-1513.298) (-1514.611) * (-1517.229) (-1512.742) (-1511.320) [-1506.083] -- 0:02:13
Average standard deviation of split frequencies: 0.013956
50500 -- (-1507.179) [-1507.395] (-1511.752) (-1508.702) * (-1507.825) [-1506.250] (-1510.744) (-1510.397) -- 0:02:11
51000 -- [-1515.346] (-1505.179) (-1512.778) (-1509.489) * (-1509.197) [-1509.951] (-1513.599) (-1511.956) -- 0:02:10
51500 -- (-1514.154) (-1506.962) [-1511.931] (-1509.579) * [-1509.952] (-1506.267) (-1513.738) (-1512.690) -- 0:02:08
52000 -- (-1509.062) [-1503.854] (-1518.842) (-1509.774) * [-1512.912] (-1510.472) (-1512.395) (-1513.843) -- 0:02:07
52500 -- [-1511.535] (-1505.702) (-1513.152) (-1514.077) * [-1521.389] (-1510.356) (-1513.464) (-1509.777) -- 0:02:06
53000 -- (-1509.532) (-1509.222) [-1515.123] (-1514.643) * (-1511.557) (-1507.843) (-1509.754) [-1510.707] -- 0:02:05
53500 -- [-1511.164] (-1507.774) (-1509.834) (-1510.223) * [-1510.318] (-1507.113) (-1513.315) (-1507.499) -- 0:02:03
54000 -- (-1510.204) [-1507.925] (-1510.696) (-1505.668) * (-1505.596) [-1511.405] (-1509.666) (-1514.809) -- 0:02:02
54500 -- [-1508.045] (-1507.429) (-1508.278) (-1505.304) * (-1508.031) (-1506.660) (-1511.748) [-1510.170] -- 0:02:01
55000 -- (-1508.937) [-1511.278] (-1509.592) (-1511.392) * (-1509.525) [-1509.913] (-1507.874) (-1508.215) -- 0:02:00
Average standard deviation of split frequencies: 0.029463
55500 -- (-1512.738) (-1505.299) (-1513.745) [-1512.778] * (-1506.756) [-1506.586] (-1513.300) (-1511.406) -- 0:01:59
56000 -- (-1505.935) (-1505.157) (-1512.506) [-1506.654] * (-1511.816) (-1511.617) (-1516.956) [-1507.610] -- 0:01:58
56500 -- (-1508.045) [-1509.039] (-1508.999) (-1514.389) * (-1510.945) [-1509.742] (-1515.882) (-1508.694) -- 0:01:56
57000 -- (-1508.270) [-1517.788] (-1505.334) (-1513.589) * (-1509.226) (-1513.464) [-1513.355] (-1508.359) -- 0:01:55
57500 -- (-1510.760) (-1514.896) [-1507.418] (-1512.588) * (-1508.420) (-1509.020) (-1508.668) [-1509.957] -- 0:02:11
58000 -- (-1510.651) [-1507.828] (-1511.599) (-1507.307) * (-1512.133) (-1507.453) [-1505.792] (-1514.732) -- 0:02:09
58500 -- [-1506.473] (-1506.428) (-1510.843) (-1514.319) * (-1508.242) [-1508.839] (-1512.087) (-1512.097) -- 0:02:08
59000 -- [-1506.725] (-1505.500) (-1509.471) (-1515.793) * (-1508.690) [-1509.905] (-1509.378) (-1514.269) -- 0:02:07
59500 -- [-1505.806] (-1505.039) (-1515.564) (-1513.188) * (-1507.694) [-1508.643] (-1507.464) (-1514.522) -- 0:02:06
60000 -- (-1506.092) [-1506.897] (-1519.347) (-1511.985) * (-1509.820) [-1509.273] (-1507.309) (-1512.443) -- 0:02:05
Average standard deviation of split frequencies: 0.011656
60500 -- [-1509.452] (-1508.870) (-1520.408) (-1506.405) * (-1507.885) [-1505.316] (-1506.372) (-1506.462) -- 0:02:04
61000 -- (-1511.624) [-1510.812] (-1510.390) (-1514.312) * (-1511.713) (-1511.767) [-1506.621] (-1508.886) -- 0:02:03
61500 -- [-1506.610] (-1510.716) (-1509.028) (-1509.511) * [-1509.314] (-1509.786) (-1507.738) (-1507.079) -- 0:02:02
62000 -- [-1508.264] (-1507.469) (-1509.151) (-1506.652) * [-1513.678] (-1507.078) (-1510.648) (-1515.792) -- 0:02:01
62500 -- [-1508.700] (-1508.197) (-1515.819) (-1507.843) * (-1512.700) [-1508.326] (-1509.424) (-1508.197) -- 0:02:00
63000 -- [-1504.629] (-1514.623) (-1510.164) (-1511.891) * [-1506.296] (-1509.163) (-1514.008) (-1506.073) -- 0:01:58
63500 -- (-1508.748) [-1509.259] (-1506.504) (-1511.885) * (-1505.699) (-1507.555) (-1506.540) [-1508.622] -- 0:01:57
64000 -- (-1510.954) (-1512.675) [-1506.008] (-1511.264) * (-1509.086) (-1517.786) [-1504.743] (-1508.623) -- 0:01:57
64500 -- (-1513.160) (-1513.906) [-1509.212] (-1511.869) * (-1507.715) (-1514.347) (-1511.884) [-1508.247] -- 0:01:56
65000 -- (-1512.104) (-1509.200) (-1508.268) [-1509.871] * (-1507.682) (-1512.344) (-1506.731) [-1507.404] -- 0:02:09
Average standard deviation of split frequencies: 0.000000
65500 -- (-1508.804) [-1513.567] (-1508.528) (-1510.683) * [-1507.565] (-1515.194) (-1505.064) (-1510.231) -- 0:02:08
66000 -- [-1509.907] (-1510.583) (-1512.571) (-1512.136) * [-1510.150] (-1505.608) (-1510.341) (-1507.767) -- 0:02:07
66500 -- [-1507.918] (-1510.011) (-1512.162) (-1511.161) * [-1505.652] (-1505.968) (-1513.855) (-1507.720) -- 0:02:06
67000 -- [-1507.336] (-1510.288) (-1510.791) (-1511.300) * (-1509.188) (-1504.621) (-1505.057) [-1508.929] -- 0:02:05
67500 -- (-1510.587) (-1513.355) [-1509.160] (-1509.673) * (-1507.717) (-1515.275) [-1510.331] (-1506.283) -- 0:02:04
68000 -- [-1514.416] (-1507.876) (-1508.142) (-1511.345) * (-1509.168) (-1510.076) [-1509.517] (-1506.256) -- 0:02:03
68500 -- (-1507.213) (-1509.164) (-1511.372) [-1507.830] * (-1511.420) (-1509.824) (-1509.735) [-1509.604] -- 0:02:02
69000 -- [-1505.974] (-1512.220) (-1508.288) (-1508.056) * (-1509.660) (-1511.590) [-1507.884] (-1509.179) -- 0:02:01
69500 -- [-1512.245] (-1510.811) (-1508.384) (-1508.447) * (-1508.823) (-1517.760) (-1507.029) [-1504.766] -- 0:02:00
70000 -- [-1507.119] (-1509.171) (-1506.662) (-1510.784) * (-1509.353) (-1511.928) [-1509.344] (-1510.388) -- 0:01:59
Average standard deviation of split frequencies: 0.010006
70500 -- (-1506.946) (-1520.480) [-1511.822] (-1510.626) * (-1513.299) (-1508.740) [-1510.674] (-1511.635) -- 0:01:58
71000 -- [-1507.410] (-1510.319) (-1514.198) (-1508.712) * (-1509.477) (-1509.112) [-1510.651] (-1513.833) -- 0:01:57
71500 -- (-1507.299) (-1508.552) (-1507.478) [-1511.569] * (-1508.135) (-1518.987) (-1512.921) [-1505.181] -- 0:01:56
72000 -- (-1507.670) (-1512.189) [-1506.701] (-1506.052) * (-1506.305) (-1513.008) [-1509.000] (-1510.828) -- 0:02:08
72500 -- (-1512.399) (-1509.530) [-1504.918] (-1505.965) * [-1507.777] (-1508.549) (-1511.360) (-1505.068) -- 0:02:07
73000 -- [-1510.863] (-1514.471) (-1506.034) (-1515.440) * (-1507.949) [-1511.379] (-1506.028) (-1511.431) -- 0:02:06
73500 -- (-1510.065) (-1516.260) [-1510.745] (-1514.582) * [-1507.246] (-1511.042) (-1513.105) (-1512.465) -- 0:02:06
74000 -- (-1511.634) (-1513.763) [-1504.336] (-1514.475) * [-1509.697] (-1505.446) (-1510.340) (-1508.396) -- 0:02:05
74500 -- [-1508.881] (-1516.360) (-1509.436) (-1516.139) * (-1507.649) [-1509.089] (-1517.030) (-1517.564) -- 0:02:04
75000 -- [-1507.919] (-1508.143) (-1505.582) (-1509.038) * (-1506.472) (-1511.008) [-1509.134] (-1522.549) -- 0:02:03
Average standard deviation of split frequencies: 0.031013
75500 -- (-1507.940) (-1505.957) [-1508.203] (-1512.166) * (-1519.069) [-1508.084] (-1508.497) (-1513.760) -- 0:02:02
76000 -- [-1513.354] (-1507.507) (-1506.254) (-1511.181) * [-1515.497] (-1514.978) (-1511.432) (-1508.201) -- 0:02:01
76500 -- (-1510.305) [-1506.697] (-1512.069) (-1507.921) * (-1513.375) (-1519.700) (-1510.522) [-1506.441] -- 0:02:00
77000 -- (-1512.451) [-1510.063] (-1505.331) (-1508.208) * [-1504.195] (-1514.322) (-1512.980) (-1513.865) -- 0:01:59
77500 -- [-1512.624] (-1515.401) (-1512.211) (-1516.483) * (-1508.158) (-1509.009) [-1511.119] (-1508.678) -- 0:01:59
78000 -- (-1513.905) (-1505.673) [-1508.661] (-1511.128) * (-1508.896) (-1507.784) [-1506.814] (-1511.253) -- 0:01:58
78500 -- (-1511.834) (-1508.296) (-1505.260) [-1506.926] * (-1514.217) [-1508.186] (-1514.584) (-1515.539) -- 0:01:57
79000 -- (-1511.454) [-1509.067] (-1513.071) (-1514.954) * (-1510.153) (-1510.610) (-1508.172) [-1504.218] -- 0:02:08
79500 -- (-1504.452) [-1509.211] (-1505.960) (-1511.035) * (-1509.408) [-1509.290] (-1508.635) (-1506.551) -- 0:02:07
80000 -- (-1508.207) (-1515.036) [-1508.186] (-1506.482) * (-1508.739) [-1509.433] (-1512.799) (-1506.378) -- 0:02:06
Average standard deviation of split frequencies: 0.035063
80500 -- [-1508.457] (-1510.781) (-1511.812) (-1507.273) * (-1512.114) (-1505.973) (-1506.543) [-1506.801] -- 0:02:05
81000 -- (-1503.824) [-1510.742] (-1509.079) (-1516.287) * (-1505.538) (-1508.952) [-1509.235] (-1506.284) -- 0:02:04
81500 -- (-1504.799) (-1511.289) (-1512.610) [-1510.086] * (-1509.355) [-1504.531] (-1511.061) (-1507.568) -- 0:02:03
82000 -- (-1508.272) (-1513.077) [-1506.922] (-1520.724) * [-1507.083] (-1507.200) (-1510.031) (-1508.377) -- 0:02:03
82500 -- (-1510.841) (-1509.393) [-1504.846] (-1515.182) * (-1511.744) [-1507.357] (-1511.736) (-1506.386) -- 0:02:02
83000 -- (-1507.042) [-1506.402] (-1510.672) (-1511.015) * (-1513.030) [-1512.169] (-1513.666) (-1510.039) -- 0:02:01
83500 -- [-1512.054] (-1508.634) (-1507.744) (-1512.665) * (-1509.638) (-1507.160) [-1506.896] (-1505.596) -- 0:02:00
84000 -- [-1510.538] (-1511.552) (-1506.855) (-1512.296) * (-1507.837) (-1511.678) (-1510.289) [-1506.746] -- 0:01:59
84500 -- (-1507.782) (-1506.019) (-1507.979) [-1509.282] * (-1508.571) (-1511.057) [-1507.459] (-1508.390) -- 0:01:59
85000 -- (-1508.363) [-1510.343] (-1508.272) (-1512.121) * (-1504.805) (-1510.623) (-1506.997) [-1504.559] -- 0:01:58
Average standard deviation of split frequencies: 0.049333
85500 -- (-1505.019) (-1511.102) [-1507.801] (-1510.580) * (-1505.116) [-1507.900] (-1506.707) (-1509.200) -- 0:01:57
86000 -- (-1504.949) (-1511.749) (-1508.842) [-1505.113] * (-1509.522) [-1511.309] (-1507.697) (-1508.341) -- 0:01:56
86500 -- (-1507.203) (-1506.993) [-1509.168] (-1510.659) * (-1506.196) (-1512.414) [-1510.576] (-1509.274) -- 0:02:06
87000 -- [-1508.479] (-1507.461) (-1507.631) (-1511.292) * [-1506.604] (-1507.624) (-1516.882) (-1511.858) -- 0:02:05
87500 -- [-1507.836] (-1514.078) (-1505.373) (-1507.633) * (-1510.989) [-1513.070] (-1512.718) (-1512.785) -- 0:02:05
88000 -- (-1512.350) [-1510.368] (-1508.952) (-1509.631) * [-1507.052] (-1513.125) (-1506.194) (-1516.249) -- 0:02:04
88500 -- (-1508.344) (-1507.073) (-1508.613) [-1513.134] * [-1509.704] (-1514.222) (-1510.941) (-1508.214) -- 0:02:03
89000 -- (-1506.166) [-1510.187] (-1507.637) (-1512.475) * (-1510.595) (-1509.740) [-1505.979] (-1508.019) -- 0:02:02
89500 -- (-1508.744) [-1506.779] (-1507.348) (-1505.816) * (-1507.607) (-1511.464) [-1507.144] (-1508.814) -- 0:02:02
90000 -- (-1513.975) [-1506.679] (-1509.277) (-1506.152) * (-1505.368) (-1507.881) (-1510.271) [-1511.894] -- 0:02:01
Average standard deviation of split frequencies: 0.041595
90500 -- (-1510.333) (-1504.779) [-1506.831] (-1508.737) * (-1510.631) [-1509.767] (-1510.445) (-1512.054) -- 0:02:00
91000 -- (-1510.402) [-1507.451] (-1507.652) (-1509.817) * (-1506.901) (-1510.296) (-1516.057) [-1513.311] -- 0:01:59
91500 -- [-1511.069] (-1509.556) (-1512.339) (-1510.275) * (-1512.929) [-1508.627] (-1510.545) (-1511.356) -- 0:01:59
92000 -- (-1509.853) [-1514.905] (-1513.595) (-1513.226) * (-1511.042) (-1505.970) (-1509.890) [-1506.041] -- 0:01:58
92500 -- [-1507.883] (-1508.151) (-1509.874) (-1506.649) * (-1510.495) [-1512.593] (-1508.972) (-1507.747) -- 0:01:57
93000 -- (-1506.218) (-1508.151) (-1506.621) [-1508.414] * (-1514.682) (-1514.080) [-1507.007] (-1508.775) -- 0:01:57
93500 -- (-1508.962) (-1505.420) [-1509.198] (-1507.157) * (-1509.602) (-1511.840) [-1510.351] (-1511.585) -- 0:01:56
94000 -- (-1506.177) [-1507.225] (-1510.085) (-1509.619) * (-1508.336) (-1512.494) (-1511.563) [-1509.495] -- 0:02:05
94500 -- [-1503.948] (-1507.305) (-1509.164) (-1511.456) * (-1511.358) (-1514.150) (-1510.623) [-1513.831] -- 0:02:04
95000 -- (-1512.516) [-1507.914] (-1513.746) (-1509.027) * [-1508.667] (-1510.704) (-1515.823) (-1508.706) -- 0:02:03
Average standard deviation of split frequencies: 0.041739
95500 -- (-1509.891) (-1510.702) [-1511.241] (-1516.438) * [-1514.894] (-1507.465) (-1506.338) (-1507.612) -- 0:02:03
96000 -- [-1510.391] (-1507.643) (-1508.287) (-1510.648) * (-1515.177) (-1508.440) (-1507.818) [-1507.679] -- 0:02:02
96500 -- (-1507.520) (-1506.706) (-1505.596) [-1509.585] * [-1514.091] (-1510.939) (-1506.522) (-1511.156) -- 0:02:01
97000 -- (-1509.156) (-1505.509) [-1506.760] (-1507.927) * (-1510.055) (-1507.853) [-1513.421] (-1506.353) -- 0:02:01
97500 -- (-1508.827) [-1514.910] (-1507.911) (-1510.728) * [-1509.254] (-1505.903) (-1511.534) (-1509.292) -- 0:02:00
98000 -- (-1506.757) (-1511.776) (-1513.181) [-1507.926] * (-1508.998) (-1506.672) [-1507.289] (-1510.605) -- 0:01:59
98500 -- [-1508.665] (-1505.742) (-1507.935) (-1510.610) * (-1510.295) [-1507.512] (-1511.838) (-1509.359) -- 0:01:58
99000 -- (-1507.614) (-1506.760) (-1508.414) [-1506.826] * [-1510.273] (-1509.088) (-1509.997) (-1506.690) -- 0:01:58
99500 -- [-1507.041] (-1510.571) (-1512.518) (-1509.747) * (-1507.766) [-1507.359] (-1505.296) (-1510.948) -- 0:01:57
100000 -- (-1509.198) [-1505.107] (-1509.934) (-1510.052) * (-1515.795) (-1511.953) [-1507.356] (-1507.691) -- 0:01:56
Average standard deviation of split frequencies: 0.042145
100500 -- (-1515.847) (-1511.798) (-1506.606) [-1508.841] * [-1506.505] (-1516.223) (-1512.753) (-1509.065) -- 0:02:05
101000 -- (-1517.275) (-1513.314) (-1506.229) [-1508.117] * (-1514.145) (-1517.391) (-1510.625) [-1506.624] -- 0:02:04
101500 -- (-1510.380) (-1515.453) [-1507.304] (-1506.282) * [-1507.726] (-1512.147) (-1510.120) (-1508.665) -- 0:02:03
102000 -- [-1520.426] (-1510.799) (-1508.771) (-1507.243) * [-1510.926] (-1513.033) (-1514.504) (-1510.023) -- 0:02:03
102500 -- (-1509.768) (-1510.703) [-1508.073] (-1509.657) * [-1510.683] (-1508.538) (-1512.149) (-1512.813) -- 0:02:02
103000 -- (-1516.735) [-1509.381] (-1506.174) (-1512.562) * [-1508.839] (-1507.000) (-1516.405) (-1508.379) -- 0:02:01
103500 -- (-1514.247) (-1514.444) (-1514.030) [-1506.928] * (-1516.811) (-1510.291) (-1512.371) [-1505.897] -- 0:02:01
104000 -- (-1518.440) (-1509.524) [-1508.329] (-1507.490) * (-1513.897) (-1514.201) [-1509.705] (-1519.032) -- 0:02:00
104500 -- (-1510.077) (-1511.993) (-1511.371) [-1504.428] * [-1506.098] (-1512.072) (-1514.320) (-1514.009) -- 0:01:59
105000 -- (-1512.038) (-1512.221) [-1510.442] (-1511.094) * (-1505.735) (-1511.044) [-1508.235] (-1516.180) -- 0:01:59
Average standard deviation of split frequencies: 0.033354
105500 -- (-1508.083) [-1511.175] (-1514.354) (-1507.420) * (-1510.134) (-1509.933) [-1505.855] (-1507.928) -- 0:01:58
106000 -- [-1506.253] (-1506.180) (-1506.179) (-1512.205) * (-1507.897) (-1514.962) [-1505.370] (-1517.198) -- 0:01:58
106500 -- (-1510.486) (-1507.648) (-1506.790) [-1507.681] * (-1507.489) (-1509.486) (-1508.485) [-1513.859] -- 0:01:57
107000 -- (-1511.306) [-1510.623] (-1505.086) (-1513.438) * (-1508.682) (-1507.804) (-1505.634) [-1508.916] -- 0:01:56
107500 -- (-1509.802) [-1505.525] (-1509.714) (-1509.371) * (-1517.151) [-1506.653] (-1505.426) (-1517.185) -- 0:01:56
108000 -- (-1514.877) (-1510.803) (-1507.242) [-1507.875] * [-1513.440] (-1516.364) (-1509.091) (-1511.887) -- 0:02:03
108500 -- (-1514.235) (-1516.536) [-1509.777] (-1507.677) * [-1510.747] (-1514.785) (-1505.422) (-1509.631) -- 0:02:03
109000 -- [-1509.598] (-1510.350) (-1505.271) (-1510.986) * (-1510.853) [-1507.591] (-1507.887) (-1507.682) -- 0:02:02
109500 -- (-1509.461) (-1510.139) [-1505.024] (-1505.304) * [-1513.980] (-1511.013) (-1516.940) (-1513.840) -- 0:02:01
110000 -- [-1511.002] (-1516.284) (-1509.122) (-1515.968) * (-1514.277) (-1504.855) [-1508.598] (-1509.367) -- 0:02:01
Average standard deviation of split frequencies: 0.044727
110500 -- (-1510.616) (-1511.831) (-1509.707) [-1515.603] * (-1513.861) [-1505.342] (-1508.160) (-1515.231) -- 0:02:00
111000 -- (-1511.463) (-1515.699) [-1514.752] (-1508.881) * (-1509.192) [-1510.292] (-1504.647) (-1509.448) -- 0:02:00
111500 -- [-1505.726] (-1513.117) (-1528.455) (-1514.138) * (-1511.167) (-1511.509) (-1506.667) [-1511.520] -- 0:01:59
112000 -- (-1509.167) [-1506.903] (-1509.753) (-1507.680) * (-1507.584) (-1513.152) (-1505.856) [-1510.422] -- 0:01:58
112500 -- (-1510.855) (-1506.041) [-1509.467] (-1507.504) * (-1509.813) (-1510.566) (-1507.258) [-1512.309] -- 0:01:58
113000 -- (-1513.821) (-1506.526) [-1509.396] (-1511.832) * (-1514.808) (-1513.326) (-1505.691) [-1508.277] -- 0:01:57
113500 -- (-1505.859) [-1508.995] (-1510.900) (-1506.607) * (-1511.345) (-1505.215) (-1509.244) [-1504.997] -- 0:01:57
114000 -- (-1508.845) [-1508.413] (-1512.714) (-1508.463) * (-1503.420) (-1508.002) [-1516.108] (-1509.268) -- 0:01:56
114500 -- [-1511.716] (-1505.961) (-1508.346) (-1507.003) * (-1507.123) (-1505.656) (-1508.689) [-1506.069] -- 0:01:56
115000 -- [-1506.574] (-1509.829) (-1514.301) (-1506.687) * [-1510.625] (-1518.315) (-1508.375) (-1508.466) -- 0:02:03
Average standard deviation of split frequencies: 0.048766
115500 -- [-1509.958] (-1507.085) (-1508.956) (-1508.589) * (-1504.054) (-1513.329) [-1506.689] (-1508.637) -- 0:02:02
116000 -- [-1511.064] (-1505.248) (-1507.925) (-1506.893) * (-1510.312) [-1507.462] (-1511.398) (-1507.010) -- 0:02:01
116500 -- (-1511.025) (-1511.493) [-1504.098] (-1504.186) * (-1512.017) (-1508.359) [-1507.912] (-1514.285) -- 0:02:01
117000 -- [-1506.333] (-1506.096) (-1508.092) (-1508.435) * [-1506.211] (-1507.446) (-1506.746) (-1507.712) -- 0:02:00
117500 -- (-1504.952) [-1504.510] (-1510.005) (-1504.556) * (-1508.331) [-1508.465] (-1512.272) (-1512.061) -- 0:02:00
118000 -- [-1504.668] (-1508.296) (-1509.535) (-1510.970) * (-1507.514) (-1506.784) (-1516.439) [-1505.708] -- 0:01:59
118500 -- [-1506.043] (-1506.860) (-1509.636) (-1508.177) * [-1506.874] (-1510.237) (-1511.238) (-1509.705) -- 0:01:59
119000 -- [-1511.265] (-1509.945) (-1514.357) (-1509.495) * (-1509.572) [-1509.252] (-1508.643) (-1513.720) -- 0:01:58
119500 -- (-1517.858) (-1507.484) (-1507.528) [-1507.035] * (-1512.017) [-1506.013] (-1508.945) (-1509.643) -- 0:01:57
120000 -- (-1507.985) [-1506.988] (-1513.281) (-1508.148) * [-1504.873] (-1508.308) (-1505.269) (-1506.947) -- 0:01:57
Average standard deviation of split frequencies: 0.039067
120500 -- (-1511.298) (-1512.937) [-1510.154] (-1507.983) * (-1510.797) [-1510.011] (-1510.335) (-1515.469) -- 0:01:56
121000 -- (-1511.499) [-1509.071] (-1511.583) (-1509.105) * (-1511.475) (-1510.721) (-1510.904) [-1511.072] -- 0:01:56
121500 -- (-1514.444) (-1510.385) [-1511.833] (-1511.122) * (-1506.324) [-1509.009] (-1507.482) (-1512.607) -- 0:01:55
122000 -- (-1512.935) [-1507.022] (-1516.910) (-1507.394) * (-1514.515) [-1513.439] (-1510.096) (-1507.931) -- 0:02:02
122500 -- (-1513.335) (-1507.439) (-1511.646) [-1510.076] * (-1511.540) (-1509.002) [-1507.225] (-1509.315) -- 0:02:01
123000 -- [-1512.407] (-1506.230) (-1508.881) (-1510.839) * [-1507.696] (-1516.735) (-1508.233) (-1510.652) -- 0:02:01
123500 -- [-1512.335] (-1509.973) (-1512.241) (-1511.992) * (-1507.017) [-1509.312] (-1512.163) (-1509.012) -- 0:02:00
124000 -- (-1512.833) [-1506.093] (-1512.494) (-1509.586) * [-1503.563] (-1515.371) (-1517.074) (-1510.567) -- 0:02:00
124500 -- (-1519.015) (-1507.609) [-1507.857] (-1511.087) * (-1508.028) [-1507.491] (-1513.478) (-1508.133) -- 0:01:59
125000 -- (-1510.159) (-1512.139) [-1508.321] (-1510.572) * [-1507.558] (-1512.098) (-1509.252) (-1511.336) -- 0:01:59
Average standard deviation of split frequencies: 0.037413
125500 -- (-1514.523) [-1511.512] (-1507.798) (-1512.122) * (-1508.739) (-1512.312) (-1511.504) [-1508.929] -- 0:01:58
126000 -- (-1507.861) [-1512.999] (-1509.917) (-1512.205) * (-1506.446) (-1510.411) (-1508.235) [-1507.666] -- 0:01:57
126500 -- (-1509.572) (-1513.963) [-1510.189] (-1511.994) * [-1506.167] (-1512.788) (-1508.742) (-1509.710) -- 0:01:57
127000 -- [-1510.251] (-1506.730) (-1514.063) (-1507.617) * (-1518.240) (-1511.012) [-1506.156] (-1513.153) -- 0:01:56
127500 -- (-1512.695) (-1510.757) (-1523.575) [-1509.073] * (-1511.356) (-1510.612) (-1509.023) [-1507.635] -- 0:01:56
128000 -- (-1507.811) (-1507.258) [-1509.034] (-1506.287) * (-1506.879) (-1508.179) (-1509.976) [-1508.402] -- 0:01:55
128500 -- [-1509.402] (-1510.230) (-1512.120) (-1512.872) * (-1506.545) [-1508.458] (-1511.067) (-1504.069) -- 0:01:55
129000 -- [-1508.307] (-1508.922) (-1508.509) (-1512.930) * (-1508.993) (-1516.883) (-1507.088) [-1506.912] -- 0:01:54
129500 -- (-1513.241) [-1509.807] (-1510.646) (-1507.857) * (-1505.525) (-1506.424) [-1507.805] (-1509.720) -- 0:02:00
130000 -- (-1507.697) (-1507.480) (-1506.210) [-1509.723] * [-1505.897] (-1507.442) (-1507.418) (-1509.429) -- 0:02:00
Average standard deviation of split frequencies: 0.032469
130500 -- (-1508.379) (-1506.861) [-1506.356] (-1506.528) * (-1515.798) [-1508.691] (-1509.796) (-1508.684) -- 0:01:59
131000 -- (-1509.115) (-1510.642) [-1507.807] (-1510.934) * (-1512.948) (-1515.385) [-1505.680] (-1512.359) -- 0:01:59
131500 -- (-1513.582) (-1507.161) (-1508.797) [-1503.627] * [-1509.303] (-1509.174) (-1511.690) (-1507.720) -- 0:01:58
132000 -- (-1511.435) (-1512.184) [-1510.807] (-1505.132) * [-1507.264] (-1516.590) (-1509.947) (-1513.860) -- 0:01:58
132500 -- (-1511.208) [-1508.165] (-1504.409) (-1512.609) * [-1509.021] (-1520.678) (-1510.787) (-1511.722) -- 0:01:57
133000 -- (-1507.730) (-1507.583) [-1504.797] (-1508.846) * (-1518.345) [-1513.288] (-1509.735) (-1513.036) -- 0:01:57
133500 -- (-1512.373) [-1506.968] (-1511.905) (-1510.096) * (-1510.672) [-1509.686] (-1511.577) (-1506.914) -- 0:01:56
134000 -- (-1506.600) (-1506.264) (-1508.229) [-1507.375] * [-1509.188] (-1514.600) (-1507.589) (-1504.016) -- 0:01:56
134500 -- (-1509.363) (-1508.355) [-1509.168] (-1503.675) * (-1507.305) (-1514.696) (-1508.448) [-1503.283] -- 0:01:55
135000 -- (-1510.336) [-1503.709] (-1513.297) (-1510.555) * (-1512.334) (-1511.369) (-1505.841) [-1507.509] -- 0:01:55
Average standard deviation of split frequencies: 0.031196
135500 -- (-1510.614) (-1509.688) (-1510.693) [-1507.102] * (-1510.945) (-1517.817) [-1507.253] (-1510.399) -- 0:01:54
136000 -- (-1514.888) (-1513.727) [-1507.274] (-1505.176) * (-1518.749) (-1509.845) (-1511.084) [-1506.819] -- 0:01:54
136500 -- (-1507.533) [-1507.926] (-1515.764) (-1511.933) * (-1512.504) [-1507.043] (-1508.407) (-1511.904) -- 0:02:00
137000 -- (-1510.793) (-1507.797) (-1507.255) [-1509.247] * (-1516.070) (-1506.844) (-1510.910) [-1504.210] -- 0:01:59
137500 -- (-1508.575) (-1508.951) [-1508.741] (-1509.004) * (-1509.782) [-1505.251] (-1508.756) (-1511.214) -- 0:01:59
138000 -- (-1507.783) (-1511.053) (-1509.032) [-1508.006] * (-1510.166) (-1509.292) [-1507.142] (-1508.842) -- 0:01:58
138500 -- (-1507.302) [-1507.690] (-1516.021) (-1508.757) * (-1507.663) (-1513.383) (-1508.982) [-1509.334] -- 0:01:58
139000 -- [-1510.465] (-1512.249) (-1511.411) (-1507.788) * [-1506.157] (-1511.764) (-1512.459) (-1506.972) -- 0:01:57
139500 -- [-1509.603] (-1512.993) (-1512.713) (-1508.138) * (-1505.228) (-1508.326) [-1509.044] (-1512.336) -- 0:01:57
140000 -- [-1510.916] (-1510.975) (-1516.539) (-1511.847) * [-1510.411] (-1509.253) (-1513.593) (-1510.915) -- 0:01:56
Average standard deviation of split frequencies: 0.025134
140500 -- (-1507.810) [-1513.100] (-1515.885) (-1507.780) * (-1508.462) (-1508.115) [-1506.124] (-1512.239) -- 0:01:56
141000 -- (-1506.808) (-1508.509) (-1515.362) [-1508.284] * (-1506.997) (-1512.988) (-1509.432) [-1506.725] -- 0:01:55
141500 -- [-1505.654] (-1509.248) (-1513.974) (-1515.816) * [-1512.696] (-1514.121) (-1517.705) (-1514.867) -- 0:01:55
142000 -- (-1509.211) (-1510.967) (-1508.050) [-1505.613] * [-1509.337] (-1509.597) (-1512.739) (-1513.674) -- 0:01:54
142500 -- (-1516.277) (-1519.550) (-1506.737) [-1510.792] * (-1506.423) (-1509.356) [-1506.591] (-1508.774) -- 0:01:54
143000 -- (-1506.179) (-1513.576) (-1511.834) [-1511.250] * (-1511.478) (-1509.827) (-1514.488) [-1511.861] -- 0:01:53
143500 -- (-1509.406) (-1507.567) [-1509.290] (-1510.957) * [-1504.646] (-1513.798) (-1510.252) (-1508.716) -- 0:01:53
144000 -- (-1507.954) (-1515.077) [-1505.546] (-1514.208) * (-1506.216) (-1509.272) (-1504.682) [-1507.042] -- 0:01:58
144500 -- [-1509.166] (-1509.061) (-1511.530) (-1508.487) * (-1510.526) (-1508.236) [-1510.214] (-1508.047) -- 0:01:58
145000 -- (-1507.763) (-1511.034) (-1507.523) [-1510.097] * (-1507.508) [-1511.865] (-1513.826) (-1507.277) -- 0:01:57
Average standard deviation of split frequencies: 0.038746
145500 -- [-1505.031] (-1512.199) (-1513.002) (-1506.809) * [-1507.734] (-1511.034) (-1508.162) (-1505.336) -- 0:01:57
146000 -- (-1510.515) (-1511.436) [-1506.523] (-1506.293) * (-1509.446) [-1507.271] (-1510.214) (-1505.759) -- 0:01:56
146500 -- (-1509.761) (-1517.393) [-1505.688] (-1511.545) * (-1514.159) (-1511.702) (-1508.001) [-1503.738] -- 0:01:56
147000 -- (-1509.184) (-1514.471) (-1506.721) [-1507.561] * (-1515.812) (-1509.602) (-1506.658) [-1507.213] -- 0:01:56
147500 -- (-1512.463) (-1511.471) (-1509.240) [-1504.755] * (-1513.470) (-1509.737) [-1506.088] (-1507.596) -- 0:01:55
148000 -- (-1511.625) [-1512.072] (-1511.333) (-1507.750) * (-1518.843) (-1509.682) [-1511.427] (-1508.949) -- 0:01:55
148500 -- (-1511.574) [-1515.783] (-1510.019) (-1515.267) * (-1517.794) (-1513.494) (-1512.148) [-1513.063] -- 0:01:54
149000 -- (-1507.853) (-1511.263) [-1510.995] (-1512.325) * (-1524.225) [-1515.578] (-1512.928) (-1505.802) -- 0:01:54
149500 -- (-1509.342) [-1511.243] (-1518.586) (-1508.717) * (-1521.347) (-1514.693) [-1511.601] (-1509.737) -- 0:01:53
150000 -- (-1512.019) [-1516.636] (-1511.474) (-1504.807) * (-1523.788) [-1517.227] (-1506.862) (-1510.568) -- 0:01:53
Average standard deviation of split frequencies: 0.028159
150500 -- (-1515.308) [-1515.126] (-1514.236) (-1512.624) * (-1517.696) (-1518.692) (-1513.673) [-1509.124] -- 0:01:52
151000 -- [-1511.092] (-1519.935) (-1510.667) (-1508.938) * [-1513.633] (-1512.204) (-1509.909) (-1510.447) -- 0:01:52
151500 -- (-1510.816) (-1514.013) [-1508.674] (-1503.924) * (-1520.898) (-1512.889) (-1510.102) [-1507.251] -- 0:01:57
152000 -- [-1508.172] (-1511.309) (-1510.850) (-1508.234) * (-1514.423) (-1514.649) [-1505.591] (-1506.544) -- 0:01:57
152500 -- (-1511.360) (-1510.275) (-1508.524) [-1505.828] * (-1518.358) (-1512.900) (-1511.537) [-1505.721] -- 0:01:56
153000 -- (-1510.869) (-1508.041) [-1507.222] (-1513.191) * (-1513.230) [-1507.518] (-1511.954) (-1513.033) -- 0:01:56
153500 -- (-1507.768) (-1510.412) (-1508.175) [-1505.479] * [-1514.823] (-1509.584) (-1508.086) (-1509.304) -- 0:01:55
154000 -- (-1510.586) (-1510.045) [-1508.815] (-1509.269) * (-1516.059) (-1510.543) [-1505.708] (-1508.922) -- 0:01:55
154500 -- [-1507.338] (-1511.438) (-1516.728) (-1515.823) * (-1516.110) (-1508.134) (-1503.474) [-1504.085] -- 0:01:54
155000 -- (-1516.078) (-1510.613) [-1509.943] (-1507.672) * [-1507.950] (-1508.795) (-1507.502) (-1510.675) -- 0:01:54
Average standard deviation of split frequencies: 0.034751
155500 -- (-1515.515) (-1511.744) [-1506.639] (-1507.051) * (-1509.439) (-1511.609) [-1507.981] (-1510.166) -- 0:01:54
156000 -- (-1513.089) (-1513.948) [-1512.099] (-1510.358) * (-1508.383) (-1511.132) [-1505.321] (-1512.162) -- 0:01:53
156500 -- (-1513.191) (-1508.682) (-1508.203) [-1508.295] * [-1505.853] (-1511.978) (-1509.019) (-1515.133) -- 0:01:53
157000 -- (-1507.221) [-1508.774] (-1513.022) (-1510.972) * [-1505.467] (-1511.026) (-1504.427) (-1504.838) -- 0:01:52
157500 -- (-1508.334) (-1508.814) (-1514.728) [-1511.758] * (-1508.870) (-1509.709) (-1507.173) [-1510.483] -- 0:01:52
158000 -- (-1508.436) (-1510.009) (-1512.664) [-1517.624] * (-1512.591) (-1514.845) [-1505.701] (-1510.172) -- 0:01:51
158500 -- (-1506.946) (-1507.154) [-1507.836] (-1519.380) * (-1516.062) (-1509.093) (-1510.850) [-1513.735] -- 0:01:56
159000 -- (-1508.530) [-1510.772] (-1511.142) (-1517.728) * (-1509.581) (-1512.869) (-1508.512) [-1509.381] -- 0:01:56
159500 -- (-1508.335) (-1506.036) (-1511.578) [-1511.660] * (-1511.312) (-1511.073) (-1507.385) [-1504.809] -- 0:01:55
160000 -- [-1511.801] (-1510.116) (-1510.921) (-1510.432) * (-1511.515) (-1506.907) (-1513.048) [-1505.620] -- 0:01:55
Average standard deviation of split frequencies: 0.035209
160500 -- (-1511.727) (-1518.585) [-1508.725] (-1509.943) * [-1514.511] (-1506.598) (-1511.137) (-1507.763) -- 0:01:55
161000 -- (-1506.320) (-1510.240) [-1505.858] (-1512.810) * [-1512.730] (-1512.058) (-1509.746) (-1507.152) -- 0:01:54
161500 -- (-1505.468) (-1513.326) [-1505.929] (-1514.779) * [-1508.274] (-1507.830) (-1514.787) (-1510.637) -- 0:01:54
162000 -- (-1509.978) [-1512.165] (-1512.250) (-1508.065) * (-1506.729) (-1511.156) [-1510.429] (-1508.037) -- 0:01:53
162500 -- [-1508.310] (-1512.794) (-1515.391) (-1510.479) * [-1504.330] (-1515.931) (-1510.188) (-1510.378) -- 0:01:53
163000 -- (-1503.816) (-1517.278) [-1508.592] (-1507.207) * (-1521.981) (-1510.201) (-1514.244) [-1506.091] -- 0:01:52
163500 -- (-1510.279) (-1510.506) (-1507.737) [-1507.328] * (-1509.018) (-1508.547) [-1509.962] (-1509.195) -- 0:01:52
164000 -- (-1511.076) (-1509.262) (-1510.031) [-1511.959] * [-1508.197] (-1511.114) (-1509.566) (-1510.708) -- 0:01:52
164500 -- (-1517.905) [-1508.373] (-1510.014) (-1506.602) * [-1506.869] (-1510.279) (-1509.218) (-1509.209) -- 0:01:51
165000 -- (-1508.860) (-1511.014) (-1510.722) [-1504.729] * [-1508.625] (-1507.104) (-1508.979) (-1504.738) -- 0:01:51
Average standard deviation of split frequencies: 0.046856
165500 -- (-1511.161) [-1508.474] (-1508.791) (-1510.275) * (-1515.161) (-1510.816) [-1515.804] (-1509.172) -- 0:01:50
166000 -- (-1505.624) (-1510.724) (-1511.713) [-1512.060] * (-1515.342) (-1510.082) [-1510.892] (-1506.903) -- 0:01:55
166500 -- [-1505.696] (-1506.668) (-1512.620) (-1510.198) * (-1507.925) [-1509.643] (-1509.505) (-1512.483) -- 0:01:55
167000 -- (-1507.972) [-1507.837] (-1513.033) (-1510.717) * [-1510.647] (-1509.879) (-1513.547) (-1509.064) -- 0:01:54
167500 -- (-1515.153) (-1507.694) (-1513.014) [-1510.160] * [-1508.952] (-1511.860) (-1513.366) (-1509.213) -- 0:01:54
168000 -- (-1506.612) (-1509.719) (-1511.293) [-1506.923] * (-1505.592) (-1515.334) (-1507.469) [-1507.541] -- 0:01:53
168500 -- [-1509.731] (-1510.728) (-1515.418) (-1506.297) * (-1510.247) (-1512.248) [-1511.418] (-1507.901) -- 0:01:53
169000 -- [-1509.637] (-1510.525) (-1520.437) (-1509.257) * [-1507.256] (-1515.420) (-1514.896) (-1505.277) -- 0:01:53
169500 -- [-1506.155] (-1510.941) (-1509.313) (-1508.706) * (-1512.540) (-1515.113) (-1512.922) [-1510.341] -- 0:01:52
170000 -- (-1507.840) (-1508.441) [-1507.746] (-1511.642) * [-1513.221] (-1505.250) (-1510.397) (-1507.835) -- 0:01:52
Average standard deviation of split frequencies: 0.049718
170500 -- (-1510.024) [-1508.612] (-1512.497) (-1507.004) * (-1518.238) (-1508.463) (-1507.689) [-1507.993] -- 0:01:51
171000 -- (-1508.963) (-1513.223) [-1510.606] (-1510.587) * (-1508.948) [-1510.068] (-1511.820) (-1512.839) -- 0:01:51
171500 -- (-1510.706) [-1510.741] (-1510.334) (-1505.431) * [-1507.315] (-1508.942) (-1510.758) (-1505.847) -- 0:01:51
172000 -- (-1509.498) [-1511.266] (-1510.516) (-1508.804) * (-1513.390) (-1506.651) (-1510.752) [-1508.566] -- 0:01:50
172500 -- (-1507.036) (-1510.334) (-1507.057) [-1508.404] * (-1514.172) (-1506.382) (-1509.625) [-1512.628] -- 0:01:50
173000 -- (-1514.517) (-1514.450) [-1508.283] (-1506.998) * (-1511.776) (-1505.951) (-1507.998) [-1511.995] -- 0:01:49
173500 -- [-1508.563] (-1516.710) (-1513.153) (-1506.546) * (-1510.000) [-1504.921] (-1512.725) (-1508.826) -- 0:01:54
174000 -- (-1513.996) [-1508.470] (-1512.343) (-1507.317) * (-1514.049) (-1508.258) [-1505.665] (-1513.956) -- 0:01:53
174500 -- (-1509.179) (-1511.607) [-1507.654] (-1512.234) * [-1508.375] (-1510.374) (-1506.133) (-1509.370) -- 0:01:53
175000 -- (-1513.184) [-1514.847] (-1508.616) (-1513.548) * (-1506.879) (-1511.737) [-1507.505] (-1509.320) -- 0:01:53
Average standard deviation of split frequencies: 0.040177
175500 -- (-1514.466) [-1505.335] (-1512.558) (-1509.637) * [-1508.403] (-1516.818) (-1506.500) (-1513.847) -- 0:01:52
176000 -- (-1510.253) (-1507.978) (-1510.503) [-1506.591] * (-1511.552) (-1511.174) [-1509.554] (-1510.708) -- 0:01:52
176500 -- (-1511.352) (-1508.835) (-1509.738) [-1507.488] * [-1511.379] (-1508.649) (-1508.919) (-1512.394) -- 0:01:51
177000 -- (-1515.859) [-1508.165] (-1503.276) (-1517.259) * (-1509.677) (-1508.396) [-1508.391] (-1515.978) -- 0:01:51
177500 -- (-1510.290) (-1508.739) [-1506.855] (-1518.528) * [-1507.319] (-1510.767) (-1506.223) (-1510.332) -- 0:01:51
178000 -- (-1509.190) (-1507.567) [-1508.912] (-1508.468) * (-1512.274) (-1508.970) (-1513.619) [-1508.079] -- 0:01:50
178500 -- (-1505.335) (-1513.396) [-1507.074] (-1510.101) * (-1511.700) (-1505.904) (-1507.223) [-1512.126] -- 0:01:50
179000 -- (-1510.056) (-1512.031) (-1505.679) [-1506.929] * [-1507.927] (-1504.261) (-1507.856) (-1511.977) -- 0:01:50
179500 -- (-1509.245) (-1509.731) [-1503.718] (-1510.212) * (-1512.594) [-1509.158] (-1515.242) (-1512.843) -- 0:01:49
180000 -- [-1506.720] (-1508.595) (-1505.411) (-1507.504) * (-1514.062) [-1510.765] (-1508.772) (-1509.995) -- 0:01:49
Average standard deviation of split frequencies: 0.039139
180500 -- (-1506.288) (-1515.448) (-1515.399) [-1506.161] * (-1513.651) (-1508.592) [-1507.160] (-1507.708) -- 0:01:53
181000 -- (-1508.252) [-1511.104] (-1509.553) (-1509.580) * (-1511.752) (-1507.947) [-1508.406] (-1508.206) -- 0:01:53
181500 -- (-1510.205) (-1508.471) [-1509.008] (-1511.371) * (-1508.863) (-1511.289) (-1519.445) [-1509.596] -- 0:01:52
182000 -- (-1508.130) (-1512.034) [-1507.241] (-1504.601) * [-1513.546] (-1511.460) (-1516.046) (-1511.635) -- 0:01:52
182500 -- (-1507.664) (-1513.012) (-1508.199) [-1507.154] * (-1513.119) (-1508.409) (-1512.682) [-1511.572] -- 0:01:51
183000 -- (-1509.383) (-1509.253) (-1505.316) [-1510.081] * (-1510.132) [-1510.597] (-1507.325) (-1513.400) -- 0:01:51
183500 -- (-1511.604) (-1508.763) (-1507.899) [-1505.796] * (-1513.149) [-1513.024] (-1510.724) (-1514.324) -- 0:01:51
184000 -- (-1505.880) (-1508.158) [-1509.268] (-1514.959) * (-1510.002) [-1508.437] (-1508.497) (-1513.581) -- 0:01:50
184500 -- (-1511.200) (-1507.674) (-1504.675) [-1512.345] * (-1507.833) (-1506.582) [-1514.140] (-1515.846) -- 0:01:50
185000 -- (-1516.820) (-1507.472) [-1509.428] (-1512.560) * (-1506.807) [-1508.505] (-1507.231) (-1508.265) -- 0:01:50
Average standard deviation of split frequencies: 0.034215
185500 -- (-1512.475) [-1509.039] (-1510.049) (-1509.047) * [-1505.360] (-1517.276) (-1510.639) (-1515.677) -- 0:01:49
186000 -- (-1506.858) [-1509.008] (-1510.240) (-1510.354) * (-1506.596) (-1510.879) [-1506.595] (-1510.597) -- 0:01:49
186500 -- (-1515.590) (-1507.955) [-1506.247] (-1509.345) * (-1506.211) (-1510.762) (-1510.832) [-1510.676] -- 0:01:49
187000 -- (-1511.306) (-1511.393) [-1506.591] (-1515.333) * [-1510.109] (-1515.166) (-1515.967) (-1514.809) -- 0:01:48
187500 -- (-1509.748) (-1509.136) [-1509.592] (-1510.475) * [-1507.958] (-1516.730) (-1512.957) (-1515.871) -- 0:01:48
188000 -- (-1508.841) [-1507.460] (-1513.196) (-1511.876) * (-1512.509) (-1511.315) [-1510.061] (-1512.480) -- 0:01:52
188500 -- [-1511.452] (-1512.270) (-1509.352) (-1507.541) * [-1512.225] (-1510.603) (-1507.710) (-1513.505) -- 0:01:51
189000 -- (-1509.889) (-1506.524) (-1504.822) [-1513.686] * (-1515.032) [-1512.212] (-1513.103) (-1513.859) -- 0:01:51
189500 -- (-1510.562) (-1512.445) (-1508.753) [-1509.458] * [-1515.494] (-1518.141) (-1509.538) (-1507.384) -- 0:01:51
190000 -- [-1512.947] (-1507.569) (-1509.559) (-1511.979) * (-1511.765) (-1508.555) [-1503.693] (-1503.944) -- 0:01:50
Average standard deviation of split frequencies: 0.033377
190500 -- (-1508.604) [-1506.617] (-1507.427) (-1511.947) * (-1510.238) (-1507.567) [-1507.844] (-1508.269) -- 0:01:50
191000 -- (-1509.499) (-1510.528) (-1512.346) [-1506.484] * [-1510.344] (-1508.645) (-1508.500) (-1509.977) -- 0:01:50
191500 -- (-1505.611) (-1512.590) [-1510.274] (-1517.623) * (-1508.507) [-1512.879] (-1505.699) (-1511.426) -- 0:01:49
192000 -- [-1506.027] (-1513.482) (-1509.103) (-1510.832) * (-1505.664) (-1504.972) (-1515.130) [-1514.004] -- 0:01:49
192500 -- [-1507.463] (-1509.458) (-1505.912) (-1507.839) * [-1509.088] (-1510.911) (-1517.755) (-1509.433) -- 0:01:49
193000 -- (-1505.389) [-1508.811] (-1508.305) (-1510.713) * [-1505.880] (-1510.346) (-1509.199) (-1514.569) -- 0:01:48
193500 -- (-1508.986) (-1511.962) [-1509.846] (-1509.105) * (-1506.064) (-1510.311) (-1515.495) [-1512.210] -- 0:01:48
194000 -- (-1506.913) [-1508.464] (-1507.793) (-1506.973) * (-1512.440) (-1507.419) (-1512.848) [-1515.791] -- 0:01:48
194500 -- (-1509.916) [-1518.569] (-1511.881) (-1507.254) * [-1509.950] (-1505.703) (-1512.690) (-1510.070) -- 0:01:47
195000 -- (-1504.648) (-1508.428) [-1513.568] (-1521.978) * [-1508.178] (-1509.997) (-1509.676) (-1511.250) -- 0:01:47
Average standard deviation of split frequencies: 0.020444
195500 -- (-1507.296) (-1515.434) (-1508.214) [-1510.978] * (-1508.923) (-1507.497) (-1508.390) [-1510.841] -- 0:01:51
196000 -- [-1509.202] (-1509.255) (-1511.428) (-1509.604) * (-1507.144) (-1508.673) [-1507.550] (-1508.305) -- 0:01:50
196500 -- (-1513.744) [-1506.197] (-1510.044) (-1512.480) * (-1511.729) [-1503.039] (-1508.677) (-1516.972) -- 0:01:50
197000 -- (-1512.295) [-1503.343] (-1511.411) (-1508.966) * [-1510.279] (-1507.484) (-1509.356) (-1514.113) -- 0:01:50
197500 -- [-1509.992] (-1505.964) (-1510.359) (-1515.825) * (-1508.029) (-1517.631) [-1508.921] (-1514.896) -- 0:01:49
198000 -- (-1513.454) (-1509.999) [-1511.623] (-1508.795) * (-1511.378) (-1508.707) [-1506.288] (-1518.210) -- 0:01:49
198500 -- (-1520.754) [-1509.753] (-1519.100) (-1513.799) * (-1511.821) [-1512.107] (-1508.224) (-1510.292) -- 0:01:49
199000 -- (-1516.552) (-1507.759) (-1512.896) [-1506.293] * (-1507.572) (-1508.462) [-1505.543] (-1511.731) -- 0:01:48
199500 -- (-1520.303) (-1508.230) (-1508.211) [-1506.899] * [-1504.803] (-1508.049) (-1506.385) (-1516.965) -- 0:01:48
200000 -- (-1510.623) [-1504.972] (-1515.240) (-1508.431) * (-1511.795) (-1505.321) [-1506.070] (-1517.099) -- 0:01:48
Average standard deviation of split frequencies: 0.012921
200500 -- [-1510.150] (-1507.949) (-1512.864) (-1520.281) * [-1506.969] (-1508.390) (-1509.597) (-1523.963) -- 0:01:47
201000 -- (-1509.138) [-1506.863] (-1510.862) (-1510.049) * (-1507.007) [-1506.078] (-1509.280) (-1515.001) -- 0:01:47
201500 -- [-1504.294] (-1504.691) (-1506.034) (-1517.638) * (-1509.278) [-1509.239] (-1511.907) (-1511.732) -- 0:01:46
202000 -- (-1506.511) [-1509.903] (-1510.251) (-1509.139) * (-1513.398) [-1505.723] (-1514.315) (-1507.454) -- 0:01:46
202500 -- (-1513.443) (-1510.328) (-1507.242) [-1507.771] * (-1511.172) [-1507.591] (-1517.109) (-1514.300) -- 0:01:50
203000 -- [-1508.071] (-1509.903) (-1511.225) (-1508.976) * (-1505.265) (-1509.192) (-1511.814) [-1506.086] -- 0:01:49
203500 -- (-1509.917) (-1511.500) (-1511.048) [-1507.606] * (-1507.007) (-1510.184) (-1510.049) [-1510.810] -- 0:01:49
204000 -- [-1514.702] (-1506.945) (-1510.509) (-1510.003) * (-1507.121) (-1508.415) (-1509.690) [-1508.354] -- 0:01:49
204500 -- (-1512.029) (-1506.115) (-1510.354) [-1512.386] * [-1506.959] (-1510.254) (-1513.530) (-1509.939) -- 0:01:48
205000 -- (-1506.127) [-1506.983] (-1511.531) (-1508.753) * (-1506.533) [-1512.215] (-1512.317) (-1514.608) -- 0:01:48
Average standard deviation of split frequencies: 0.014874
205500 -- (-1512.013) (-1512.348) (-1511.732) [-1510.391] * [-1511.676] (-1512.758) (-1512.907) (-1508.185) -- 0:01:48
206000 -- (-1513.081) [-1510.641] (-1514.076) (-1513.048) * (-1509.079) (-1514.972) (-1509.778) [-1509.246] -- 0:01:47
206500 -- [-1506.194] (-1511.073) (-1507.041) (-1506.954) * (-1506.740) (-1509.341) (-1510.489) [-1513.639] -- 0:01:47
207000 -- [-1510.561] (-1509.487) (-1510.910) (-1513.281) * (-1505.491) (-1508.472) [-1511.001] (-1511.401) -- 0:01:47
207500 -- (-1509.416) (-1516.822) [-1506.780] (-1511.800) * (-1510.540) [-1513.914] (-1514.037) (-1511.658) -- 0:01:46
208000 -- [-1506.927] (-1505.496) (-1510.522) (-1514.354) * [-1510.213] (-1508.763) (-1515.037) (-1507.871) -- 0:01:46
208500 -- (-1507.770) [-1509.652] (-1505.642) (-1511.114) * (-1505.420) [-1515.589] (-1506.924) (-1509.057) -- 0:01:46
209000 -- (-1504.245) [-1509.924] (-1506.999) (-1515.621) * (-1510.559) (-1509.123) [-1504.825] (-1509.334) -- 0:01:45
209500 -- (-1507.677) (-1506.640) [-1509.942] (-1508.898) * [-1504.802] (-1513.459) (-1507.040) (-1510.990) -- 0:01:45
210000 -- (-1511.243) [-1508.135] (-1510.596) (-1511.154) * (-1513.172) (-1508.350) [-1502.949] (-1510.739) -- 0:01:49
Average standard deviation of split frequencies: 0.011188
210500 -- (-1509.029) [-1508.864] (-1511.013) (-1512.617) * (-1512.246) (-1511.228) [-1507.891] (-1515.527) -- 0:01:48
211000 -- (-1512.171) [-1507.909] (-1510.244) (-1518.035) * [-1508.846] (-1517.179) (-1509.058) (-1510.529) -- 0:01:48
211500 -- (-1509.111) [-1509.649] (-1507.480) (-1515.057) * (-1513.905) (-1517.741) [-1508.621] (-1515.339) -- 0:01:48
212000 -- [-1504.531] (-1508.532) (-1506.647) (-1522.450) * (-1508.282) (-1511.343) (-1504.627) [-1506.138] -- 0:01:47
212500 -- (-1504.729) [-1508.367] (-1507.595) (-1512.752) * [-1508.807] (-1516.144) (-1509.988) (-1515.940) -- 0:01:47
213000 -- [-1509.291] (-1509.562) (-1508.668) (-1512.400) * [-1505.977] (-1508.536) (-1509.223) (-1511.467) -- 0:01:47
213500 -- (-1507.587) [-1506.779] (-1507.168) (-1511.087) * (-1508.350) [-1510.870] (-1507.327) (-1513.186) -- 0:01:46
214000 -- (-1505.041) (-1513.481) [-1507.647] (-1508.634) * (-1505.021) (-1509.567) [-1509.129] (-1510.075) -- 0:01:46
214500 -- (-1509.206) (-1508.458) (-1508.543) [-1512.482] * (-1510.193) (-1506.417) (-1506.350) [-1506.209] -- 0:01:46
215000 -- (-1515.902) (-1509.389) [-1502.923] (-1514.172) * [-1508.625] (-1504.714) (-1510.246) (-1507.126) -- 0:01:45
Average standard deviation of split frequencies: 0.007638
215500 -- (-1511.061) (-1507.946) [-1507.015] (-1514.858) * (-1509.316) (-1509.666) (-1511.040) [-1507.051] -- 0:01:45
216000 -- (-1512.853) (-1508.470) [-1511.393] (-1510.288) * (-1506.714) (-1507.765) [-1508.299] (-1514.681) -- 0:01:45
216500 -- [-1506.830] (-1512.086) (-1511.923) (-1511.332) * (-1507.055) (-1509.473) (-1513.221) [-1508.361] -- 0:01:44
217000 -- (-1506.937) (-1511.985) (-1507.213) [-1506.096] * (-1509.957) (-1509.074) (-1505.968) [-1510.195] -- 0:01:48
217500 -- (-1507.271) [-1509.502] (-1508.047) (-1510.376) * (-1504.835) (-1509.720) (-1510.255) [-1508.549] -- 0:01:47
218000 -- (-1506.481) (-1508.550) (-1511.678) [-1510.042] * (-1504.088) (-1514.286) [-1510.536] (-1513.542) -- 0:01:47
218500 -- [-1512.623] (-1512.101) (-1514.389) (-1511.379) * [-1505.275] (-1513.976) (-1509.643) (-1511.283) -- 0:01:47
219000 -- [-1505.512] (-1514.331) (-1510.453) (-1512.613) * (-1505.485) (-1519.743) [-1506.065] (-1511.723) -- 0:01:46
219500 -- (-1511.751) (-1509.381) (-1511.721) [-1506.406] * (-1512.470) (-1517.747) [-1507.920] (-1512.240) -- 0:01:46
220000 -- (-1513.120) (-1506.886) [-1508.697] (-1512.659) * (-1508.337) (-1516.001) (-1506.825) [-1510.913] -- 0:01:46
Average standard deviation of split frequencies: 0.011750
220500 -- (-1509.462) (-1516.875) (-1512.150) [-1511.084] * (-1510.241) (-1508.090) [-1506.565] (-1509.160) -- 0:01:46
221000 -- [-1508.420] (-1508.195) (-1511.005) (-1512.138) * (-1513.685) [-1508.324] (-1509.189) (-1507.391) -- 0:01:45
221500 -- (-1507.381) (-1506.883) (-1513.797) [-1504.401] * [-1512.832] (-1510.605) (-1513.558) (-1508.669) -- 0:01:45
222000 -- (-1507.529) (-1507.688) (-1514.719) [-1510.336] * (-1509.449) [-1511.493] (-1518.646) (-1506.341) -- 0:01:45
222500 -- [-1505.552] (-1507.416) (-1509.355) (-1507.977) * [-1507.782] (-1508.921) (-1521.939) (-1511.813) -- 0:01:44
223000 -- [-1506.175] (-1506.169) (-1507.582) (-1507.845) * (-1509.972) [-1513.232] (-1516.150) (-1510.200) -- 0:01:44
223500 -- [-1510.396] (-1513.068) (-1510.675) (-1508.656) * (-1509.120) (-1506.723) (-1520.323) [-1507.541] -- 0:01:44
224000 -- [-1507.970] (-1505.683) (-1509.302) (-1514.208) * (-1512.826) (-1510.151) (-1511.647) [-1507.494] -- 0:01:43
224500 -- [-1508.131] (-1507.522) (-1511.960) (-1510.481) * (-1506.990) (-1510.640) (-1507.985) [-1507.265] -- 0:01:47
225000 -- (-1507.769) (-1505.845) [-1513.024] (-1507.335) * (-1511.773) [-1508.301] (-1512.776) (-1504.850) -- 0:01:46
Average standard deviation of split frequencies: 0.009386
225500 -- (-1510.555) (-1508.036) [-1514.858] (-1506.710) * [-1509.636] (-1507.522) (-1515.783) (-1514.586) -- 0:01:46
226000 -- [-1505.958] (-1511.822) (-1509.094) (-1507.134) * (-1507.946) (-1511.609) [-1507.311] (-1511.165) -- 0:01:46
226500 -- (-1509.541) (-1506.701) (-1511.558) [-1509.330] * (-1505.073) (-1509.683) (-1509.475) [-1508.387] -- 0:01:45
227000 -- (-1508.086) (-1508.587) [-1508.826] (-1509.022) * (-1507.853) (-1509.136) (-1508.752) [-1512.781] -- 0:01:45
227500 -- (-1511.510) (-1505.832) (-1512.685) [-1506.666] * (-1507.847) [-1506.387] (-1505.562) (-1508.602) -- 0:01:45
228000 -- (-1515.353) (-1504.783) (-1510.164) [-1503.842] * (-1510.841) [-1508.194] (-1508.320) (-1507.030) -- 0:01:44
228500 -- [-1509.409] (-1506.299) (-1516.076) (-1509.454) * (-1511.074) (-1507.490) (-1516.546) [-1509.542] -- 0:01:44
229000 -- [-1508.037] (-1510.946) (-1514.500) (-1510.414) * (-1504.382) (-1515.674) (-1513.517) [-1507.853] -- 0:01:44
229500 -- [-1507.026] (-1508.652) (-1507.374) (-1507.756) * (-1506.747) (-1517.426) (-1505.539) [-1510.843] -- 0:01:44
230000 -- [-1506.497] (-1509.541) (-1513.476) (-1512.440) * [-1511.371] (-1509.165) (-1505.538) (-1509.583) -- 0:01:43
Average standard deviation of split frequencies: 0.006131
230500 -- (-1510.788) (-1508.836) [-1507.103] (-1508.802) * (-1511.233) (-1504.895) (-1508.336) [-1507.872] -- 0:01:43
231000 -- [-1504.250] (-1509.839) (-1508.162) (-1508.211) * (-1514.357) (-1508.059) (-1507.117) [-1509.087] -- 0:01:43
231500 -- (-1511.260) [-1506.054] (-1509.671) (-1510.808) * (-1510.280) (-1508.966) (-1506.455) [-1506.536] -- 0:01:42
232000 -- (-1508.808) (-1510.261) [-1509.855] (-1509.947) * (-1515.603) [-1504.176] (-1505.583) (-1510.364) -- 0:01:45
232500 -- (-1508.933) [-1511.117] (-1513.963) (-1508.583) * (-1510.869) (-1516.803) (-1513.809) [-1509.193] -- 0:01:45
233000 -- (-1504.475) (-1517.558) (-1511.648) [-1503.274] * [-1507.642] (-1511.813) (-1509.096) (-1510.822) -- 0:01:45
233500 -- (-1508.433) (-1513.588) [-1510.972] (-1508.112) * (-1506.200) (-1507.756) (-1511.361) [-1503.229] -- 0:01:45
234000 -- [-1505.926] (-1511.300) (-1515.694) (-1511.804) * (-1510.189) [-1507.923] (-1509.717) (-1506.026) -- 0:01:44
234500 -- (-1502.905) (-1507.956) (-1506.905) [-1511.120] * (-1512.718) [-1507.907] (-1514.030) (-1510.660) -- 0:01:44
235000 -- (-1509.240) (-1513.228) [-1506.538] (-1514.923) * (-1510.581) (-1507.032) (-1510.889) [-1510.490] -- 0:01:44
Average standard deviation of split frequencies: 0.001997
235500 -- (-1509.931) (-1513.206) (-1512.522) [-1512.421] * (-1510.150) (-1511.150) [-1510.143] (-1522.019) -- 0:01:43
236000 -- (-1509.116) (-1512.387) (-1511.417) [-1510.976] * (-1511.526) (-1507.396) (-1509.327) [-1509.265] -- 0:01:43
236500 -- (-1520.337) (-1507.350) [-1503.645] (-1510.054) * (-1515.319) (-1508.765) [-1506.047] (-1507.632) -- 0:01:43
237000 -- (-1516.079) [-1505.375] (-1506.353) (-1506.137) * [-1507.884] (-1510.502) (-1506.762) (-1508.722) -- 0:01:43
237500 -- (-1509.570) (-1511.788) [-1505.520] (-1510.316) * [-1513.125] (-1508.057) (-1512.800) (-1509.158) -- 0:01:42
238000 -- (-1510.010) [-1508.814] (-1513.572) (-1512.476) * (-1505.837) (-1505.399) (-1515.729) [-1506.447] -- 0:01:42
238500 -- (-1509.913) (-1507.362) [-1508.805] (-1510.149) * (-1509.572) (-1507.245) (-1510.665) [-1509.151] -- 0:01:42
239000 -- (-1510.361) [-1506.730] (-1518.939) (-1511.838) * (-1506.733) (-1512.318) (-1514.281) [-1504.836] -- 0:01:45
239500 -- [-1511.059] (-1505.876) (-1513.722) (-1515.612) * (-1505.509) [-1505.707] (-1517.902) (-1506.180) -- 0:01:44
240000 -- (-1509.246) (-1507.787) (-1510.911) [-1509.667] * (-1509.803) (-1508.390) [-1503.615] (-1509.189) -- 0:01:44
Average standard deviation of split frequencies: 0.003917
240500 -- (-1515.902) [-1509.409] (-1510.423) (-1510.281) * (-1510.013) [-1512.434] (-1513.642) (-1506.774) -- 0:01:44
241000 -- (-1505.154) (-1509.807) (-1512.191) [-1505.267] * (-1511.995) (-1508.284) [-1508.946] (-1505.299) -- 0:01:43
241500 -- (-1510.272) (-1506.746) (-1509.718) [-1507.212] * (-1513.224) (-1511.096) (-1508.715) [-1510.255] -- 0:01:43
242000 -- [-1507.079] (-1511.036) (-1508.893) (-1506.673) * (-1520.069) (-1510.860) (-1510.404) [-1506.051] -- 0:01:43
242500 -- (-1509.244) [-1510.778] (-1509.852) (-1508.421) * (-1518.984) [-1508.461] (-1510.775) (-1507.216) -- 0:01:43
243000 -- (-1514.237) (-1506.004) [-1509.165] (-1505.089) * (-1517.611) [-1507.938] (-1511.527) (-1507.298) -- 0:01:42
243500 -- (-1512.005) [-1509.100] (-1516.154) (-1506.516) * (-1516.470) [-1513.359] (-1516.973) (-1512.909) -- 0:01:42
244000 -- (-1510.216) (-1508.717) (-1513.128) [-1507.440] * (-1516.291) [-1504.024] (-1509.355) (-1507.899) -- 0:01:42
244500 -- (-1508.122) [-1505.956] (-1506.284) (-1515.147) * (-1513.603) (-1509.457) (-1510.954) [-1509.603] -- 0:01:41
245000 -- (-1510.390) (-1503.797) [-1506.797] (-1514.773) * (-1514.362) (-1508.974) (-1516.709) [-1504.918] -- 0:01:41
Average standard deviation of split frequencies: 0.011498
245500 -- [-1512.162] (-1506.277) (-1511.698) (-1508.962) * (-1513.104) (-1508.865) [-1509.767] (-1512.323) -- 0:01:41
246000 -- (-1508.870) (-1506.163) (-1514.642) [-1510.745] * (-1510.446) (-1507.453) (-1513.258) [-1505.167] -- 0:01:41
246500 -- (-1510.691) (-1513.401) (-1505.830) [-1506.849] * [-1508.486] (-1509.601) (-1510.045) (-1504.718) -- 0:01:43
247000 -- (-1508.650) (-1507.331) (-1509.810) [-1507.917] * (-1510.841) [-1511.049] (-1507.109) (-1505.413) -- 0:01:43
247500 -- (-1506.283) [-1504.810] (-1516.307) (-1513.082) * (-1516.275) [-1505.943] (-1509.214) (-1509.030) -- 0:01:43
248000 -- (-1512.379) (-1510.388) [-1508.183] (-1508.277) * (-1512.854) [-1505.568] (-1510.132) (-1508.789) -- 0:01:43
248500 -- (-1513.034) (-1513.144) [-1505.564] (-1513.419) * [-1507.264] (-1508.972) (-1505.541) (-1510.730) -- 0:01:42
249000 -- [-1508.123] (-1512.389) (-1507.498) (-1515.680) * (-1516.010) (-1508.917) (-1507.153) [-1507.147] -- 0:01:42
249500 -- [-1508.531] (-1512.259) (-1510.692) (-1512.333) * (-1517.104) (-1513.035) (-1508.817) [-1503.790] -- 0:01:42
250000 -- (-1507.136) [-1507.373] (-1513.428) (-1514.734) * [-1507.307] (-1513.672) (-1506.343) (-1506.509) -- 0:01:42
Average standard deviation of split frequencies: 0.013164
250500 -- (-1510.438) [-1506.977] (-1511.786) (-1512.161) * (-1506.424) (-1506.981) [-1507.559] (-1514.929) -- 0:01:41
251000 -- (-1510.487) [-1507.202] (-1508.662) (-1512.742) * (-1511.764) (-1507.818) [-1510.243] (-1511.424) -- 0:01:41
251500 -- (-1513.497) (-1507.183) [-1507.980] (-1518.332) * (-1508.793) (-1506.531) [-1509.047] (-1510.826) -- 0:01:41
252000 -- (-1509.909) (-1508.522) (-1513.285) [-1510.692] * (-1510.216) (-1511.760) (-1503.516) [-1511.750] -- 0:01:40
252500 -- (-1510.680) (-1507.546) (-1511.121) [-1509.157] * (-1516.926) (-1517.047) [-1506.549] (-1506.649) -- 0:01:40
253000 -- [-1506.237] (-1507.114) (-1509.455) (-1511.326) * [-1506.524] (-1510.347) (-1506.202) (-1511.547) -- 0:01:40
253500 -- (-1508.151) (-1508.383) [-1505.405] (-1508.442) * (-1508.002) [-1507.247] (-1506.942) (-1511.582) -- 0:01:43
254000 -- (-1508.915) [-1507.779] (-1509.563) (-1514.166) * [-1508.097] (-1510.771) (-1504.895) (-1507.693) -- 0:01:42
254500 -- (-1508.266) [-1515.034] (-1507.149) (-1514.957) * [-1504.129] (-1512.555) (-1512.490) (-1505.915) -- 0:01:42
255000 -- [-1508.474] (-1507.499) (-1511.049) (-1511.183) * (-1506.141) (-1514.660) [-1507.100] (-1512.918) -- 0:01:42
Average standard deviation of split frequencies: 0.011969
255500 -- (-1512.651) (-1507.309) [-1508.869] (-1507.154) * (-1507.250) (-1510.728) (-1508.718) [-1511.893] -- 0:01:41
256000 -- (-1513.986) (-1509.699) (-1510.358) [-1509.571] * [-1514.835] (-1508.579) (-1511.891) (-1511.774) -- 0:01:41
256500 -- [-1510.934] (-1510.195) (-1511.514) (-1513.566) * (-1508.160) (-1506.044) [-1504.404] (-1516.967) -- 0:01:41
257000 -- (-1509.755) (-1515.421) [-1507.824] (-1513.803) * [-1512.876] (-1511.073) (-1507.978) (-1513.936) -- 0:01:41
257500 -- [-1504.992] (-1508.050) (-1512.152) (-1518.179) * (-1511.075) (-1507.953) (-1511.578) [-1514.625] -- 0:01:40
258000 -- (-1507.178) (-1512.794) (-1509.438) [-1510.806] * (-1513.091) [-1507.413] (-1508.746) (-1508.662) -- 0:01:40
258500 -- (-1511.140) [-1511.843] (-1514.046) (-1510.367) * (-1508.755) (-1510.860) (-1505.512) [-1511.248] -- 0:01:40
259000 -- (-1510.318) [-1509.272] (-1507.426) (-1510.889) * (-1512.496) (-1509.502) [-1502.948] (-1509.231) -- 0:01:40
259500 -- (-1507.182) (-1510.418) (-1506.042) [-1511.259] * (-1513.652) (-1507.198) [-1505.536] (-1508.573) -- 0:01:39
260000 -- (-1515.493) [-1511.173] (-1509.565) (-1505.994) * (-1511.305) (-1507.632) (-1510.538) [-1508.144] -- 0:01:39
Average standard deviation of split frequencies: 0.012659
260500 -- (-1514.408) (-1515.835) (-1509.919) [-1505.936] * (-1508.323) [-1508.103] (-1506.294) (-1512.658) -- 0:01:39
261000 -- (-1507.885) (-1510.890) (-1509.010) [-1511.489] * [-1510.800] (-1510.524) (-1513.917) (-1512.901) -- 0:01:41
261500 -- (-1521.400) (-1511.023) (-1504.976) [-1510.206] * (-1513.005) (-1510.124) (-1512.881) [-1513.933] -- 0:01:41
262000 -- (-1510.402) (-1514.116) (-1509.919) [-1512.808] * (-1515.145) [-1508.897] (-1513.111) (-1509.728) -- 0:01:41
262500 -- [-1508.137] (-1511.757) (-1506.969) (-1513.088) * (-1517.854) (-1511.074) (-1505.388) [-1507.797] -- 0:01:41
263000 -- (-1512.221) (-1504.151) (-1507.521) [-1505.892] * [-1510.794] (-1512.468) (-1508.348) (-1513.800) -- 0:01:40
263500 -- (-1519.668) [-1504.693] (-1513.050) (-1508.470) * [-1504.637] (-1509.645) (-1508.338) (-1512.066) -- 0:01:40
264000 -- (-1512.148) (-1507.067) [-1505.179] (-1508.381) * (-1508.196) [-1505.235] (-1511.482) (-1506.947) -- 0:01:40
264500 -- (-1508.016) [-1507.282] (-1511.406) (-1507.666) * [-1514.483] (-1507.295) (-1511.819) (-1511.977) -- 0:01:40
265000 -- (-1509.731) (-1508.259) [-1506.375] (-1507.520) * [-1509.491] (-1513.359) (-1508.030) (-1509.498) -- 0:01:39
Average standard deviation of split frequencies: 0.014178
265500 -- (-1507.806) (-1510.037) (-1511.505) [-1507.013] * [-1507.323] (-1509.142) (-1512.878) (-1511.138) -- 0:01:39
266000 -- [-1513.135] (-1511.300) (-1505.088) (-1504.251) * (-1509.491) [-1507.136] (-1513.748) (-1516.877) -- 0:01:39
266500 -- (-1510.910) (-1511.773) [-1507.037] (-1505.952) * (-1510.987) [-1504.133] (-1518.724) (-1509.712) -- 0:01:39
267000 -- (-1505.963) (-1508.710) (-1513.040) [-1511.460] * (-1511.719) [-1507.270] (-1520.459) (-1508.694) -- 0:01:38
267500 -- [-1511.955] (-1508.657) (-1513.709) (-1508.620) * (-1513.630) (-1507.439) (-1508.336) [-1503.806] -- 0:01:38
268000 -- [-1511.763] (-1507.913) (-1517.941) (-1511.614) * (-1509.628) [-1504.839] (-1510.322) (-1509.616) -- 0:01:38
268500 -- [-1508.411] (-1512.609) (-1514.239) (-1512.752) * (-1509.590) (-1507.704) (-1519.321) [-1508.929] -- 0:01:40
269000 -- (-1510.843) (-1514.461) [-1508.208] (-1510.698) * (-1509.592) (-1508.840) (-1509.155) [-1504.941] -- 0:01:40
269500 -- (-1514.822) (-1514.177) (-1510.507) [-1507.905] * (-1507.919) (-1507.620) [-1510.302] (-1505.783) -- 0:01:40
270000 -- (-1507.156) (-1509.625) (-1507.898) [-1512.718] * (-1506.218) (-1509.980) (-1510.815) [-1503.058] -- 0:01:40
Average standard deviation of split frequencies: 0.020029
270500 -- (-1511.088) (-1510.716) [-1509.402] (-1506.268) * (-1510.277) [-1509.624] (-1508.915) (-1513.482) -- 0:01:39
271000 -- (-1512.996) (-1513.310) (-1508.440) [-1509.301] * (-1515.084) (-1509.512) (-1514.596) [-1504.251] -- 0:01:39
271500 -- (-1512.053) [-1507.776] (-1511.321) (-1513.311) * (-1508.019) (-1518.611) (-1518.784) [-1510.121] -- 0:01:39
272000 -- [-1510.031] (-1507.081) (-1513.633) (-1508.422) * (-1508.521) [-1509.420] (-1509.961) (-1511.481) -- 0:01:39
272500 -- (-1506.774) (-1510.499) (-1505.336) [-1512.385] * (-1510.511) [-1508.749] (-1515.886) (-1514.653) -- 0:01:38
273000 -- (-1504.687) (-1511.367) [-1513.577] (-1509.616) * (-1508.288) (-1510.106) (-1514.076) [-1510.017] -- 0:01:38
273500 -- (-1510.749) (-1511.526) [-1509.431] (-1511.821) * [-1508.652] (-1507.925) (-1521.532) (-1506.454) -- 0:01:38
274000 -- (-1506.102) (-1510.325) (-1509.308) [-1506.783] * [-1509.694] (-1507.740) (-1510.832) (-1515.842) -- 0:01:38
274500 -- (-1508.581) [-1512.556] (-1511.771) (-1508.756) * [-1504.835] (-1506.616) (-1505.013) (-1507.048) -- 0:01:37
275000 -- (-1506.435) (-1514.903) [-1508.596] (-1517.894) * [-1508.436] (-1511.548) (-1511.689) (-1510.720) -- 0:01:37
Average standard deviation of split frequencies: 0.017080
275500 -- (-1510.167) (-1507.572) [-1506.688] (-1512.920) * (-1506.297) (-1509.725) (-1506.791) [-1508.535] -- 0:01:39
276000 -- (-1510.575) (-1513.768) [-1508.546] (-1509.580) * (-1510.477) (-1507.928) (-1506.990) [-1508.685] -- 0:01:39
276500 -- (-1509.719) [-1514.084] (-1513.929) (-1520.104) * (-1514.231) [-1512.009] (-1511.837) (-1508.672) -- 0:01:39
277000 -- (-1507.735) [-1507.484] (-1506.808) (-1516.906) * (-1504.998) (-1512.597) (-1515.948) [-1507.249] -- 0:01:39
277500 -- [-1507.354] (-1508.137) (-1507.895) (-1509.072) * (-1506.342) [-1514.875] (-1507.747) (-1511.652) -- 0:01:38
278000 -- (-1511.618) (-1507.984) [-1506.096] (-1516.211) * [-1505.586] (-1511.610) (-1512.574) (-1509.872) -- 0:01:38
278500 -- (-1511.103) (-1509.981) [-1507.119] (-1510.084) * [-1506.928] (-1511.617) (-1515.866) (-1511.091) -- 0:01:38
279000 -- (-1508.276) (-1515.335) [-1511.292] (-1508.245) * [-1509.967] (-1513.574) (-1523.038) (-1513.747) -- 0:01:38
279500 -- (-1505.775) [-1508.526] (-1507.442) (-1508.303) * (-1516.118) [-1511.123] (-1510.974) (-1509.706) -- 0:01:37
280000 -- (-1507.471) (-1510.034) [-1512.964] (-1514.914) * (-1509.458) (-1506.837) (-1512.682) [-1512.729] -- 0:01:37
Average standard deviation of split frequencies: 0.013437
280500 -- (-1503.529) [-1506.439] (-1517.303) (-1517.544) * (-1509.469) (-1513.150) (-1509.795) [-1506.496] -- 0:01:37
281000 -- (-1513.649) (-1506.435) [-1513.002] (-1514.761) * (-1511.562) (-1509.446) [-1510.253] (-1509.049) -- 0:01:37
281500 -- (-1510.092) [-1505.565] (-1503.930) (-1511.332) * [-1509.670] (-1512.403) (-1514.332) (-1509.032) -- 0:01:36
282000 -- [-1509.926] (-1514.270) (-1508.805) (-1511.010) * (-1508.466) (-1513.001) [-1516.491] (-1513.468) -- 0:01:36
282500 -- [-1508.272] (-1515.808) (-1507.084) (-1514.695) * (-1513.171) (-1513.869) (-1511.015) [-1510.554] -- 0:01:36
283000 -- (-1510.707) (-1508.317) [-1506.903] (-1512.536) * (-1510.680) (-1509.337) [-1509.759] (-1516.138) -- 0:01:38
283500 -- (-1514.545) (-1509.280) [-1506.063] (-1514.545) * (-1513.503) (-1514.588) (-1509.608) [-1511.030] -- 0:01:38
284000 -- (-1516.373) (-1511.189) (-1507.337) [-1509.122] * (-1511.050) (-1507.387) [-1509.195] (-1512.044) -- 0:01:38
284500 -- (-1507.364) (-1513.101) [-1505.150] (-1507.366) * [-1511.693] (-1506.296) (-1509.293) (-1512.414) -- 0:01:38
285000 -- (-1512.391) (-1509.604) [-1507.806] (-1508.352) * (-1508.052) (-1511.483) [-1504.514] (-1514.287) -- 0:01:37
Average standard deviation of split frequencies: 0.006593
285500 -- (-1509.083) (-1508.370) (-1504.228) [-1507.152] * (-1510.628) [-1509.418] (-1509.666) (-1512.710) -- 0:01:37
286000 -- (-1509.366) (-1508.303) (-1511.625) [-1505.312] * (-1514.668) [-1504.277] (-1507.563) (-1512.925) -- 0:01:37
286500 -- (-1511.164) (-1504.788) (-1507.258) [-1513.179] * [-1515.389] (-1511.386) (-1506.176) (-1513.190) -- 0:01:37
287000 -- [-1505.812] (-1510.719) (-1517.688) (-1509.031) * (-1510.288) [-1510.343] (-1510.999) (-1514.203) -- 0:01:36
287500 -- (-1513.240) (-1510.501) (-1510.687) [-1511.371] * [-1507.890] (-1505.495) (-1517.627) (-1510.746) -- 0:01:36
288000 -- (-1511.476) (-1514.837) [-1513.161] (-1509.546) * (-1508.830) (-1513.798) (-1512.267) [-1506.262] -- 0:01:36
288500 -- [-1507.137] (-1509.300) (-1512.045) (-1510.748) * (-1509.648) (-1513.364) [-1506.709] (-1507.897) -- 0:01:36
289000 -- (-1508.419) (-1509.883) [-1505.514] (-1507.069) * [-1513.871] (-1508.199) (-1510.772) (-1510.427) -- 0:01:35
289500 -- (-1508.873) (-1510.697) [-1506.841] (-1508.849) * (-1510.972) (-1506.846) (-1508.061) [-1506.148] -- 0:01:35
290000 -- (-1507.951) (-1510.697) (-1506.949) [-1507.045] * (-1511.369) (-1511.521) [-1506.702] (-1514.690) -- 0:01:35
Average standard deviation of split frequencies: 0.005676
290500 -- (-1507.538) [-1507.086] (-1505.114) (-1510.287) * (-1515.052) (-1506.963) (-1508.299) [-1512.721] -- 0:01:37
291000 -- (-1511.270) (-1508.973) (-1506.610) [-1508.725] * (-1511.321) (-1510.901) (-1510.634) [-1509.728] -- 0:01:37
291500 -- (-1510.907) (-1509.859) (-1503.807) [-1506.274] * (-1513.519) [-1508.508] (-1510.901) (-1516.299) -- 0:01:37
292000 -- (-1514.394) [-1509.883] (-1506.072) (-1511.173) * (-1512.298) (-1511.094) (-1519.628) [-1507.253] -- 0:01:36
292500 -- (-1510.143) [-1506.448] (-1511.479) (-1511.763) * (-1514.499) [-1513.348] (-1514.267) (-1509.769) -- 0:01:36
293000 -- (-1505.676) [-1506.555] (-1512.993) (-1511.609) * [-1508.638] (-1513.768) (-1513.183) (-1504.998) -- 0:01:36
293500 -- (-1510.253) (-1512.946) (-1510.216) [-1506.822] * [-1507.094] (-1513.500) (-1518.122) (-1506.480) -- 0:01:36
294000 -- (-1511.535) (-1514.117) [-1507.716] (-1517.231) * (-1507.751) [-1510.384] (-1513.028) (-1508.218) -- 0:01:36
294500 -- [-1509.270] (-1515.964) (-1506.726) (-1510.551) * [-1510.051] (-1512.260) (-1511.974) (-1508.613) -- 0:01:35
295000 -- (-1511.960) (-1510.304) (-1510.046) [-1515.002] * (-1508.636) (-1507.098) (-1509.886) [-1508.543] -- 0:01:35
Average standard deviation of split frequencies: 0.001593
295500 -- (-1513.624) (-1508.678) (-1507.956) [-1511.335] * (-1512.259) (-1509.004) [-1507.917] (-1508.854) -- 0:01:35
296000 -- (-1512.913) [-1506.037] (-1507.159) (-1509.554) * (-1508.282) [-1511.095] (-1507.864) (-1510.851) -- 0:01:35
296500 -- (-1520.022) (-1509.018) [-1508.066] (-1511.128) * (-1513.240) (-1511.550) [-1508.701] (-1508.933) -- 0:01:34
297000 -- (-1507.803) [-1511.622] (-1511.390) (-1511.789) * (-1511.448) [-1510.596] (-1512.694) (-1510.548) -- 0:01:34
297500 -- [-1516.202] (-1514.675) (-1511.507) (-1510.058) * (-1508.910) (-1514.706) (-1509.471) [-1510.234] -- 0:01:36
298000 -- (-1519.325) (-1508.615) [-1508.380] (-1510.581) * (-1509.273) (-1513.043) (-1507.628) [-1508.796] -- 0:01:36
298500 -- (-1517.385) (-1508.560) [-1513.559] (-1509.535) * (-1506.357) [-1508.678] (-1508.285) (-1510.460) -- 0:01:36
299000 -- [-1506.911] (-1514.683) (-1511.410) (-1513.491) * (-1506.628) (-1511.416) [-1510.333] (-1509.831) -- 0:01:36
299500 -- (-1516.706) [-1510.692] (-1518.422) (-1512.140) * [-1505.124] (-1515.466) (-1509.306) (-1513.892) -- 0:01:35
300000 -- [-1513.486] (-1506.329) (-1513.611) (-1510.479) * (-1512.843) [-1511.305] (-1512.161) (-1513.683) -- 0:01:35
Average standard deviation of split frequencies: 0.004704
300500 -- (-1513.640) (-1506.864) (-1507.486) [-1504.548] * (-1505.191) [-1507.263] (-1511.627) (-1511.504) -- 0:01:35
301000 -- (-1506.562) (-1508.581) (-1506.609) [-1505.981] * [-1505.259] (-1509.258) (-1506.775) (-1512.077) -- 0:01:35
301500 -- (-1506.244) [-1508.742] (-1508.163) (-1509.755) * (-1504.555) (-1515.051) [-1507.729] (-1511.489) -- 0:01:34
302000 -- (-1513.444) (-1505.517) (-1507.427) [-1513.266] * (-1515.194) [-1507.814] (-1511.595) (-1510.880) -- 0:01:34
302500 -- (-1505.964) (-1508.709) [-1505.825] (-1507.816) * (-1510.381) (-1516.972) (-1504.743) [-1510.383] -- 0:01:34
303000 -- (-1509.288) [-1508.701] (-1508.634) (-1512.974) * (-1516.629) [-1511.821] (-1510.488) (-1508.734) -- 0:01:34
303500 -- (-1504.569) [-1507.198] (-1507.023) (-1510.890) * (-1508.077) (-1511.075) (-1511.653) [-1511.694] -- 0:01:34
304000 -- (-1510.335) (-1507.339) (-1509.209) [-1507.098] * (-1510.080) (-1512.746) (-1510.154) [-1509.710] -- 0:01:33
304500 -- (-1512.639) [-1507.950] (-1507.448) (-1509.399) * (-1510.551) (-1514.003) [-1510.000] (-1514.126) -- 0:01:33
305000 -- (-1510.976) (-1512.582) [-1513.179] (-1512.722) * (-1505.886) (-1509.882) (-1505.066) [-1510.101] -- 0:01:35
Average standard deviation of split frequencies: 0.003081
305500 -- (-1509.473) (-1509.930) [-1506.675] (-1512.018) * (-1505.333) (-1508.895) (-1515.709) [-1508.854] -- 0:01:35
306000 -- [-1507.148] (-1507.597) (-1508.286) (-1508.761) * [-1508.096] (-1515.161) (-1507.885) (-1507.995) -- 0:01:35
306500 -- [-1506.748] (-1513.370) (-1516.894) (-1509.319) * (-1508.738) (-1518.039) [-1509.030] (-1510.285) -- 0:01:35
307000 -- (-1510.629) (-1514.975) (-1507.155) [-1511.747] * (-1509.399) (-1509.877) (-1513.418) [-1507.131] -- 0:01:34
307500 -- (-1515.258) (-1517.098) (-1509.506) [-1512.055] * [-1509.181] (-1507.056) (-1510.279) (-1513.585) -- 0:01:34
308000 -- (-1509.474) [-1508.981] (-1508.891) (-1508.510) * (-1510.782) [-1508.113] (-1513.798) (-1507.373) -- 0:01:34
308500 -- [-1506.302] (-1510.951) (-1507.578) (-1507.824) * (-1513.777) (-1508.220) (-1511.443) [-1511.957] -- 0:01:34
309000 -- [-1511.032] (-1517.163) (-1513.880) (-1514.352) * (-1516.737) (-1513.206) [-1505.736] (-1515.503) -- 0:01:33
309500 -- [-1504.350] (-1512.341) (-1509.127) (-1511.266) * (-1512.762) (-1516.447) (-1507.431) [-1516.164] -- 0:01:33
310000 -- (-1510.340) (-1507.317) (-1509.245) [-1512.907] * (-1512.514) (-1516.946) (-1511.157) [-1509.576] -- 0:01:33
Average standard deviation of split frequencies: 0.003035
310500 -- [-1507.421] (-1506.027) (-1511.488) (-1516.017) * [-1508.246] (-1511.159) (-1505.789) (-1509.492) -- 0:01:33
311000 -- (-1509.506) [-1508.799] (-1509.348) (-1516.092) * (-1511.891) [-1506.238] (-1509.396) (-1506.844) -- 0:01:33
311500 -- (-1510.938) (-1508.205) (-1507.924) [-1507.884] * (-1513.854) (-1503.951) (-1508.646) [-1506.747] -- 0:01:32
312000 -- (-1509.195) (-1510.848) (-1511.037) [-1507.291] * [-1513.929] (-1510.288) (-1509.674) (-1512.793) -- 0:01:34
312500 -- (-1507.857) (-1517.781) (-1507.833) [-1512.832] * (-1510.937) (-1512.373) [-1507.974] (-1512.537) -- 0:01:34
313000 -- (-1510.223) (-1511.194) [-1511.877] (-1508.514) * [-1506.637] (-1508.907) (-1511.086) (-1510.138) -- 0:01:34
313500 -- (-1507.500) (-1509.279) (-1509.937) [-1510.887] * [-1511.871] (-1509.423) (-1520.491) (-1514.153) -- 0:01:34
314000 -- (-1512.793) [-1509.533] (-1514.712) (-1516.611) * [-1506.838] (-1508.960) (-1512.266) (-1516.324) -- 0:01:33
314500 -- [-1510.199] (-1506.894) (-1505.800) (-1507.987) * [-1508.798] (-1509.688) (-1509.369) (-1513.842) -- 0:01:33
315000 -- (-1509.143) (-1507.343) (-1511.544) [-1505.826] * [-1509.683] (-1509.064) (-1512.033) (-1507.386) -- 0:01:33
Average standard deviation of split frequencies: 0.002984
315500 -- (-1513.868) [-1504.771] (-1511.924) (-1507.008) * (-1513.471) (-1509.418) [-1510.641] (-1508.735) -- 0:01:33
316000 -- (-1510.173) (-1505.694) (-1515.820) [-1510.218] * (-1510.466) [-1517.496] (-1508.856) (-1512.962) -- 0:01:33
316500 -- (-1507.611) (-1503.607) (-1514.075) [-1503.656] * [-1506.124] (-1510.140) (-1511.379) (-1513.049) -- 0:01:32
317000 -- (-1506.047) (-1514.694) [-1510.191] (-1507.782) * (-1509.443) (-1508.408) [-1506.079] (-1519.962) -- 0:01:32
317500 -- [-1509.082] (-1509.887) (-1511.283) (-1510.577) * (-1507.407) (-1505.679) [-1509.729] (-1510.066) -- 0:01:32
318000 -- [-1510.419] (-1510.925) (-1512.395) (-1506.978) * (-1508.461) (-1515.305) [-1509.211] (-1509.585) -- 0:01:32
318500 -- (-1512.348) (-1509.415) [-1510.382] (-1512.047) * [-1508.927] (-1517.643) (-1508.300) (-1513.406) -- 0:01:32
319000 -- (-1506.284) (-1515.086) (-1512.053) [-1510.129] * [-1505.717] (-1517.531) (-1506.018) (-1510.109) -- 0:01:31
319500 -- (-1511.821) (-1513.773) (-1512.412) [-1508.438] * (-1513.640) (-1509.648) (-1506.071) [-1507.356] -- 0:01:33
320000 -- (-1516.079) (-1512.727) [-1506.618] (-1507.239) * (-1511.776) [-1510.221] (-1510.280) (-1513.058) -- 0:01:33
Average standard deviation of split frequencies: 0.002205
320500 -- (-1514.706) (-1507.980) (-1506.616) [-1509.468] * [-1510.801] (-1509.137) (-1509.238) (-1508.049) -- 0:01:33
321000 -- (-1512.735) [-1506.208] (-1506.606) (-1511.064) * (-1505.283) (-1511.148) (-1508.745) [-1508.944] -- 0:01:33
321500 -- (-1514.799) (-1516.190) [-1507.263] (-1513.561) * (-1511.125) [-1508.706] (-1513.193) (-1509.791) -- 0:01:32
322000 -- [-1511.471] (-1514.609) (-1507.398) (-1515.896) * (-1511.666) (-1513.812) [-1510.580] (-1505.624) -- 0:01:32
322500 -- (-1513.407) (-1506.873) (-1504.573) [-1514.044] * (-1509.376) (-1514.379) [-1509.328] (-1510.542) -- 0:01:32
323000 -- (-1510.383) [-1507.383] (-1503.625) (-1512.680) * (-1508.617) (-1515.246) [-1512.268] (-1506.787) -- 0:01:32
323500 -- (-1507.653) [-1507.065] (-1510.548) (-1506.662) * (-1507.166) (-1510.361) [-1514.671] (-1506.388) -- 0:01:32
324000 -- (-1505.348) [-1506.495] (-1507.192) (-1508.548) * (-1509.483) [-1512.309] (-1509.870) (-1505.782) -- 0:01:31
324500 -- (-1506.905) [-1511.148] (-1515.657) (-1511.164) * (-1507.218) (-1509.009) (-1505.819) [-1507.473] -- 0:01:31
325000 -- (-1510.793) (-1508.483) [-1509.207] (-1508.624) * (-1510.001) (-1515.865) [-1508.916] (-1504.629) -- 0:01:31
Average standard deviation of split frequencies: 0.003615
325500 -- (-1507.110) (-1508.577) [-1510.301] (-1508.860) * (-1505.775) (-1508.106) (-1508.563) [-1506.845] -- 0:01:31
326000 -- (-1508.894) [-1512.353] (-1509.015) (-1511.922) * (-1507.338) [-1513.473] (-1510.421) (-1509.805) -- 0:01:30
326500 -- [-1508.640] (-1516.246) (-1510.453) (-1501.890) * (-1511.972) (-1510.561) [-1505.484] (-1509.145) -- 0:01:32
327000 -- (-1506.611) [-1509.996] (-1512.386) (-1504.876) * (-1510.703) (-1508.208) (-1507.996) [-1508.579] -- 0:01:32
327500 -- (-1507.678) (-1509.362) (-1508.492) [-1507.317] * (-1513.530) [-1506.598] (-1506.804) (-1511.113) -- 0:01:32
328000 -- (-1515.143) [-1508.827] (-1509.162) (-1509.773) * (-1514.986) (-1509.469) [-1505.743] (-1512.047) -- 0:01:32
328500 -- [-1511.926] (-1509.298) (-1508.521) (-1506.678) * (-1511.965) [-1507.524] (-1508.187) (-1511.109) -- 0:01:31
329000 -- (-1512.247) [-1511.072] (-1507.581) (-1505.961) * [-1511.044] (-1510.807) (-1507.960) (-1514.225) -- 0:01:31
329500 -- (-1509.121) [-1510.740] (-1517.368) (-1507.248) * (-1512.720) [-1507.057] (-1509.322) (-1513.979) -- 0:01:31
330000 -- (-1510.201) (-1517.763) [-1510.330] (-1506.811) * (-1508.402) (-1508.272) (-1507.717) [-1512.677] -- 0:01:31
Average standard deviation of split frequencies: 0.003564
330500 -- (-1508.797) [-1509.144] (-1506.763) (-1511.879) * (-1512.084) [-1508.453] (-1512.156) (-1515.295) -- 0:01:31
331000 -- [-1506.291] (-1505.649) (-1511.893) (-1509.520) * (-1515.362) [-1508.103] (-1516.997) (-1509.154) -- 0:01:30
331500 -- (-1505.060) (-1511.351) [-1510.206] (-1513.571) * (-1513.609) [-1508.341] (-1511.989) (-1508.619) -- 0:01:30
332000 -- (-1504.136) (-1505.831) (-1511.909) [-1507.980] * [-1511.525] (-1506.717) (-1509.140) (-1510.233) -- 0:01:30
332500 -- (-1507.872) (-1509.385) (-1511.874) [-1506.563] * (-1511.893) [-1510.767] (-1506.669) (-1510.896) -- 0:01:30
333000 -- [-1511.191] (-1508.050) (-1510.711) (-1512.917) * (-1510.475) (-1506.077) [-1510.373] (-1507.595) -- 0:01:30
333500 -- (-1508.826) (-1511.807) [-1507.620] (-1516.661) * (-1510.351) (-1508.482) [-1510.345] (-1513.895) -- 0:01:29
334000 -- (-1510.469) (-1511.095) [-1510.857] (-1516.979) * [-1507.353] (-1508.247) (-1514.050) (-1509.265) -- 0:01:31
334500 -- (-1507.760) [-1514.066] (-1508.870) (-1511.354) * [-1512.993] (-1516.269) (-1510.265) (-1506.512) -- 0:01:31
335000 -- (-1507.938) [-1509.213] (-1508.716) (-1514.388) * [-1507.748] (-1511.797) (-1511.522) (-1508.201) -- 0:01:31
Average standard deviation of split frequencies: 0.004209
335500 -- (-1507.121) [-1503.315] (-1505.853) (-1511.734) * (-1515.193) [-1508.500] (-1509.247) (-1507.987) -- 0:01:31
336000 -- (-1507.792) (-1504.698) [-1507.703] (-1510.061) * [-1517.063] (-1513.598) (-1506.529) (-1512.071) -- 0:01:30
336500 -- (-1507.112) [-1506.349] (-1507.026) (-1509.959) * (-1516.758) (-1509.569) (-1507.843) [-1506.227] -- 0:01:30
337000 -- (-1511.819) [-1510.373] (-1507.876) (-1512.996) * [-1505.392] (-1513.025) (-1514.719) (-1513.922) -- 0:01:30
337500 -- (-1509.437) (-1512.331) (-1511.293) [-1509.154] * (-1511.586) (-1510.132) [-1504.581] (-1507.923) -- 0:01:30
338000 -- (-1510.718) [-1509.134] (-1511.360) (-1513.419) * [-1511.077] (-1516.412) (-1505.514) (-1509.567) -- 0:01:30
338500 -- (-1509.096) (-1508.533) [-1511.257] (-1508.284) * (-1509.556) [-1506.302] (-1506.838) (-1512.650) -- 0:01:29
339000 -- (-1509.822) (-1510.906) [-1513.616] (-1511.588) * (-1509.707) (-1506.479) [-1507.281] (-1514.621) -- 0:01:29
339500 -- [-1509.353] (-1506.553) (-1509.570) (-1512.758) * [-1506.821] (-1505.141) (-1510.969) (-1513.513) -- 0:01:29
340000 -- (-1508.227) (-1509.946) (-1516.511) [-1508.310] * (-1507.914) [-1508.908] (-1519.646) (-1511.620) -- 0:01:29
Average standard deviation of split frequencies: 0.004151
340500 -- [-1511.711] (-1509.220) (-1516.797) (-1508.255) * (-1510.350) (-1511.151) (-1513.927) [-1510.692] -- 0:01:29
341000 -- (-1511.651) [-1507.130] (-1513.199) (-1516.009) * (-1513.191) (-1505.925) [-1508.224] (-1507.812) -- 0:01:30
341500 -- (-1509.397) [-1507.284] (-1514.116) (-1512.617) * (-1515.304) (-1512.042) [-1509.809] (-1510.700) -- 0:01:30
342000 -- [-1506.640] (-1510.076) (-1508.015) (-1511.751) * (-1515.954) (-1504.705) [-1511.307] (-1510.167) -- 0:01:30
342500 -- (-1510.175) [-1507.780] (-1518.052) (-1511.847) * (-1512.572) (-1510.240) [-1508.080] (-1513.984) -- 0:01:30
343000 -- (-1512.821) (-1512.693) (-1513.684) [-1515.386] * (-1516.788) (-1516.260) (-1508.482) [-1507.813] -- 0:01:30
343500 -- (-1513.320) (-1509.390) (-1511.110) [-1505.592] * (-1510.551) (-1512.691) [-1508.637] (-1509.563) -- 0:01:29
344000 -- (-1505.342) [-1508.084] (-1508.471) (-1508.461) * (-1515.318) [-1512.212] (-1510.263) (-1512.268) -- 0:01:29
344500 -- (-1509.480) (-1511.798) (-1507.293) [-1506.453] * (-1511.859) [-1507.301] (-1508.779) (-1509.149) -- 0:01:29
345000 -- [-1506.215] (-1507.354) (-1514.812) (-1503.236) * (-1507.085) [-1518.532] (-1510.235) (-1514.855) -- 0:01:29
Average standard deviation of split frequencies: 0.004769
345500 -- (-1504.376) (-1509.044) (-1510.611) [-1513.386] * (-1512.843) (-1507.422) (-1508.022) [-1508.003] -- 0:01:29
346000 -- [-1504.115] (-1506.434) (-1507.708) (-1508.824) * (-1507.598) [-1507.819] (-1515.965) (-1511.946) -- 0:01:28
346500 -- [-1505.449] (-1506.032) (-1512.054) (-1509.742) * (-1506.045) (-1516.194) (-1506.419) [-1510.101] -- 0:01:28
347000 -- (-1511.173) [-1502.871] (-1508.933) (-1511.375) * [-1511.981] (-1510.226) (-1511.305) (-1510.112) -- 0:01:28
347500 -- [-1508.193] (-1512.655) (-1509.766) (-1506.547) * (-1513.659) (-1513.963) [-1506.038] (-1507.910) -- 0:01:28
348000 -- [-1503.769] (-1515.211) (-1515.798) (-1514.885) * (-1512.541) (-1515.046) [-1510.875] (-1511.865) -- 0:01:28
348500 -- (-1504.824) (-1507.566) [-1508.836] (-1510.016) * [-1510.480] (-1510.821) (-1510.836) (-1508.404) -- 0:01:29
349000 -- [-1506.086] (-1505.544) (-1509.294) (-1510.906) * (-1509.201) (-1512.575) [-1507.053] (-1508.062) -- 0:01:29
349500 -- (-1506.943) [-1510.170] (-1504.118) (-1513.540) * (-1512.504) (-1514.451) (-1504.433) [-1507.359] -- 0:01:29
350000 -- [-1506.167] (-1512.184) (-1507.133) (-1508.748) * (-1515.505) (-1513.304) (-1508.228) [-1507.376] -- 0:01:29
Average standard deviation of split frequencies: 0.008066
350500 -- (-1503.996) [-1503.765] (-1513.510) (-1515.892) * (-1510.930) (-1507.423) (-1509.041) [-1508.718] -- 0:01:28
351000 -- (-1507.920) (-1507.973) (-1510.468) [-1513.273] * (-1507.412) [-1509.801] (-1504.059) (-1507.806) -- 0:01:28
351500 -- (-1503.941) (-1513.046) [-1506.926] (-1515.294) * (-1511.453) (-1515.088) (-1508.423) [-1510.519] -- 0:01:28
352000 -- (-1505.089) (-1507.076) (-1505.137) [-1510.380] * [-1512.003] (-1511.784) (-1510.249) (-1509.039) -- 0:01:28
352500 -- (-1512.360) (-1510.145) (-1511.872) [-1510.498] * [-1510.492] (-1509.208) (-1507.676) (-1510.796) -- 0:01:28
353000 -- [-1510.500] (-1508.289) (-1508.800) (-1509.314) * (-1507.297) [-1509.338] (-1506.977) (-1513.267) -- 0:01:27
353500 -- (-1503.951) (-1510.270) [-1508.652] (-1507.940) * [-1506.520] (-1509.153) (-1508.832) (-1508.804) -- 0:01:27
354000 -- (-1511.481) (-1508.794) (-1506.014) [-1508.200] * [-1510.478] (-1506.575) (-1518.884) (-1516.626) -- 0:01:27
354500 -- (-1506.161) (-1507.174) [-1509.649] (-1509.227) * [-1514.686] (-1511.729) (-1511.069) (-1505.068) -- 0:01:27
355000 -- [-1507.031] (-1513.844) (-1509.876) (-1509.995) * (-1508.553) (-1506.625) [-1509.714] (-1504.090) -- 0:01:27
Average standard deviation of split frequencies: 0.007945
355500 -- [-1507.970] (-1510.357) (-1515.321) (-1511.317) * (-1507.247) (-1508.885) [-1506.824] (-1509.884) -- 0:01:27
356000 -- (-1510.020) [-1507.404] (-1513.456) (-1513.800) * (-1507.155) (-1510.656) (-1505.890) [-1508.148] -- 0:01:28
356500 -- (-1513.420) (-1508.833) (-1513.990) [-1508.257] * (-1512.724) [-1508.407] (-1505.527) (-1508.791) -- 0:01:28
357000 -- [-1512.063] (-1509.170) (-1516.454) (-1509.064) * (-1518.463) [-1513.931] (-1509.020) (-1514.241) -- 0:01:28
357500 -- [-1512.737] (-1511.218) (-1511.040) (-1504.395) * [-1509.739] (-1506.978) (-1507.684) (-1512.738) -- 0:01:28
358000 -- [-1507.364] (-1510.606) (-1513.292) (-1509.450) * (-1509.958) [-1510.967] (-1504.227) (-1510.268) -- 0:01:27
358500 -- (-1509.665) [-1508.839] (-1513.274) (-1510.929) * [-1509.155] (-1510.205) (-1508.531) (-1514.393) -- 0:01:27
359000 -- (-1508.130) (-1511.447) [-1510.715] (-1510.767) * (-1510.614) (-1509.971) [-1506.558] (-1517.463) -- 0:01:27
359500 -- (-1505.506) (-1506.127) [-1508.429] (-1509.029) * [-1511.973] (-1510.173) (-1506.407) (-1506.938) -- 0:01:27
360000 -- [-1510.594] (-1507.277) (-1509.319) (-1508.909) * (-1506.744) [-1506.627] (-1506.228) (-1506.711) -- 0:01:27
Average standard deviation of split frequencies: 0.005882
360500 -- (-1514.826) (-1506.593) [-1509.307] (-1503.345) * (-1509.293) (-1509.591) (-1508.300) [-1512.610] -- 0:01:26
361000 -- (-1514.692) [-1509.260] (-1508.267) (-1508.504) * (-1513.482) (-1509.140) [-1512.924] (-1512.679) -- 0:01:26
361500 -- [-1503.934] (-1511.189) (-1515.355) (-1512.895) * (-1510.204) (-1511.016) [-1506.112] (-1508.100) -- 0:01:26
362000 -- (-1504.838) [-1506.740] (-1516.753) (-1513.484) * (-1514.401) (-1516.920) (-1508.594) [-1513.996] -- 0:01:26
362500 -- (-1506.103) [-1510.185] (-1513.272) (-1510.224) * (-1508.563) [-1510.735] (-1514.102) (-1510.936) -- 0:01:26
363000 -- (-1506.968) (-1507.625) (-1508.855) [-1505.733] * (-1506.758) (-1507.400) (-1508.884) [-1514.408] -- 0:01:27
363500 -- (-1510.510) [-1509.350] (-1513.335) (-1509.261) * (-1512.723) [-1506.646] (-1508.823) (-1508.082) -- 0:01:27
364000 -- [-1512.726] (-1507.450) (-1507.332) (-1510.810) * (-1510.350) [-1506.271] (-1511.341) (-1506.104) -- 0:01:27
364500 -- (-1515.277) (-1509.854) [-1508.284] (-1510.012) * (-1510.553) [-1504.996] (-1509.538) (-1515.796) -- 0:01:27
365000 -- (-1513.809) (-1508.133) (-1512.427) [-1507.644] * [-1504.272] (-1512.489) (-1510.231) (-1512.183) -- 0:01:26
Average standard deviation of split frequencies: 0.002576
365500 -- (-1509.836) (-1509.490) (-1508.938) [-1510.322] * (-1508.338) [-1507.549] (-1508.130) (-1506.028) -- 0:01:26
366000 -- [-1512.192] (-1511.178) (-1510.138) (-1509.363) * (-1511.692) (-1510.294) [-1513.853] (-1508.716) -- 0:01:26
366500 -- (-1510.646) (-1516.584) [-1508.297] (-1507.799) * (-1508.731) [-1509.871] (-1515.748) (-1508.169) -- 0:01:26
367000 -- (-1515.070) (-1511.766) [-1508.837] (-1509.292) * (-1508.271) (-1512.985) (-1513.005) [-1510.166] -- 0:01:26
367500 -- (-1511.415) (-1505.725) (-1511.179) [-1507.947] * (-1507.032) (-1513.583) [-1504.444] (-1504.798) -- 0:01:26
368000 -- [-1512.043] (-1508.322) (-1511.905) (-1508.167) * (-1504.677) (-1512.121) [-1509.854] (-1505.894) -- 0:01:25
368500 -- (-1510.367) (-1509.942) [-1515.921] (-1509.900) * (-1511.188) (-1512.950) (-1506.396) [-1510.031] -- 0:01:25
369000 -- (-1513.902) [-1510.134] (-1516.938) (-1508.115) * [-1515.164] (-1512.720) (-1512.955) (-1506.672) -- 0:01:25
369500 -- [-1506.820] (-1507.576) (-1509.418) (-1509.839) * (-1507.162) (-1512.645) (-1508.590) [-1507.502] -- 0:01:25
370000 -- (-1513.692) (-1508.589) [-1508.288] (-1507.919) * [-1507.961] (-1507.864) (-1512.826) (-1505.877) -- 0:01:25
Average standard deviation of split frequencies: 0.002544
370500 -- (-1508.497) (-1510.292) [-1510.007] (-1509.015) * (-1506.689) (-1509.552) (-1518.968) [-1507.768] -- 0:01:26
371000 -- [-1505.675] (-1509.977) (-1511.455) (-1511.021) * (-1511.984) [-1506.795] (-1514.851) (-1507.414) -- 0:01:26
371500 -- (-1509.767) (-1515.497) (-1507.415) [-1507.190] * (-1509.933) (-1507.933) (-1519.915) [-1509.760] -- 0:01:26
372000 -- (-1505.568) (-1504.756) [-1509.173] (-1509.926) * (-1509.986) (-1504.400) (-1517.037) [-1505.145] -- 0:01:26
372500 -- (-1506.839) (-1511.506) [-1506.024] (-1507.951) * (-1507.352) (-1506.320) (-1514.056) [-1508.711] -- 0:01:25
373000 -- (-1512.005) [-1510.884] (-1506.351) (-1505.324) * (-1513.407) (-1503.965) (-1514.080) [-1506.916] -- 0:01:25
373500 -- [-1505.543] (-1508.705) (-1506.093) (-1508.090) * (-1515.722) (-1508.329) (-1516.998) [-1506.300] -- 0:01:25
374000 -- (-1510.842) [-1506.269] (-1511.065) (-1508.886) * (-1510.366) [-1504.945] (-1521.877) (-1508.084) -- 0:01:25
374500 -- [-1508.501] (-1508.735) (-1515.970) (-1515.097) * (-1509.127) [-1506.684] (-1509.659) (-1507.484) -- 0:01:25
375000 -- [-1506.992] (-1513.030) (-1514.461) (-1514.788) * (-1511.049) (-1508.657) (-1510.355) [-1508.469] -- 0:01:25
Average standard deviation of split frequencies: 0.002507
375500 -- (-1504.667) (-1508.232) (-1514.308) [-1513.213] * (-1512.666) (-1509.662) [-1510.315] (-1509.394) -- 0:01:24
376000 -- [-1504.532] (-1512.659) (-1511.645) (-1511.088) * (-1513.079) [-1508.139] (-1509.205) (-1519.913) -- 0:01:24
376500 -- [-1510.782] (-1509.109) (-1508.779) (-1512.201) * (-1510.592) (-1503.028) (-1504.448) [-1512.134] -- 0:01:24
377000 -- (-1517.177) [-1508.418] (-1506.145) (-1511.700) * (-1511.556) [-1511.911] (-1505.692) (-1509.677) -- 0:01:24
377500 -- (-1512.038) (-1513.011) [-1502.057] (-1518.562) * [-1509.221] (-1516.304) (-1508.579) (-1507.199) -- 0:01:24
378000 -- [-1506.654] (-1507.742) (-1505.981) (-1512.367) * (-1509.770) [-1508.757] (-1507.587) (-1510.867) -- 0:01:25
378500 -- (-1510.233) (-1511.354) (-1505.951) [-1504.124] * (-1523.055) (-1511.234) [-1508.419] (-1509.767) -- 0:01:25
379000 -- (-1507.482) (-1516.384) (-1504.860) [-1505.417] * [-1511.166] (-1511.432) (-1509.482) (-1511.529) -- 0:01:25
379500 -- [-1504.662] (-1512.365) (-1504.957) (-1512.958) * (-1509.003) (-1505.344) (-1509.638) [-1507.756] -- 0:01:25
380000 -- (-1507.702) (-1509.676) (-1506.727) [-1513.284] * (-1507.672) (-1506.806) (-1509.900) [-1507.970] -- 0:01:24
Average standard deviation of split frequencies: 0.003096
380500 -- (-1510.889) (-1509.945) (-1509.872) [-1508.096] * (-1507.129) [-1509.479] (-1511.958) (-1509.911) -- 0:01:24
381000 -- (-1517.047) (-1520.861) [-1504.998] (-1507.939) * [-1510.817] (-1506.090) (-1520.481) (-1508.775) -- 0:01:24
381500 -- (-1506.354) (-1516.751) [-1503.553] (-1513.596) * [-1504.703] (-1512.707) (-1515.967) (-1515.732) -- 0:01:24
382000 -- (-1509.146) (-1515.578) [-1507.715] (-1513.736) * [-1511.194] (-1508.376) (-1512.147) (-1510.393) -- 0:01:24
382500 -- (-1513.491) (-1515.412) [-1508.159] (-1514.954) * [-1508.291] (-1508.738) (-1515.656) (-1507.490) -- 0:01:23
383000 -- (-1510.201) (-1513.879) [-1508.353] (-1510.135) * [-1508.665] (-1508.249) (-1521.190) (-1511.591) -- 0:01:23
383500 -- [-1509.374] (-1511.064) (-1508.198) (-1508.971) * (-1511.179) (-1508.641) [-1510.019] (-1515.838) -- 0:01:23
384000 -- (-1508.804) (-1511.779) (-1511.698) [-1509.247] * (-1512.774) [-1515.071] (-1515.749) (-1510.834) -- 0:01:23
384500 -- [-1508.007] (-1512.972) (-1509.855) (-1507.790) * (-1510.257) [-1511.214] (-1510.584) (-1515.499) -- 0:01:23
385000 -- (-1505.547) [-1509.519] (-1507.768) (-1507.007) * [-1506.325] (-1515.108) (-1512.296) (-1516.675) -- 0:01:24
Average standard deviation of split frequencies: 0.003053
385500 -- (-1507.085) (-1508.844) (-1508.610) [-1518.448] * [-1507.115] (-1513.824) (-1514.340) (-1511.620) -- 0:01:24
386000 -- [-1507.321] (-1509.979) (-1503.808) (-1512.277) * (-1506.704) (-1513.512) [-1506.929] (-1516.795) -- 0:01:24
386500 -- (-1507.159) (-1508.770) [-1512.233] (-1509.204) * [-1506.308] (-1509.064) (-1515.754) (-1511.899) -- 0:01:24
387000 -- (-1510.074) (-1511.543) [-1506.432] (-1513.758) * (-1505.041) (-1509.747) [-1513.060] (-1509.878) -- 0:01:23
387500 -- (-1512.164) (-1510.002) [-1508.627] (-1511.269) * (-1510.632) (-1509.659) (-1509.828) [-1508.005] -- 0:01:23
388000 -- [-1509.384] (-1506.389) (-1509.062) (-1509.827) * (-1513.026) [-1514.850] (-1509.349) (-1506.339) -- 0:01:23
388500 -- [-1504.296] (-1506.147) (-1513.782) (-1508.306) * [-1508.723] (-1509.236) (-1509.717) (-1512.608) -- 0:01:23
389000 -- (-1508.829) (-1511.219) [-1505.655] (-1508.314) * (-1505.320) [-1509.034] (-1509.758) (-1510.637) -- 0:01:23
389500 -- (-1508.329) (-1508.549) [-1507.738] (-1511.042) * (-1512.451) [-1508.469] (-1507.030) (-1503.428) -- 0:01:23
390000 -- [-1510.180] (-1509.437) (-1507.290) (-1507.159) * (-1514.761) (-1510.682) (-1507.441) [-1514.236] -- 0:01:22
Average standard deviation of split frequencies: 0.003017
390500 -- [-1510.309] (-1505.627) (-1507.357) (-1505.067) * (-1509.942) [-1511.699] (-1512.038) (-1512.506) -- 0:01:22
391000 -- (-1510.984) (-1508.222) [-1507.340] (-1510.261) * (-1510.817) [-1503.813] (-1509.073) (-1510.305) -- 0:01:22
391500 -- (-1511.940) (-1507.679) [-1502.116] (-1508.752) * (-1510.538) (-1512.289) [-1510.316] (-1513.020) -- 0:01:22
392000 -- (-1516.677) (-1514.106) (-1505.402) [-1507.511] * (-1509.359) (-1511.163) (-1510.361) [-1514.161] -- 0:01:22
392500 -- (-1516.350) (-1507.098) [-1505.321] (-1511.283) * (-1512.496) (-1510.257) [-1508.195] (-1515.649) -- 0:01:23
393000 -- [-1509.438] (-1515.057) (-1509.998) (-1504.993) * (-1512.942) (-1509.845) [-1512.205] (-1509.456) -- 0:01:23
393500 -- [-1509.562] (-1513.675) (-1514.409) (-1506.460) * (-1506.029) (-1508.729) [-1508.335] (-1509.515) -- 0:01:23
394000 -- (-1507.766) (-1513.892) (-1513.019) [-1504.026] * [-1505.145] (-1505.584) (-1505.164) (-1519.717) -- 0:01:23
394500 -- (-1509.709) (-1513.193) [-1511.603] (-1509.836) * [-1504.037] (-1507.461) (-1508.913) (-1517.477) -- 0:01:22
395000 -- (-1509.375) (-1509.831) [-1505.172] (-1509.383) * (-1508.172) [-1509.756] (-1508.988) (-1512.145) -- 0:01:22
Average standard deviation of split frequencies: 0.002976
395500 -- (-1509.362) (-1513.046) [-1506.607] (-1513.372) * (-1507.350) [-1510.609] (-1515.029) (-1511.356) -- 0:01:22
396000 -- (-1516.291) (-1515.740) (-1503.927) [-1513.923] * (-1510.449) (-1506.811) (-1516.359) [-1507.222] -- 0:01:22
396500 -- [-1514.234] (-1507.346) (-1508.662) (-1512.906) * (-1510.320) [-1508.592] (-1518.674) (-1508.967) -- 0:01:22
397000 -- (-1510.684) (-1505.832) (-1512.759) [-1512.674] * (-1507.111) [-1506.915] (-1515.919) (-1507.097) -- 0:01:22
397500 -- (-1509.133) (-1511.803) (-1510.313) [-1509.145] * [-1508.510] (-1516.169) (-1506.610) (-1511.040) -- 0:01:21
398000 -- (-1516.959) (-1510.586) [-1508.067] (-1512.880) * (-1508.157) (-1516.529) [-1507.599] (-1509.639) -- 0:01:21
398500 -- [-1512.922] (-1510.725) (-1510.848) (-1509.117) * [-1508.301] (-1511.675) (-1511.521) (-1513.081) -- 0:01:21
399000 -- (-1511.038) (-1509.110) (-1511.220) [-1507.929] * (-1508.455) (-1511.143) (-1510.465) [-1509.506] -- 0:01:21
399500 -- [-1503.143] (-1513.200) (-1511.078) (-1513.923) * (-1511.988) (-1509.775) [-1509.955] (-1514.615) -- 0:01:21
400000 -- (-1509.806) [-1505.635] (-1513.391) (-1508.251) * (-1508.414) (-1510.850) [-1512.112] (-1514.937) -- 0:01:22
Average standard deviation of split frequencies: 0.004118
400500 -- (-1507.993) [-1505.471] (-1511.221) (-1507.931) * (-1509.025) [-1507.943] (-1507.361) (-1511.542) -- 0:01:22
401000 -- (-1518.579) (-1516.202) [-1511.020] (-1505.319) * (-1512.035) (-1509.186) [-1506.461] (-1512.843) -- 0:01:22
401500 -- (-1512.506) [-1504.679] (-1509.426) (-1508.321) * (-1511.281) (-1507.762) (-1512.218) [-1512.857] -- 0:01:21
402000 -- (-1512.933) [-1508.671] (-1513.548) (-1509.552) * (-1510.407) (-1515.308) [-1509.264] (-1507.453) -- 0:01:21
402500 -- (-1513.564) [-1507.912] (-1507.631) (-1512.143) * (-1505.278) (-1506.644) [-1503.438] (-1516.051) -- 0:01:21
403000 -- (-1513.203) [-1507.215] (-1511.463) (-1513.299) * (-1511.132) [-1510.418] (-1510.800) (-1510.767) -- 0:01:21
403500 -- (-1513.851) (-1521.385) [-1506.936] (-1511.985) * (-1508.276) (-1506.906) [-1507.385] (-1511.296) -- 0:01:21
404000 -- [-1508.661] (-1512.576) (-1516.104) (-1509.985) * [-1507.762] (-1509.617) (-1508.977) (-1516.213) -- 0:01:21
404500 -- (-1510.394) [-1507.123] (-1508.910) (-1505.426) * (-1509.450) (-1509.466) (-1508.138) [-1518.688] -- 0:01:20
405000 -- (-1513.612) (-1514.365) [-1505.474] (-1509.379) * (-1508.802) [-1508.088] (-1522.749) (-1511.190) -- 0:01:20
Average standard deviation of split frequencies: 0.005225
405500 -- (-1509.390) (-1515.695) [-1509.924] (-1512.406) * (-1508.426) (-1510.077) (-1512.902) [-1511.188] -- 0:01:20
406000 -- [-1511.158] (-1510.444) (-1504.296) (-1515.710) * [-1508.348] (-1514.022) (-1510.224) (-1514.286) -- 0:01:20
406500 -- (-1513.500) [-1507.661] (-1509.404) (-1514.440) * (-1507.643) (-1510.338) [-1508.585] (-1510.391) -- 0:01:20
407000 -- [-1509.052] (-1509.449) (-1510.149) (-1510.996) * (-1509.471) (-1506.882) [-1509.964] (-1509.963) -- 0:01:21
407500 -- (-1509.592) (-1512.537) [-1506.287] (-1510.661) * (-1508.231) (-1506.915) (-1506.667) [-1511.507] -- 0:01:21
408000 -- (-1506.844) (-1516.392) [-1503.764] (-1515.951) * (-1505.533) (-1512.183) (-1509.740) [-1511.722] -- 0:01:21
408500 -- (-1512.885) (-1506.730) (-1507.566) [-1506.358] * [-1509.217] (-1509.779) (-1510.821) (-1513.186) -- 0:01:21
409000 -- (-1513.383) (-1507.418) [-1509.575] (-1507.644) * [-1502.982] (-1510.409) (-1510.164) (-1511.738) -- 0:01:20
409500 -- (-1516.664) [-1509.826] (-1508.029) (-1511.403) * [-1506.559] (-1510.259) (-1511.281) (-1511.503) -- 0:01:20
410000 -- [-1507.440] (-1506.556) (-1511.869) (-1516.733) * [-1508.205] (-1517.471) (-1512.546) (-1505.271) -- 0:01:20
Average standard deviation of split frequencies: 0.005166
410500 -- [-1506.895] (-1506.836) (-1511.048) (-1517.497) * (-1507.711) (-1513.116) (-1512.391) [-1506.828] -- 0:01:20
411000 -- (-1510.138) [-1505.561] (-1521.547) (-1512.437) * (-1507.307) (-1513.797) (-1513.706) [-1507.645] -- 0:01:20
411500 -- (-1514.209) (-1508.310) [-1512.170] (-1514.823) * (-1507.979) (-1517.525) [-1509.263] (-1508.505) -- 0:01:20
412000 -- (-1514.904) [-1508.393] (-1513.033) (-1509.773) * (-1503.663) (-1512.280) (-1509.312) [-1507.161] -- 0:01:19
412500 -- (-1509.434) [-1507.448] (-1518.821) (-1507.716) * (-1508.471) (-1508.815) (-1511.819) [-1509.028] -- 0:01:19
413000 -- (-1518.476) (-1518.072) (-1515.272) [-1508.547] * (-1511.537) (-1509.629) (-1509.811) [-1510.814] -- 0:01:19
413500 -- [-1505.749] (-1511.454) (-1508.441) (-1508.116) * [-1506.359] (-1507.613) (-1509.341) (-1517.179) -- 0:01:19
414000 -- [-1512.713] (-1509.843) (-1510.045) (-1511.448) * (-1510.638) (-1511.769) (-1513.032) [-1507.931] -- 0:01:19
414500 -- (-1506.492) (-1509.936) (-1512.396) [-1508.210] * (-1508.483) (-1507.272) [-1510.922] (-1508.802) -- 0:01:20
415000 -- (-1510.788) [-1510.129] (-1511.944) (-1514.124) * [-1511.218] (-1507.816) (-1507.632) (-1512.784) -- 0:01:20
Average standard deviation of split frequencies: 0.004533
415500 -- (-1509.139) (-1508.019) [-1505.278] (-1511.435) * (-1508.512) (-1509.349) [-1509.079] (-1513.476) -- 0:01:20
416000 -- (-1510.350) (-1513.145) [-1506.529] (-1507.053) * (-1506.661) (-1513.709) [-1505.288] (-1509.650) -- 0:01:20
416500 -- (-1512.199) [-1511.896] (-1507.092) (-1508.125) * [-1510.097] (-1517.247) (-1506.279) (-1509.415) -- 0:01:19
417000 -- (-1508.126) (-1508.450) [-1509.157] (-1512.404) * (-1510.267) [-1508.905] (-1507.065) (-1508.338) -- 0:01:19
417500 -- (-1507.552) [-1506.572] (-1511.241) (-1513.049) * (-1508.260) (-1510.528) (-1504.393) [-1509.262] -- 0:01:19
418000 -- (-1513.217) (-1504.321) (-1512.737) [-1505.564] * [-1508.333] (-1508.166) (-1509.571) (-1512.176) -- 0:01:19
418500 -- (-1514.656) (-1509.980) [-1508.318] (-1505.164) * (-1504.311) (-1505.848) [-1506.362] (-1507.239) -- 0:01:19
419000 -- (-1516.204) (-1508.668) (-1517.827) [-1510.941] * [-1510.671] (-1504.951) (-1507.185) (-1511.938) -- 0:01:19
419500 -- (-1512.491) (-1510.234) (-1514.234) [-1509.479] * (-1513.982) (-1513.197) (-1517.933) [-1510.196] -- 0:01:18
420000 -- (-1508.637) (-1509.992) [-1506.646] (-1514.563) * [-1516.434] (-1512.254) (-1508.968) (-1511.537) -- 0:01:18
Average standard deviation of split frequencies: 0.007284
420500 -- (-1515.717) [-1511.645] (-1513.418) (-1506.312) * (-1507.333) [-1511.041] (-1509.639) (-1505.585) -- 0:01:18
421000 -- (-1516.064) [-1516.062] (-1510.861) (-1510.422) * [-1506.277] (-1510.689) (-1507.243) (-1508.517) -- 0:01:18
421500 -- (-1506.604) (-1508.014) (-1509.042) [-1510.970] * [-1508.087] (-1515.171) (-1514.682) (-1508.746) -- 0:01:18
422000 -- (-1506.866) (-1508.845) (-1507.528) [-1507.293] * (-1510.547) [-1515.259] (-1513.005) (-1507.678) -- 0:01:19
422500 -- (-1504.646) (-1509.093) (-1508.161) [-1509.394] * (-1509.163) (-1510.330) [-1511.386] (-1508.875) -- 0:01:19
423000 -- (-1511.917) (-1509.199) (-1511.601) [-1512.238] * (-1509.965) [-1508.099] (-1508.883) (-1508.059) -- 0:01:19
423500 -- [-1509.342] (-1508.362) (-1511.874) (-1508.080) * (-1507.610) (-1515.310) (-1514.615) [-1518.348] -- 0:01:18
424000 -- (-1515.216) (-1516.751) (-1510.880) [-1514.363] * (-1512.646) [-1509.777] (-1511.556) (-1507.717) -- 0:01:18
424500 -- (-1514.909) (-1515.469) (-1508.909) [-1508.842] * (-1508.339) (-1515.706) [-1508.746] (-1509.143) -- 0:01:18
425000 -- (-1517.423) (-1512.951) (-1506.167) [-1507.705] * (-1509.140) (-1507.046) [-1509.996] (-1510.515) -- 0:01:18
Average standard deviation of split frequencies: 0.009406
425500 -- (-1508.614) (-1514.019) (-1506.447) [-1509.043] * (-1503.836) (-1509.803) (-1517.708) [-1509.857] -- 0:01:18
426000 -- (-1512.633) (-1512.968) (-1513.718) [-1508.086] * [-1509.291] (-1508.663) (-1510.394) (-1509.716) -- 0:01:18
426500 -- (-1512.667) (-1515.923) (-1506.152) [-1509.552] * (-1511.547) (-1511.593) (-1511.564) [-1507.155] -- 0:01:17
427000 -- [-1507.388] (-1519.377) (-1508.468) (-1513.875) * (-1515.515) (-1510.115) [-1510.576] (-1512.226) -- 0:01:17
427500 -- (-1506.525) (-1520.211) (-1506.027) [-1506.003] * (-1508.417) [-1507.252] (-1512.035) (-1508.213) -- 0:01:17
428000 -- (-1513.264) (-1511.005) (-1508.249) [-1505.296] * (-1506.833) (-1505.707) (-1512.553) [-1505.486] -- 0:01:17
428500 -- (-1512.938) (-1510.223) (-1511.876) [-1510.275] * [-1508.918] (-1507.677) (-1507.869) (-1508.634) -- 0:01:17
429000 -- (-1507.924) [-1508.051] (-1509.937) (-1510.453) * [-1506.953] (-1507.780) (-1506.194) (-1512.882) -- 0:01:18
429500 -- (-1516.340) [-1509.293] (-1508.222) (-1509.511) * (-1505.847) [-1507.740] (-1513.518) (-1509.703) -- 0:01:18
430000 -- (-1516.554) (-1506.690) (-1513.968) [-1503.963] * [-1510.418] (-1513.649) (-1509.118) (-1511.411) -- 0:01:18
Average standard deviation of split frequencies: 0.012588
430500 -- (-1502.971) (-1506.707) (-1515.341) [-1507.163] * (-1512.089) (-1507.228) [-1506.970] (-1507.344) -- 0:01:18
431000 -- (-1509.157) [-1507.842] (-1509.129) (-1511.305) * (-1508.505) [-1509.232] (-1515.282) (-1507.520) -- 0:01:17
431500 -- [-1507.873] (-1508.535) (-1511.298) (-1508.716) * (-1507.530) [-1512.295] (-1511.466) (-1506.905) -- 0:01:17
432000 -- (-1505.423) (-1509.478) (-1508.886) [-1508.784] * [-1508.977] (-1506.462) (-1511.519) (-1506.311) -- 0:01:17
432500 -- [-1505.577] (-1512.073) (-1509.908) (-1506.621) * (-1515.798) (-1505.336) (-1512.507) [-1506.163] -- 0:01:17
433000 -- [-1506.445] (-1508.277) (-1513.891) (-1506.603) * (-1512.138) [-1509.734] (-1507.694) (-1505.577) -- 0:01:17
433500 -- (-1508.847) [-1508.285] (-1510.405) (-1509.352) * (-1509.003) (-1511.020) [-1509.979] (-1508.775) -- 0:01:17
434000 -- (-1515.278) [-1512.253] (-1512.137) (-1506.332) * (-1512.767) (-1510.568) (-1505.438) [-1505.362] -- 0:01:16
434500 -- (-1509.373) [-1508.060] (-1519.538) (-1509.343) * (-1508.507) (-1507.541) (-1507.724) [-1509.811] -- 0:01:16
435000 -- (-1506.298) (-1510.235) (-1511.166) [-1510.455] * [-1512.356] (-1510.367) (-1509.901) (-1514.294) -- 0:01:16
Average standard deviation of split frequencies: 0.014056
435500 -- (-1508.374) (-1513.542) (-1510.325) [-1510.073] * (-1507.201) (-1509.875) (-1507.181) [-1508.649] -- 0:01:16
436000 -- (-1511.679) (-1509.007) [-1508.914] (-1508.248) * (-1514.443) (-1509.710) (-1507.638) [-1510.350] -- 0:01:16
436500 -- (-1505.881) [-1504.741] (-1511.687) (-1508.533) * [-1511.375] (-1505.191) (-1514.212) (-1507.879) -- 0:01:17
437000 -- (-1511.127) (-1508.380) [-1511.082] (-1507.472) * (-1509.020) (-1510.524) [-1509.586] (-1506.483) -- 0:01:17
437500 -- (-1507.428) (-1517.349) (-1509.548) [-1513.134] * (-1513.990) [-1509.627] (-1511.700) (-1509.418) -- 0:01:17
438000 -- (-1513.968) (-1516.447) [-1510.360] (-1511.031) * (-1521.498) (-1508.162) [-1509.927] (-1509.918) -- 0:01:16
438500 -- (-1509.649) (-1515.998) [-1507.815] (-1517.898) * (-1509.745) (-1510.178) [-1510.248] (-1506.144) -- 0:01:16
439000 -- (-1507.467) [-1510.573] (-1510.024) (-1518.856) * (-1510.731) [-1507.286] (-1506.582) (-1508.726) -- 0:01:16
439500 -- [-1506.907] (-1506.936) (-1505.526) (-1511.210) * [-1509.853] (-1507.841) (-1509.590) (-1507.928) -- 0:01:16
440000 -- (-1506.978) [-1509.194] (-1506.635) (-1515.371) * (-1512.928) (-1512.304) (-1510.554) [-1509.546] -- 0:01:16
Average standard deviation of split frequencies: 0.013372
440500 -- (-1505.731) (-1513.201) [-1506.001] (-1509.018) * (-1514.779) [-1510.686] (-1508.505) (-1508.338) -- 0:01:16
441000 -- (-1508.016) (-1506.590) (-1510.224) [-1508.021] * (-1507.160) [-1506.330] (-1515.581) (-1508.913) -- 0:01:16
441500 -- (-1508.314) (-1515.417) [-1506.059] (-1511.211) * [-1504.941] (-1513.064) (-1513.753) (-1508.054) -- 0:01:15
442000 -- (-1506.401) (-1511.304) [-1511.614] (-1507.062) * (-1507.103) [-1508.249] (-1514.723) (-1511.185) -- 0:01:15
442500 -- (-1508.991) (-1506.779) [-1509.686] (-1509.529) * [-1508.306] (-1509.219) (-1517.670) (-1513.464) -- 0:01:15
443000 -- (-1514.429) (-1512.731) (-1503.843) [-1507.942] * (-1507.345) [-1508.945] (-1509.173) (-1514.087) -- 0:01:15
443500 -- (-1510.366) (-1510.419) (-1504.332) [-1509.185] * (-1512.162) (-1510.845) [-1509.014] (-1515.039) -- 0:01:15
444000 -- (-1508.487) (-1510.830) [-1503.591] (-1508.019) * (-1509.982) [-1510.186] (-1508.582) (-1508.779) -- 0:01:16
444500 -- (-1509.990) [-1509.637] (-1517.082) (-1518.721) * (-1511.420) [-1509.503] (-1505.846) (-1504.624) -- 0:01:16
445000 -- (-1514.538) (-1507.736) (-1508.423) [-1508.197] * [-1511.284] (-1507.412) (-1508.077) (-1504.539) -- 0:01:16
Average standard deviation of split frequencies: 0.021139
445500 -- (-1515.637) [-1507.692] (-1507.507) (-1512.133) * (-1503.527) [-1508.952] (-1508.657) (-1505.341) -- 0:01:15
446000 -- (-1506.231) [-1507.548] (-1506.073) (-1515.236) * (-1511.282) [-1508.920] (-1510.836) (-1504.986) -- 0:01:15
446500 -- (-1512.912) (-1506.649) [-1509.597] (-1512.315) * (-1512.755) (-1515.792) [-1507.846] (-1511.730) -- 0:01:15
447000 -- (-1503.091) (-1513.055) [-1508.365] (-1507.917) * (-1510.023) (-1512.128) [-1507.022] (-1511.088) -- 0:01:15
447500 -- [-1511.237] (-1508.532) (-1509.870) (-1508.053) * [-1513.531] (-1515.799) (-1512.387) (-1511.436) -- 0:01:15
448000 -- (-1506.245) [-1506.439] (-1512.430) (-1520.909) * (-1509.342) [-1507.713] (-1507.099) (-1510.082) -- 0:01:15
448500 -- (-1511.346) [-1506.320] (-1509.097) (-1512.242) * (-1509.189) [-1507.097] (-1510.139) (-1510.826) -- 0:01:15
449000 -- [-1510.687] (-1511.139) (-1509.442) (-1506.844) * (-1512.946) (-1509.857) [-1505.311] (-1506.998) -- 0:01:14
449500 -- [-1510.952] (-1512.178) (-1508.752) (-1510.339) * [-1511.739] (-1507.260) (-1508.188) (-1514.412) -- 0:01:14
450000 -- (-1507.872) (-1508.343) (-1508.686) [-1512.034] * (-1511.180) [-1507.719] (-1507.509) (-1514.725) -- 0:01:14
Average standard deviation of split frequencies: 0.018828
450500 -- (-1517.466) (-1510.664) (-1504.879) [-1507.858] * [-1504.532] (-1511.731) (-1510.809) (-1504.155) -- 0:01:14
451000 -- (-1517.771) [-1515.306] (-1512.318) (-1506.805) * (-1511.423) [-1507.326] (-1511.679) (-1507.995) -- 0:01:14
451500 -- [-1509.413] (-1511.735) (-1514.031) (-1510.563) * (-1505.557) (-1507.586) [-1506.603] (-1507.790) -- 0:01:15
452000 -- (-1505.831) [-1508.789] (-1509.680) (-1509.286) * (-1506.534) (-1505.505) [-1511.634] (-1511.158) -- 0:01:15
452500 -- [-1503.899] (-1512.078) (-1520.468) (-1509.876) * (-1506.731) (-1508.127) [-1506.389] (-1510.246) -- 0:01:15
453000 -- (-1510.657) [-1507.181] (-1506.288) (-1512.654) * (-1514.938) (-1512.942) (-1508.715) [-1508.287] -- 0:01:14
453500 -- [-1509.036] (-1507.441) (-1512.170) (-1515.445) * (-1513.861) [-1512.004] (-1512.806) (-1507.706) -- 0:01:14
454000 -- (-1513.326) (-1506.586) (-1507.958) [-1510.071] * (-1514.588) (-1508.039) (-1509.681) [-1510.964] -- 0:01:14
454500 -- (-1506.372) (-1505.994) [-1509.652] (-1512.718) * (-1510.673) (-1513.567) (-1510.869) [-1510.943] -- 0:01:14
455000 -- (-1506.167) [-1509.273] (-1510.670) (-1509.612) * (-1506.543) (-1509.957) (-1513.713) [-1506.085] -- 0:01:14
Average standard deviation of split frequencies: 0.014473
455500 -- (-1506.235) (-1507.940) [-1507.062] (-1508.806) * (-1508.840) (-1507.955) (-1512.126) [-1512.513] -- 0:01:14
456000 -- (-1509.576) (-1507.686) (-1508.550) [-1505.008] * (-1512.421) (-1508.404) [-1514.672] (-1509.203) -- 0:01:13
456500 -- (-1509.599) (-1508.482) (-1516.541) [-1506.234] * [-1509.897] (-1507.232) (-1514.016) (-1506.841) -- 0:01:13
457000 -- (-1506.860) (-1507.978) [-1512.383] (-1507.778) * (-1513.998) [-1504.516] (-1513.714) (-1508.704) -- 0:01:13
457500 -- (-1506.848) [-1506.070] (-1508.792) (-1511.440) * [-1512.894] (-1509.983) (-1517.306) (-1511.185) -- 0:01:13
458000 -- (-1506.326) (-1508.587) [-1513.432] (-1515.119) * (-1510.617) [-1507.950] (-1515.024) (-1511.756) -- 0:01:13
458500 -- (-1505.454) (-1510.428) (-1519.637) [-1512.962] * (-1511.195) (-1505.868) [-1516.712] (-1510.215) -- 0:01:14
459000 -- (-1507.742) [-1509.772] (-1517.356) (-1508.514) * (-1507.656) (-1508.889) [-1513.675] (-1512.121) -- 0:01:14
459500 -- (-1507.914) (-1507.131) (-1514.014) [-1511.635] * [-1509.365] (-1513.672) (-1512.853) (-1512.402) -- 0:01:14
460000 -- (-1509.379) (-1506.773) (-1509.778) [-1514.655] * (-1509.174) (-1513.792) [-1509.991] (-1507.912) -- 0:01:13
Average standard deviation of split frequencies: 0.012791
460500 -- (-1508.787) (-1508.554) (-1508.966) [-1507.929] * [-1507.891] (-1518.785) (-1512.514) (-1509.254) -- 0:01:13
461000 -- (-1504.313) (-1513.946) [-1508.712] (-1505.308) * (-1510.150) (-1520.450) (-1509.537) [-1508.312] -- 0:01:13
461500 -- (-1510.151) (-1508.968) (-1509.146) [-1502.554] * (-1508.654) (-1506.761) [-1507.667] (-1510.452) -- 0:01:13
462000 -- (-1509.339) (-1508.253) (-1507.436) [-1507.542] * (-1511.439) (-1508.159) [-1506.280] (-1509.395) -- 0:01:13
462500 -- (-1511.693) (-1510.279) (-1506.907) [-1504.207] * (-1514.772) (-1512.078) [-1504.986] (-1518.825) -- 0:01:13
463000 -- [-1506.045] (-1515.107) (-1508.707) (-1509.212) * (-1506.333) (-1505.419) [-1509.010] (-1510.206) -- 0:01:13
463500 -- (-1505.457) (-1505.848) (-1508.961) [-1505.251] * (-1510.567) [-1506.338] (-1507.898) (-1507.983) -- 0:01:12
464000 -- (-1508.877) [-1505.718] (-1511.687) (-1507.402) * (-1510.133) (-1514.850) (-1508.418) [-1510.892] -- 0:01:12
464500 -- (-1509.619) [-1509.882] (-1509.010) (-1518.081) * (-1509.000) (-1509.131) [-1510.170] (-1509.950) -- 0:01:12
465000 -- (-1511.411) (-1510.369) [-1505.926] (-1509.644) * (-1507.504) [-1514.539] (-1506.709) (-1509.541) -- 0:01:12
Average standard deviation of split frequencies: 0.016186
465500 -- (-1514.172) (-1508.156) [-1506.110] (-1511.171) * (-1508.892) (-1508.268) [-1510.772] (-1511.037) -- 0:01:12
466000 -- (-1510.838) [-1512.199] (-1509.181) (-1514.400) * (-1506.200) [-1507.413] (-1514.785) (-1510.122) -- 0:01:13
466500 -- (-1509.897) [-1509.821] (-1508.378) (-1518.984) * [-1507.852] (-1509.128) (-1509.438) (-1512.562) -- 0:01:13
467000 -- (-1513.500) (-1510.835) (-1510.013) [-1507.768] * (-1509.133) (-1506.243) [-1512.777] (-1510.376) -- 0:01:13
467500 -- (-1513.162) (-1510.853) [-1511.197] (-1510.360) * (-1513.445) (-1506.460) (-1514.600) [-1515.660] -- 0:01:12
468000 -- [-1516.033] (-1511.732) (-1507.524) (-1509.783) * (-1510.452) [-1508.723] (-1508.260) (-1516.482) -- 0:01:12
468500 -- (-1507.370) (-1515.488) (-1508.526) [-1506.256] * (-1509.308) (-1509.702) (-1512.031) [-1506.660] -- 0:01:12
469000 -- (-1511.898) (-1516.582) (-1509.280) [-1507.733] * (-1512.568) (-1512.628) (-1515.358) [-1513.145] -- 0:01:12
469500 -- (-1511.353) [-1509.081] (-1511.859) (-1510.586) * (-1509.223) [-1505.285] (-1515.935) (-1508.466) -- 0:01:12
470000 -- (-1511.387) [-1506.082] (-1509.451) (-1506.034) * (-1507.165) (-1506.028) (-1512.563) [-1507.772] -- 0:01:12
Average standard deviation of split frequencies: 0.015024
470500 -- (-1507.425) [-1506.492] (-1513.477) (-1513.705) * (-1512.728) (-1509.829) [-1510.168] (-1506.955) -- 0:01:12
471000 -- (-1508.667) (-1511.730) [-1513.225] (-1514.845) * (-1512.325) (-1508.906) [-1507.657] (-1506.934) -- 0:01:11
471500 -- (-1515.963) [-1507.688] (-1515.914) (-1510.660) * (-1511.692) [-1508.717] (-1509.911) (-1506.403) -- 0:01:11
472000 -- [-1508.187] (-1510.084) (-1507.672) (-1510.555) * (-1513.538) [-1506.135] (-1514.803) (-1510.603) -- 0:01:11
472500 -- (-1510.961) (-1508.638) [-1511.375] (-1513.040) * (-1509.316) [-1510.724] (-1515.689) (-1510.914) -- 0:01:11
473000 -- (-1514.631) [-1505.887] (-1511.325) (-1509.716) * [-1506.034] (-1513.458) (-1516.305) (-1514.190) -- 0:01:11
473500 -- (-1509.870) [-1510.732] (-1510.028) (-1511.889) * (-1506.159) (-1508.997) [-1510.287] (-1505.754) -- 0:01:12
474000 -- (-1510.011) [-1505.678] (-1507.547) (-1513.497) * (-1505.762) [-1510.084] (-1514.576) (-1508.908) -- 0:01:12
474500 -- (-1509.380) (-1507.670) [-1506.998] (-1514.845) * (-1507.741) (-1509.491) (-1509.487) [-1507.519] -- 0:01:11
475000 -- (-1507.262) (-1506.523) [-1509.788] (-1508.664) * (-1512.032) (-1510.349) [-1506.224] (-1512.836) -- 0:01:11
Average standard deviation of split frequencies: 0.012874
475500 -- (-1508.218) (-1506.021) [-1506.661] (-1509.049) * (-1513.481) (-1511.653) [-1508.861] (-1510.744) -- 0:01:11
476000 -- (-1508.357) [-1510.852] (-1510.223) (-1509.329) * [-1510.252] (-1513.529) (-1508.625) (-1512.739) -- 0:01:11
476500 -- [-1508.253] (-1511.296) (-1514.509) (-1506.950) * (-1513.778) (-1516.565) (-1507.454) [-1510.239] -- 0:01:11
477000 -- (-1512.339) [-1510.111] (-1509.948) (-1507.627) * (-1509.418) (-1516.166) [-1508.579] (-1513.079) -- 0:01:11
477500 -- [-1508.502] (-1510.646) (-1514.845) (-1512.274) * (-1507.945) [-1511.917] (-1506.740) (-1512.832) -- 0:01:11
478000 -- (-1507.108) (-1507.272) [-1509.206] (-1509.914) * (-1508.453) (-1505.530) [-1506.385] (-1509.839) -- 0:01:10
478500 -- [-1509.246] (-1507.377) (-1510.306) (-1507.445) * [-1507.196] (-1519.889) (-1505.410) (-1508.407) -- 0:01:10
479000 -- [-1506.235] (-1507.879) (-1515.283) (-1510.701) * (-1510.392) [-1510.007] (-1506.201) (-1512.622) -- 0:01:10
479500 -- [-1510.391] (-1505.310) (-1516.329) (-1511.805) * (-1514.145) (-1517.425) (-1511.077) [-1512.674] -- 0:01:10
480000 -- (-1514.486) (-1516.520) (-1506.789) [-1508.998] * (-1514.512) (-1511.600) (-1507.665) [-1516.021] -- 0:01:10
Average standard deviation of split frequencies: 0.015692
480500 -- [-1508.900] (-1512.964) (-1510.037) (-1509.862) * (-1518.515) (-1510.658) [-1512.624] (-1506.809) -- 0:01:10
481000 -- [-1505.004] (-1518.563) (-1508.104) (-1508.911) * (-1514.149) (-1509.718) [-1510.002] (-1509.263) -- 0:01:11
481500 -- (-1512.072) (-1506.465) (-1511.945) [-1510.232] * (-1515.979) (-1508.025) [-1509.986] (-1511.023) -- 0:01:11
482000 -- (-1506.896) (-1509.149) [-1509.093] (-1516.679) * (-1523.414) [-1508.519] (-1507.264) (-1511.888) -- 0:01:10
482500 -- (-1507.753) [-1503.800] (-1505.149) (-1511.251) * (-1510.042) (-1510.614) (-1503.988) [-1516.497] -- 0:01:10
483000 -- (-1509.596) (-1507.058) (-1514.921) [-1511.539] * (-1512.137) [-1506.776] (-1513.327) (-1512.220) -- 0:01:10
483500 -- (-1509.189) (-1509.128) (-1514.158) [-1512.631] * (-1512.362) (-1508.440) (-1510.408) [-1515.518] -- 0:01:10
484000 -- (-1510.811) [-1509.412] (-1511.826) (-1514.915) * (-1507.728) [-1508.784] (-1506.856) (-1509.643) -- 0:01:10
484500 -- (-1517.177) (-1508.469) [-1508.081] (-1505.985) * (-1507.093) (-1509.652) [-1515.431] (-1511.573) -- 0:01:10
485000 -- (-1519.564) [-1503.633] (-1514.029) (-1506.723) * (-1506.804) (-1509.464) (-1517.175) [-1514.982] -- 0:01:10
Average standard deviation of split frequencies: 0.014550
485500 -- (-1515.748) [-1508.588] (-1513.269) (-1508.206) * (-1507.521) (-1509.613) (-1513.612) [-1513.055] -- 0:01:09
486000 -- [-1509.738] (-1506.163) (-1508.763) (-1512.373) * (-1508.037) [-1507.964] (-1508.418) (-1504.350) -- 0:01:09
486500 -- [-1512.456] (-1508.420) (-1513.385) (-1508.342) * (-1507.771) (-1505.541) (-1511.653) [-1508.092] -- 0:01:09
487000 -- (-1516.430) (-1515.753) (-1510.787) [-1506.843] * (-1506.748) [-1507.788] (-1511.507) (-1514.980) -- 0:01:09
487500 -- (-1517.818) (-1511.467) [-1510.953] (-1505.044) * [-1508.925] (-1511.070) (-1510.023) (-1506.710) -- 0:01:09
488000 -- (-1516.069) (-1515.477) [-1507.310] (-1507.765) * (-1508.738) [-1505.930] (-1510.670) (-1510.159) -- 0:01:10
488500 -- (-1515.153) [-1514.335] (-1509.335) (-1506.802) * (-1511.195) [-1509.663] (-1509.084) (-1507.065) -- 0:01:10
489000 -- (-1519.177) (-1503.797) (-1511.141) [-1506.425] * [-1511.234] (-1512.605) (-1510.988) (-1509.584) -- 0:01:10
489500 -- (-1515.843) (-1506.488) [-1516.665] (-1514.391) * (-1513.298) (-1509.717) (-1523.855) [-1505.931] -- 0:01:09
490000 -- (-1516.752) [-1510.790] (-1509.664) (-1510.555) * [-1504.661] (-1508.210) (-1512.389) (-1512.280) -- 0:01:09
Average standard deviation of split frequencies: 0.011529
490500 -- (-1512.009) (-1509.086) [-1510.926] (-1507.933) * (-1515.701) (-1509.342) (-1521.961) [-1512.813] -- 0:01:09
491000 -- [-1508.982] (-1507.395) (-1507.937) (-1508.783) * (-1512.357) [-1505.034] (-1511.346) (-1507.048) -- 0:01:09
491500 -- (-1510.432) (-1511.859) [-1514.792] (-1511.920) * (-1509.341) (-1511.404) [-1510.230] (-1508.052) -- 0:01:09
492000 -- [-1503.585] (-1508.575) (-1512.934) (-1506.046) * (-1513.526) (-1508.015) (-1514.251) [-1505.213] -- 0:01:09
492500 -- (-1509.021) (-1508.832) (-1512.044) [-1508.990] * (-1511.733) [-1505.616] (-1507.444) (-1506.720) -- 0:01:09
493000 -- [-1509.236] (-1508.506) (-1510.186) (-1509.555) * (-1513.460) (-1511.513) [-1509.462] (-1507.041) -- 0:01:08
493500 -- (-1508.962) (-1508.407) [-1506.771] (-1506.066) * (-1508.978) (-1510.153) (-1509.192) [-1508.448] -- 0:01:08
494000 -- (-1510.551) [-1506.478] (-1511.046) (-1508.299) * (-1509.575) (-1511.850) (-1510.536) [-1508.948] -- 0:01:08
494500 -- [-1507.610] (-1515.535) (-1512.219) (-1505.952) * [-1506.700] (-1509.433) (-1511.769) (-1516.834) -- 0:01:08
495000 -- (-1509.006) [-1506.040] (-1507.543) (-1506.120) * [-1510.821] (-1510.013) (-1513.903) (-1513.598) -- 0:01:08
Average standard deviation of split frequencies: 0.009504
495500 -- (-1512.446) (-1507.684) (-1508.917) [-1510.764] * (-1514.115) [-1507.062] (-1507.206) (-1515.504) -- 0:01:09
496000 -- (-1513.355) (-1510.023) [-1507.039] (-1506.318) * (-1509.810) [-1507.868] (-1509.862) (-1516.090) -- 0:01:09
496500 -- (-1512.577) (-1510.049) [-1509.302] (-1507.097) * (-1507.479) (-1506.760) (-1506.367) [-1512.287] -- 0:01:08
497000 -- (-1511.292) (-1516.171) (-1515.719) [-1505.231] * (-1510.410) (-1510.922) [-1507.069] (-1511.072) -- 0:01:08
497500 -- (-1507.644) (-1516.825) (-1512.459) [-1503.164] * (-1505.953) (-1510.312) (-1511.675) [-1509.066] -- 0:01:08
498000 -- (-1511.977) (-1509.594) [-1511.187] (-1511.069) * [-1506.020] (-1509.645) (-1508.586) (-1508.681) -- 0:01:08
498500 -- (-1510.686) (-1513.053) (-1510.409) [-1506.958] * (-1508.304) (-1512.701) [-1508.243] (-1508.795) -- 0:01:08
499000 -- [-1509.575] (-1514.002) (-1512.657) (-1508.281) * (-1510.574) (-1511.637) [-1504.982] (-1504.205) -- 0:01:08
499500 -- (-1506.553) (-1505.451) [-1512.887] (-1509.353) * (-1504.654) (-1514.668) [-1510.427] (-1509.501) -- 0:01:08
500000 -- (-1508.682) (-1508.579) [-1508.876] (-1507.780) * (-1507.660) [-1509.280] (-1510.530) (-1509.694) -- 0:01:08
Average standard deviation of split frequencies: 0.008945
500500 -- (-1513.634) (-1510.942) (-1513.504) [-1504.415] * (-1506.335) (-1505.760) (-1510.164) [-1511.018] -- 0:01:07
501000 -- (-1509.378) (-1506.916) [-1503.804] (-1508.693) * (-1507.401) (-1503.800) [-1513.772] (-1509.694) -- 0:01:07
501500 -- (-1505.820) (-1515.034) [-1506.942] (-1505.890) * (-1506.986) (-1514.585) (-1509.418) [-1508.044] -- 0:01:07
502000 -- (-1510.150) [-1508.483] (-1506.222) (-1508.122) * (-1508.062) (-1515.491) [-1506.239] (-1514.721) -- 0:01:07
502500 -- (-1513.466) (-1506.923) (-1509.371) [-1506.515] * (-1510.858) (-1512.681) (-1504.957) [-1506.372] -- 0:01:08
503000 -- [-1506.318] (-1509.047) (-1507.498) (-1509.644) * (-1506.232) (-1511.789) [-1508.734] (-1510.442) -- 0:01:08
503500 -- [-1503.882] (-1511.544) (-1507.577) (-1508.201) * (-1506.556) (-1508.346) [-1502.976] (-1510.821) -- 0:01:08
504000 -- [-1507.617] (-1505.654) (-1514.073) (-1514.937) * (-1514.539) [-1510.390] (-1508.399) (-1512.863) -- 0:01:07
504500 -- [-1511.346] (-1507.537) (-1516.011) (-1510.633) * (-1505.370) (-1511.203) (-1504.917) [-1507.372] -- 0:01:07
505000 -- (-1518.197) (-1508.936) (-1509.933) [-1509.016] * (-1507.493) (-1508.861) (-1506.018) [-1507.186] -- 0:01:07
Average standard deviation of split frequencies: 0.008850
505500 -- [-1513.992] (-1509.569) (-1510.204) (-1510.025) * (-1510.781) [-1506.302] (-1514.090) (-1508.637) -- 0:01:07
506000 -- [-1510.514] (-1512.824) (-1507.614) (-1506.867) * [-1507.215] (-1509.721) (-1510.372) (-1508.593) -- 0:01:07
506500 -- (-1509.923) (-1514.149) (-1507.786) [-1505.451] * (-1517.542) (-1507.802) [-1515.356] (-1510.026) -- 0:01:07
507000 -- (-1522.730) [-1505.123] (-1518.880) (-1506.975) * (-1507.516) [-1510.421] (-1508.028) (-1509.541) -- 0:01:07
507500 -- (-1511.593) [-1506.471] (-1511.101) (-1509.129) * (-1511.329) [-1506.837] (-1513.341) (-1504.477) -- 0:01:06
508000 -- [-1506.253] (-1515.855) (-1508.311) (-1507.033) * [-1506.857] (-1509.697) (-1510.302) (-1508.467) -- 0:01:06
508500 -- (-1511.470) (-1507.674) (-1505.707) [-1502.545] * (-1504.855) (-1504.665) (-1505.731) [-1507.421] -- 0:01:06
509000 -- (-1510.149) [-1508.563] (-1504.918) (-1510.230) * (-1506.416) (-1514.562) (-1506.762) [-1504.659] -- 0:01:06
509500 -- [-1509.062] (-1512.186) (-1505.434) (-1505.374) * (-1507.172) (-1515.458) [-1507.752] (-1509.293) -- 0:01:06
510000 -- (-1508.349) (-1509.761) (-1505.324) [-1506.708] * (-1507.925) (-1516.624) (-1508.439) [-1509.924] -- 0:01:07
Average standard deviation of split frequencies: 0.006923
510500 -- (-1509.110) (-1506.854) [-1508.325] (-1506.341) * (-1512.647) [-1511.974] (-1508.153) (-1512.746) -- 0:01:07
511000 -- (-1508.752) [-1507.040] (-1504.946) (-1513.336) * (-1510.367) [-1506.543] (-1512.689) (-1508.649) -- 0:01:06
511500 -- (-1511.125) [-1506.665] (-1506.429) (-1506.459) * (-1508.573) [-1504.535] (-1509.331) (-1503.483) -- 0:01:06
512000 -- (-1510.557) (-1510.874) (-1509.919) [-1508.101] * (-1508.156) (-1504.785) (-1511.743) [-1504.814] -- 0:01:06
512500 -- (-1509.776) (-1508.189) [-1508.231] (-1508.687) * [-1507.291] (-1509.067) (-1507.849) (-1510.335) -- 0:01:06
513000 -- (-1504.284) [-1508.000] (-1507.959) (-1516.329) * [-1507.223] (-1517.687) (-1510.965) (-1512.980) -- 0:01:06
513500 -- (-1504.680) (-1511.428) (-1507.501) [-1511.047] * [-1506.229] (-1515.097) (-1513.723) (-1510.343) -- 0:01:06
514000 -- [-1517.107] (-1506.201) (-1506.853) (-1510.572) * [-1508.314] (-1504.156) (-1511.374) (-1507.903) -- 0:01:06
514500 -- (-1511.131) [-1510.354] (-1503.588) (-1506.291) * (-1510.247) [-1508.007] (-1515.027) (-1517.824) -- 0:01:06
515000 -- (-1513.865) [-1507.649] (-1509.100) (-1507.813) * [-1509.812] (-1509.839) (-1510.449) (-1510.837) -- 0:01:05
Average standard deviation of split frequencies: 0.006852
515500 -- (-1511.717) [-1509.158] (-1506.546) (-1509.248) * [-1504.567] (-1512.060) (-1513.116) (-1508.269) -- 0:01:05
516000 -- (-1515.267) (-1512.017) (-1509.990) [-1511.185] * (-1508.797) (-1510.726) (-1512.757) [-1516.288] -- 0:01:05
516500 -- (-1513.027) (-1505.634) (-1510.005) [-1509.600] * [-1508.399] (-1508.480) (-1518.474) (-1510.101) -- 0:01:05
517000 -- (-1508.521) [-1513.473] (-1508.798) (-1508.648) * (-1507.666) (-1507.279) (-1512.157) [-1510.408] -- 0:01:05
517500 -- [-1506.320] (-1514.547) (-1511.714) (-1506.495) * (-1507.600) (-1517.622) [-1506.780] (-1512.724) -- 0:01:06
518000 -- (-1509.748) [-1508.927] (-1507.180) (-1518.051) * (-1518.854) [-1511.869] (-1509.675) (-1509.350) -- 0:01:06
518500 -- (-1506.445) [-1506.823] (-1509.301) (-1506.877) * [-1509.503] (-1507.705) (-1511.819) (-1512.005) -- 0:01:05
519000 -- [-1508.738] (-1506.620) (-1505.936) (-1506.479) * (-1510.690) [-1505.368] (-1508.324) (-1509.228) -- 0:01:05
519500 -- (-1506.123) (-1519.802) (-1516.130) [-1506.899] * [-1510.695] (-1508.395) (-1511.217) (-1508.609) -- 0:01:05
520000 -- [-1508.094] (-1520.461) (-1514.519) (-1513.891) * (-1508.741) [-1507.730] (-1509.747) (-1515.682) -- 0:01:05
Average standard deviation of split frequencies: 0.009054
520500 -- (-1510.843) (-1513.745) [-1507.475] (-1506.257) * (-1508.289) (-1509.120) [-1509.525] (-1508.130) -- 0:01:05
521000 -- (-1509.179) (-1511.036) (-1514.133) [-1508.290] * (-1510.312) (-1507.945) [-1505.075] (-1505.292) -- 0:01:05
521500 -- (-1507.090) [-1509.299] (-1509.702) (-1511.086) * (-1513.545) (-1508.433) [-1505.217] (-1506.632) -- 0:01:05
522000 -- (-1510.088) [-1506.888] (-1510.453) (-1513.151) * [-1506.849] (-1506.157) (-1516.978) (-1512.313) -- 0:01:05
522500 -- (-1510.466) (-1508.329) [-1510.747] (-1513.425) * (-1508.864) [-1504.642] (-1519.167) (-1514.627) -- 0:01:04
523000 -- (-1508.925) [-1508.724] (-1508.124) (-1515.153) * (-1513.516) [-1511.827] (-1508.441) (-1508.285) -- 0:01:04
523500 -- [-1506.778] (-1512.655) (-1513.195) (-1511.497) * (-1508.553) (-1507.858) (-1513.401) [-1508.856] -- 0:01:04
524000 -- (-1507.089) (-1511.271) [-1511.864] (-1510.536) * (-1510.129) (-1512.444) [-1515.885] (-1515.115) -- 0:01:04
524500 -- [-1504.031] (-1506.124) (-1510.296) (-1517.090) * (-1507.651) (-1515.888) (-1509.543) [-1511.202] -- 0:01:04
525000 -- [-1505.527] (-1515.392) (-1509.958) (-1512.987) * [-1509.555] (-1518.204) (-1506.094) (-1506.716) -- 0:01:05
Average standard deviation of split frequencies: 0.007618
525500 -- [-1508.613] (-1511.253) (-1509.810) (-1511.664) * (-1511.288) (-1509.103) (-1508.412) [-1505.822] -- 0:01:05
526000 -- (-1510.251) [-1509.012] (-1507.342) (-1514.372) * (-1512.069) [-1510.175] (-1511.899) (-1510.043) -- 0:01:04
526500 -- (-1511.575) (-1506.481) [-1509.831] (-1511.979) * (-1509.002) (-1507.126) (-1510.011) [-1512.264] -- 0:01:04
527000 -- (-1510.616) (-1507.102) (-1507.604) [-1510.290] * (-1509.708) (-1506.221) [-1505.748] (-1512.576) -- 0:01:04
527500 -- [-1509.938] (-1505.104) (-1511.512) (-1504.974) * [-1511.346] (-1506.346) (-1510.165) (-1507.490) -- 0:01:04
528000 -- (-1505.235) [-1506.630] (-1507.400) (-1506.385) * (-1507.934) (-1513.823) [-1506.695] (-1507.422) -- 0:01:04
528500 -- (-1511.112) [-1506.563] (-1505.833) (-1513.848) * [-1511.294] (-1507.935) (-1506.266) (-1506.463) -- 0:01:04
529000 -- (-1509.345) (-1510.173) [-1509.346] (-1513.228) * [-1507.321] (-1508.427) (-1508.019) (-1508.224) -- 0:01:04
529500 -- (-1509.378) (-1510.372) (-1512.788) [-1509.108] * (-1512.866) (-1507.326) [-1506.625] (-1512.075) -- 0:01:03
530000 -- (-1511.748) (-1507.192) [-1507.926] (-1506.671) * (-1508.684) (-1508.879) [-1504.558] (-1513.669) -- 0:01:03
Average standard deviation of split frequencies: 0.005774
530500 -- (-1506.289) (-1507.831) (-1512.462) [-1507.456] * (-1511.041) (-1508.443) [-1504.640] (-1507.439) -- 0:01:03
531000 -- (-1510.453) (-1513.318) (-1508.903) [-1510.565] * (-1509.637) (-1507.168) (-1507.992) [-1505.922] -- 0:01:03
531500 -- (-1506.039) (-1507.880) [-1507.162] (-1516.633) * (-1509.812) [-1509.328] (-1507.569) (-1511.462) -- 0:01:03
532000 -- (-1510.661) [-1507.105] (-1506.113) (-1515.981) * (-1508.595) (-1508.141) (-1507.284) [-1505.468] -- 0:01:04
532500 -- (-1507.909) (-1512.662) [-1506.944] (-1510.993) * [-1503.622] (-1507.761) (-1511.834) (-1509.783) -- 0:01:04
533000 -- (-1510.233) [-1506.919] (-1508.464) (-1520.091) * [-1513.932] (-1511.893) (-1507.332) (-1509.707) -- 0:01:03
533500 -- (-1507.512) [-1507.027] (-1505.788) (-1506.777) * [-1505.371] (-1509.500) (-1506.828) (-1510.434) -- 0:01:03
534000 -- (-1507.472) [-1506.657] (-1510.155) (-1509.461) * (-1508.079) (-1510.949) [-1509.540] (-1512.176) -- 0:01:03
534500 -- (-1512.615) [-1506.302] (-1506.255) (-1511.433) * (-1508.257) [-1514.808] (-1511.421) (-1507.504) -- 0:01:03
535000 -- (-1513.001) (-1504.432) [-1508.467] (-1512.449) * [-1506.748] (-1524.737) (-1511.959) (-1507.633) -- 0:01:03
Average standard deviation of split frequencies: 0.005717
535500 -- (-1512.566) (-1511.790) [-1511.341] (-1509.401) * [-1506.019] (-1521.135) (-1509.067) (-1511.007) -- 0:01:03
536000 -- (-1508.358) (-1513.509) (-1528.222) [-1508.941] * (-1505.849) (-1518.810) (-1509.141) [-1506.173] -- 0:01:03
536500 -- [-1506.900] (-1512.460) (-1509.836) (-1509.580) * [-1505.125] (-1525.199) (-1518.805) (-1509.313) -- 0:01:03
537000 -- (-1507.412) (-1511.357) [-1507.327] (-1511.812) * (-1515.029) (-1520.590) [-1517.283] (-1513.304) -- 0:01:02
537500 -- [-1507.861] (-1517.401) (-1509.601) (-1512.364) * (-1510.341) (-1508.735) (-1520.201) [-1507.954] -- 0:01:02
538000 -- [-1508.107] (-1515.597) (-1506.079) (-1507.035) * [-1510.711] (-1512.791) (-1512.419) (-1514.776) -- 0:01:02
538500 -- (-1511.893) (-1522.572) (-1507.194) [-1506.142] * (-1506.220) (-1507.673) (-1517.152) [-1507.101] -- 0:01:02
539000 -- [-1511.893] (-1513.024) (-1514.153) (-1504.675) * (-1506.804) (-1508.829) (-1523.610) [-1509.750] -- 0:01:02
539500 -- (-1509.868) [-1512.638] (-1506.303) (-1507.818) * [-1510.244] (-1512.205) (-1511.851) (-1507.354) -- 0:01:03
540000 -- (-1507.283) (-1513.662) [-1511.354] (-1509.278) * (-1511.777) (-1509.283) [-1511.483] (-1509.826) -- 0:01:03
Average standard deviation of split frequencies: 0.006103
540500 -- [-1507.114] (-1510.856) (-1510.301) (-1519.225) * (-1511.482) [-1508.311] (-1506.145) (-1512.445) -- 0:01:02
541000 -- (-1515.890) (-1506.893) (-1511.985) [-1509.298] * (-1512.177) (-1508.234) (-1510.699) [-1506.457] -- 0:01:02
541500 -- (-1510.206) (-1513.024) [-1507.088] (-1509.424) * (-1516.747) (-1506.272) (-1508.387) [-1510.257] -- 0:01:02
542000 -- (-1505.983) [-1507.377] (-1513.220) (-1506.076) * [-1506.191] (-1506.323) (-1516.146) (-1514.138) -- 0:01:02
542500 -- [-1509.486] (-1506.410) (-1510.961) (-1510.592) * (-1508.148) (-1512.817) (-1511.919) [-1508.971] -- 0:01:02
543000 -- (-1512.407) (-1508.669) [-1509.147] (-1509.047) * (-1509.220) (-1514.041) [-1511.636] (-1521.968) -- 0:01:02
543500 -- (-1507.464) (-1512.832) [-1513.028] (-1508.638) * [-1509.198] (-1515.765) (-1515.319) (-1510.667) -- 0:01:02
544000 -- (-1511.654) (-1506.718) (-1512.051) [-1513.081] * (-1508.793) [-1506.668] (-1513.939) (-1515.827) -- 0:01:02
544500 -- (-1514.626) (-1507.482) (-1506.483) [-1509.234] * [-1511.431] (-1506.649) (-1512.550) (-1518.487) -- 0:01:01
545000 -- (-1512.248) (-1510.076) [-1511.114] (-1511.321) * (-1505.957) [-1504.733] (-1512.181) (-1509.576) -- 0:01:01
Average standard deviation of split frequencies: 0.004317
545500 -- (-1514.302) (-1513.075) (-1510.247) [-1506.384] * (-1511.615) [-1505.892] (-1509.588) (-1508.449) -- 0:01:01
546000 -- (-1514.516) (-1512.194) (-1511.901) [-1505.357] * (-1513.516) [-1510.588] (-1515.984) (-1511.605) -- 0:01:01
546500 -- (-1514.849) (-1509.884) (-1506.286) [-1509.081] * [-1510.338] (-1509.059) (-1506.086) (-1512.119) -- 0:01:01
547000 -- (-1507.604) (-1514.023) [-1510.595] (-1507.996) * (-1512.953) [-1506.818] (-1507.985) (-1514.041) -- 0:01:02
547500 -- (-1509.979) (-1514.878) [-1511.663] (-1509.218) * [-1512.616] (-1510.057) (-1508.785) (-1514.517) -- 0:01:01
548000 -- [-1510.254] (-1511.616) (-1511.589) (-1508.766) * (-1509.850) (-1505.658) (-1512.318) [-1514.070] -- 0:01:01
548500 -- (-1508.882) (-1509.368) (-1509.478) [-1508.602] * (-1507.749) [-1514.856] (-1510.431) (-1511.226) -- 0:01:01
549000 -- [-1509.432] (-1510.638) (-1510.011) (-1510.489) * [-1509.344] (-1510.531) (-1509.822) (-1509.461) -- 0:01:01
549500 -- (-1509.933) (-1505.023) (-1511.866) [-1510.858] * (-1509.964) [-1507.518] (-1507.296) (-1510.235) -- 0:01:01
550000 -- (-1510.241) [-1506.511] (-1513.442) (-1508.234) * (-1507.686) (-1511.132) [-1506.356] (-1506.872) -- 0:01:01
Average standard deviation of split frequencies: 0.008989
550500 -- (-1511.711) (-1510.585) (-1507.373) [-1514.348] * (-1506.259) (-1508.930) (-1504.212) [-1508.563] -- 0:01:01
551000 -- (-1515.517) [-1513.674] (-1509.692) (-1509.469) * (-1510.750) (-1507.886) (-1504.919) [-1508.051] -- 0:01:01
551500 -- [-1506.455] (-1511.193) (-1515.797) (-1507.244) * (-1510.786) (-1519.429) [-1512.414] (-1509.868) -- 0:01:00
552000 -- (-1512.076) (-1512.113) [-1510.157] (-1506.176) * [-1509.120] (-1514.669) (-1510.794) (-1504.531) -- 0:01:00
552500 -- (-1507.500) [-1510.770] (-1506.828) (-1508.872) * (-1509.700) [-1507.378] (-1511.680) (-1512.583) -- 0:01:00
553000 -- [-1505.600] (-1520.195) (-1504.294) (-1510.302) * [-1511.980] (-1506.155) (-1511.015) (-1512.080) -- 0:01:00
553500 -- (-1507.126) (-1511.911) [-1511.899] (-1511.544) * [-1508.442] (-1508.621) (-1512.746) (-1508.163) -- 0:01:00
554000 -- (-1514.471) (-1509.457) [-1509.996] (-1508.766) * (-1505.979) (-1509.959) (-1507.122) [-1506.728] -- 0:01:00
554500 -- (-1520.414) (-1511.869) [-1508.418] (-1512.893) * (-1507.609) (-1512.055) (-1513.149) [-1506.304] -- 0:01:01
555000 -- [-1512.147] (-1511.091) (-1509.028) (-1513.289) * (-1508.696) (-1505.071) (-1506.553) [-1510.163] -- 0:01:00
Average standard deviation of split frequencies: 0.008055
555500 -- (-1508.470) (-1511.081) [-1510.137] (-1512.242) * (-1506.344) (-1508.139) [-1511.008] (-1509.584) -- 0:01:00
556000 -- (-1517.401) [-1505.338] (-1507.437) (-1514.797) * [-1509.801] (-1511.003) (-1507.796) (-1507.647) -- 0:01:00
556500 -- (-1510.221) (-1511.074) [-1509.016] (-1510.161) * (-1511.074) (-1507.360) [-1513.425] (-1512.534) -- 0:01:00
557000 -- (-1512.576) (-1509.415) [-1507.450] (-1510.487) * (-1509.706) (-1506.456) (-1509.195) [-1519.957] -- 0:01:00
557500 -- (-1519.078) [-1507.808] (-1512.809) (-1514.370) * (-1509.934) (-1519.767) (-1508.386) [-1509.160] -- 0:01:00
558000 -- (-1516.896) (-1511.882) (-1507.671) [-1513.884] * (-1511.425) (-1507.027) [-1508.786] (-1508.776) -- 0:01:00
558500 -- [-1519.746] (-1506.719) (-1511.741) (-1512.876) * (-1507.271) (-1508.703) [-1505.474] (-1510.948) -- 0:01:00
559000 -- [-1509.306] (-1506.871) (-1507.076) (-1507.609) * (-1509.576) [-1507.906] (-1510.339) (-1511.519) -- 0:00:59
559500 -- (-1510.515) [-1505.882] (-1507.495) (-1511.851) * [-1507.661] (-1511.171) (-1509.861) (-1512.421) -- 0:00:59
560000 -- (-1511.287) (-1509.541) [-1505.110] (-1508.296) * (-1514.781) (-1513.087) (-1506.532) [-1511.832] -- 0:00:59
Average standard deviation of split frequencies: 0.007147
560500 -- (-1511.963) [-1509.198] (-1511.037) (-1509.063) * [-1507.983] (-1514.429) (-1508.929) (-1508.537) -- 0:00:59
561000 -- (-1511.444) [-1508.597] (-1510.005) (-1513.063) * (-1509.060) (-1512.922) [-1512.436] (-1506.913) -- 0:00:59
561500 -- (-1506.152) (-1511.734) (-1507.657) [-1513.424] * (-1511.593) (-1513.935) [-1504.986] (-1506.113) -- 0:01:00
562000 -- (-1518.247) (-1511.881) [-1505.235] (-1508.373) * (-1509.581) (-1506.078) (-1510.729) [-1511.775] -- 0:01:00
562500 -- (-1512.410) (-1510.188) [-1509.436] (-1511.400) * (-1511.388) (-1515.939) (-1508.084) [-1511.391] -- 0:00:59
563000 -- (-1509.003) (-1510.301) [-1508.258] (-1511.349) * (-1508.240) [-1507.902] (-1508.194) (-1515.323) -- 0:00:59
563500 -- [-1512.889] (-1512.553) (-1509.237) (-1510.088) * (-1507.158) (-1508.110) (-1509.376) [-1510.364] -- 0:00:59
564000 -- (-1513.599) (-1510.757) [-1507.601] (-1513.461) * (-1511.403) (-1505.795) (-1511.146) [-1509.155] -- 0:00:59
564500 -- (-1512.060) [-1513.057] (-1508.070) (-1511.953) * (-1514.576) (-1510.671) (-1504.119) [-1510.256] -- 0:00:59
565000 -- (-1516.015) (-1514.032) [-1509.379] (-1504.936) * (-1514.728) (-1504.281) [-1505.236] (-1509.891) -- 0:00:59
Average standard deviation of split frequencies: 0.008745
565500 -- (-1510.703) [-1512.960] (-1516.177) (-1507.971) * (-1511.504) (-1508.474) (-1506.861) [-1511.919] -- 0:00:59
566000 -- (-1513.753) [-1507.395] (-1507.801) (-1512.073) * (-1508.168) (-1506.622) [-1505.204] (-1513.207) -- 0:00:59
566500 -- (-1510.182) (-1505.132) (-1519.404) [-1507.854] * (-1510.112) [-1510.599] (-1507.867) (-1510.763) -- 0:00:58
567000 -- (-1511.322) (-1507.288) [-1510.181] (-1507.779) * (-1516.658) [-1512.725] (-1511.250) (-1516.229) -- 0:00:58
567500 -- (-1511.058) (-1521.880) (-1515.300) [-1511.897] * [-1508.982] (-1510.128) (-1511.832) (-1508.864) -- 0:00:58
568000 -- [-1510.295] (-1515.644) (-1511.150) (-1510.464) * (-1506.050) [-1515.240] (-1509.827) (-1515.580) -- 0:00:58
568500 -- [-1509.567] (-1506.996) (-1505.213) (-1511.771) * [-1509.267] (-1511.594) (-1505.842) (-1510.111) -- 0:00:59
569000 -- (-1508.687) (-1512.784) [-1515.986] (-1508.927) * (-1508.963) (-1516.129) [-1516.933] (-1510.590) -- 0:00:59
569500 -- [-1510.983] (-1507.427) (-1511.769) (-1513.184) * (-1513.990) (-1510.009) (-1511.131) [-1507.811] -- 0:00:58
570000 -- [-1511.509] (-1508.509) (-1514.328) (-1511.322) * (-1504.447) [-1506.062] (-1508.607) (-1514.015) -- 0:00:58
Average standard deviation of split frequencies: 0.009500
570500 -- [-1511.248] (-1506.077) (-1511.347) (-1507.120) * (-1511.584) (-1504.033) [-1510.396] (-1517.870) -- 0:00:58
571000 -- (-1515.771) [-1511.871] (-1519.515) (-1511.314) * [-1505.806] (-1515.364) (-1509.656) (-1511.176) -- 0:00:58
571500 -- (-1507.544) (-1515.728) (-1514.008) [-1507.380] * (-1505.200) [-1506.703] (-1505.421) (-1517.465) -- 0:00:58
572000 -- (-1507.117) [-1505.161] (-1511.918) (-1507.839) * (-1508.067) (-1512.652) (-1508.164) [-1504.261] -- 0:00:58
572500 -- [-1512.724] (-1509.956) (-1517.146) (-1508.847) * [-1514.237] (-1509.120) (-1511.613) (-1509.132) -- 0:00:58
573000 -- (-1517.933) [-1508.154] (-1507.623) (-1508.826) * (-1504.771) (-1505.880) [-1506.989] (-1513.126) -- 0:00:58
573500 -- (-1518.795) [-1509.327] (-1506.162) (-1513.412) * (-1504.981) (-1505.042) [-1507.948] (-1510.616) -- 0:00:58
574000 -- (-1512.117) (-1507.802) (-1508.232) [-1515.036] * (-1508.014) [-1506.502] (-1509.508) (-1510.561) -- 0:00:57
574500 -- (-1504.380) (-1508.741) [-1507.121] (-1513.424) * (-1511.368) (-1514.098) (-1507.478) [-1509.112] -- 0:00:57
575000 -- [-1506.279] (-1507.274) (-1507.310) (-1513.953) * (-1508.561) (-1509.311) (-1512.232) [-1507.369] -- 0:00:57
Average standard deviation of split frequencies: 0.012276
575500 -- [-1510.859] (-1506.771) (-1506.815) (-1509.735) * (-1511.126) [-1510.797] (-1506.679) (-1507.702) -- 0:00:58
576000 -- (-1514.748) (-1507.781) [-1510.285] (-1508.628) * (-1511.968) (-1512.995) [-1507.660] (-1513.233) -- 0:00:58
576500 -- [-1506.575] (-1508.976) (-1511.855) (-1521.437) * (-1507.519) [-1509.227] (-1508.714) (-1508.085) -- 0:00:58
577000 -- (-1512.805) [-1507.789] (-1518.009) (-1514.663) * (-1510.508) [-1507.004] (-1505.053) (-1510.888) -- 0:00:57
577500 -- (-1510.480) [-1509.276] (-1523.320) (-1510.327) * (-1507.395) (-1508.078) [-1508.492] (-1514.403) -- 0:00:57
578000 -- (-1516.133) (-1514.013) (-1508.808) [-1509.602] * (-1508.435) (-1509.574) [-1509.214] (-1518.384) -- 0:00:57
578500 -- (-1508.739) (-1509.175) [-1508.339] (-1514.788) * (-1511.146) (-1512.361) [-1511.301] (-1512.246) -- 0:00:57
579000 -- (-1511.977) [-1509.150] (-1511.482) (-1513.892) * [-1510.092] (-1503.987) (-1514.913) (-1509.836) -- 0:00:57
579500 -- (-1521.982) (-1515.352) [-1509.779] (-1515.020) * (-1514.890) (-1509.508) [-1510.425] (-1517.511) -- 0:00:57
580000 -- (-1518.245) (-1508.218) (-1506.751) [-1511.250] * (-1508.445) (-1506.039) [-1506.654] (-1516.377) -- 0:00:57
Average standard deviation of split frequencies: 0.015019
580500 -- (-1509.257) (-1510.069) (-1506.451) [-1509.146] * [-1508.289] (-1511.175) (-1506.593) (-1505.251) -- 0:00:57
581000 -- [-1508.228] (-1508.806) (-1512.937) (-1512.550) * [-1510.698] (-1510.345) (-1507.453) (-1506.432) -- 0:00:56
581500 -- [-1505.278] (-1515.897) (-1511.688) (-1507.808) * (-1507.994) (-1508.959) (-1504.016) [-1506.806] -- 0:00:56
582000 -- (-1510.520) (-1511.088) [-1504.243] (-1503.521) * (-1516.037) (-1510.411) [-1508.422] (-1508.135) -- 0:00:56
582500 -- (-1507.753) (-1506.791) (-1516.050) [-1508.318] * (-1512.210) (-1506.259) (-1510.761) [-1511.855] -- 0:00:57
583000 -- [-1507.377] (-1508.709) (-1509.210) (-1506.213) * (-1506.716) (-1513.225) (-1509.488) [-1508.703] -- 0:00:57
583500 -- (-1506.592) (-1505.902) [-1511.293] (-1505.510) * [-1507.640] (-1514.129) (-1511.250) (-1505.826) -- 0:00:57
584000 -- [-1505.770] (-1507.971) (-1515.863) (-1508.613) * (-1513.354) [-1509.093] (-1515.134) (-1511.436) -- 0:00:56
584500 -- (-1511.430) (-1512.621) (-1518.772) [-1513.423] * [-1504.943] (-1504.879) (-1512.303) (-1508.045) -- 0:00:56
585000 -- (-1509.812) (-1510.661) [-1510.015] (-1512.412) * (-1507.854) (-1507.474) [-1508.418] (-1508.943) -- 0:00:56
Average standard deviation of split frequencies: 0.014882
585500 -- (-1512.375) (-1508.916) [-1508.042] (-1505.778) * (-1517.829) (-1511.082) (-1511.945) [-1510.101] -- 0:00:56
586000 -- [-1510.019] (-1511.098) (-1510.303) (-1510.496) * (-1510.159) (-1507.240) (-1511.987) [-1508.668] -- 0:00:56
586500 -- (-1510.198) (-1511.552) (-1509.535) [-1509.367] * (-1510.159) (-1509.052) (-1510.168) [-1507.347] -- 0:00:56
587000 -- (-1515.447) (-1510.110) (-1511.646) [-1506.534] * (-1518.252) [-1504.928] (-1513.045) (-1508.404) -- 0:00:56
587500 -- (-1506.774) (-1513.981) (-1518.390) [-1505.926] * (-1510.272) (-1517.474) (-1511.326) [-1504.351] -- 0:00:56
588000 -- (-1512.974) (-1510.503) (-1513.253) [-1507.932] * (-1507.957) [-1507.693] (-1508.800) (-1510.176) -- 0:00:56
588500 -- (-1510.354) [-1511.932] (-1508.316) (-1515.242) * [-1505.126] (-1509.667) (-1513.839) (-1506.486) -- 0:00:55
589000 -- (-1515.522) (-1521.004) [-1504.995] (-1510.637) * (-1512.027) (-1508.093) (-1504.937) [-1510.024] -- 0:00:55
589500 -- (-1514.923) (-1510.813) [-1508.980] (-1509.718) * (-1508.402) (-1516.321) [-1509.329] (-1507.237) -- 0:00:56
590000 -- (-1512.687) (-1508.959) [-1509.929] (-1506.629) * (-1509.631) (-1507.870) [-1504.732] (-1508.659) -- 0:00:56
Average standard deviation of split frequencies: 0.015962
590500 -- (-1506.622) (-1507.424) (-1505.945) [-1510.540] * (-1512.252) (-1512.154) [-1506.028] (-1509.588) -- 0:00:56
591000 -- (-1507.269) [-1507.297] (-1506.974) (-1514.524) * (-1505.756) (-1515.579) (-1516.602) [-1508.392] -- 0:00:56
591500 -- [-1504.862] (-1509.958) (-1508.707) (-1507.920) * [-1507.213] (-1519.202) (-1513.010) (-1505.815) -- 0:00:55
592000 -- (-1504.850) (-1509.812) (-1512.627) [-1507.085] * (-1506.421) [-1508.781] (-1513.475) (-1509.566) -- 0:00:55
592500 -- (-1515.989) [-1509.196] (-1512.978) (-1511.605) * (-1505.084) [-1508.849] (-1513.446) (-1506.552) -- 0:00:55
593000 -- (-1507.580) (-1507.272) (-1503.006) [-1506.775] * (-1507.168) (-1510.406) (-1508.237) [-1506.250] -- 0:00:55
593500 -- (-1508.199) [-1506.440] (-1515.306) (-1513.845) * (-1506.369) (-1511.284) [-1510.709] (-1507.436) -- 0:00:55
594000 -- (-1507.179) (-1511.795) [-1509.096] (-1518.078) * (-1506.256) [-1509.934] (-1510.568) (-1507.369) -- 0:00:55
594500 -- [-1505.345] (-1509.913) (-1512.589) (-1519.673) * [-1510.478] (-1511.993) (-1510.487) (-1508.471) -- 0:00:55
595000 -- (-1505.463) [-1509.351] (-1515.540) (-1516.038) * (-1510.228) (-1507.360) (-1509.295) [-1511.552] -- 0:00:55
Average standard deviation of split frequencies: 0.018192
595500 -- (-1508.319) (-1513.152) (-1510.665) [-1507.454] * [-1508.804] (-1509.846) (-1508.181) (-1507.541) -- 0:00:55
596000 -- (-1508.117) (-1509.737) [-1508.367] (-1521.986) * (-1513.324) [-1509.603] (-1510.285) (-1507.503) -- 0:00:55
596500 -- [-1509.566] (-1509.657) (-1506.363) (-1512.450) * (-1512.870) (-1510.206) (-1513.610) [-1506.179] -- 0:00:55
597000 -- [-1504.157] (-1507.610) (-1508.706) (-1506.544) * (-1506.250) (-1506.934) (-1507.916) [-1510.851] -- 0:00:55
597500 -- [-1509.299] (-1508.716) (-1504.192) (-1507.931) * [-1506.739] (-1510.512) (-1510.059) (-1516.461) -- 0:00:55
598000 -- (-1513.316) (-1512.070) [-1508.928] (-1510.556) * (-1506.977) (-1512.417) [-1504.373] (-1516.383) -- 0:00:55
598500 -- (-1510.103) (-1511.113) [-1507.596] (-1512.793) * [-1509.062] (-1508.023) (-1512.927) (-1510.964) -- 0:00:55
599000 -- (-1511.956) (-1506.662) (-1505.243) [-1507.123] * (-1509.077) (-1510.540) (-1510.691) [-1509.410] -- 0:00:54
599500 -- (-1509.496) (-1515.632) [-1506.994] (-1506.813) * [-1511.826] (-1507.176) (-1508.709) (-1504.934) -- 0:00:54
600000 -- [-1510.041] (-1516.551) (-1507.167) (-1507.798) * (-1512.386) (-1508.336) (-1515.577) [-1510.009] -- 0:00:54
Average standard deviation of split frequencies: 0.017266
600500 -- (-1510.365) (-1515.631) (-1510.356) [-1507.968] * (-1505.281) [-1511.247] (-1509.014) (-1509.718) -- 0:00:54
601000 -- [-1506.435] (-1512.595) (-1509.514) (-1508.324) * (-1515.741) (-1514.053) (-1507.382) [-1508.573] -- 0:00:54
601500 -- [-1506.808] (-1509.467) (-1508.529) (-1511.273) * (-1509.117) (-1507.067) [-1510.113] (-1507.345) -- 0:00:54
602000 -- (-1510.459) [-1511.083] (-1515.634) (-1510.050) * (-1507.048) (-1511.217) [-1504.706] (-1511.004) -- 0:00:54
602500 -- (-1514.696) (-1511.866) [-1507.091] (-1508.075) * (-1508.906) [-1505.108] (-1506.986) (-1512.271) -- 0:00:54
603000 -- (-1511.775) (-1510.539) [-1507.836] (-1508.152) * (-1511.935) (-1507.798) [-1507.525] (-1510.623) -- 0:00:54
603500 -- (-1514.790) (-1511.476) [-1505.485] (-1508.607) * (-1509.669) [-1509.612] (-1509.260) (-1507.020) -- 0:00:54
604000 -- (-1506.161) (-1510.703) (-1511.026) [-1507.642] * [-1510.012] (-1517.599) (-1506.376) (-1506.009) -- 0:00:54
604500 -- (-1505.854) (-1507.686) (-1509.485) [-1505.582] * [-1504.449] (-1516.264) (-1507.463) (-1505.443) -- 0:00:54
605000 -- [-1505.113] (-1511.778) (-1507.424) (-1517.330) * (-1506.375) (-1516.963) [-1508.970] (-1507.643) -- 0:00:54
Average standard deviation of split frequencies: 0.019447
605500 -- (-1509.733) (-1503.930) (-1512.314) [-1508.359] * (-1511.465) (-1508.080) [-1514.980] (-1509.437) -- 0:00:54
606000 -- (-1508.331) [-1509.379] (-1512.555) (-1518.988) * (-1514.611) [-1508.918] (-1513.084) (-1507.500) -- 0:00:53
606500 -- (-1510.696) (-1511.473) [-1508.423] (-1513.883) * (-1509.576) (-1513.516) [-1509.361] (-1509.765) -- 0:00:53
607000 -- [-1507.682] (-1509.596) (-1516.277) (-1506.354) * (-1517.168) (-1517.913) [-1506.135] (-1510.360) -- 0:00:53
607500 -- (-1511.858) [-1506.512] (-1511.297) (-1504.960) * (-1509.781) (-1510.929) [-1505.996] (-1525.315) -- 0:00:53
608000 -- (-1516.124) (-1509.241) (-1512.251) [-1510.963] * (-1509.281) (-1509.641) (-1506.886) [-1512.643] -- 0:00:53
608500 -- (-1507.848) (-1508.032) [-1506.093] (-1505.840) * (-1508.078) (-1515.091) [-1508.376] (-1507.831) -- 0:00:53
609000 -- (-1505.930) [-1507.891] (-1504.070) (-1514.062) * (-1509.712) [-1506.812] (-1509.537) (-1509.376) -- 0:00:53
609500 -- (-1512.498) (-1509.424) [-1512.073] (-1508.711) * (-1507.224) (-1507.986) (-1510.020) [-1515.394] -- 0:00:53
610000 -- (-1522.595) (-1506.117) (-1509.461) [-1512.558] * (-1511.607) (-1506.701) [-1511.455] (-1511.993) -- 0:00:53
Average standard deviation of split frequencies: 0.021229
610500 -- [-1510.359] (-1508.963) (-1509.706) (-1514.921) * (-1513.737) [-1510.552] (-1510.014) (-1509.865) -- 0:00:53
611000 -- (-1508.299) [-1508.724] (-1508.628) (-1511.194) * [-1506.222] (-1518.061) (-1518.690) (-1509.952) -- 0:00:53
611500 -- (-1514.106) (-1509.404) (-1503.780) [-1507.252] * [-1509.351] (-1519.299) (-1517.281) (-1511.148) -- 0:00:53
612000 -- (-1512.278) [-1512.594] (-1505.738) (-1511.920) * (-1507.762) [-1509.476] (-1518.205) (-1516.366) -- 0:00:53
612500 -- (-1511.719) (-1507.865) (-1508.871) [-1512.271] * (-1514.193) [-1508.427] (-1509.588) (-1509.292) -- 0:00:53
613000 -- (-1509.753) (-1512.280) [-1508.323] (-1507.357) * [-1510.195] (-1508.712) (-1510.616) (-1513.723) -- 0:00:53
613500 -- (-1507.666) (-1509.638) [-1510.350] (-1506.763) * [-1508.329] (-1517.860) (-1511.918) (-1511.365) -- 0:00:52
614000 -- (-1506.314) [-1507.321] (-1513.808) (-1513.648) * [-1506.845] (-1510.336) (-1507.201) (-1514.746) -- 0:00:52
614500 -- (-1508.833) [-1507.897] (-1510.627) (-1510.216) * [-1505.698] (-1510.998) (-1516.161) (-1510.977) -- 0:00:52
615000 -- (-1508.573) (-1508.944) [-1509.591] (-1515.223) * [-1509.495] (-1510.167) (-1514.925) (-1511.428) -- 0:00:52
Average standard deviation of split frequencies: 0.019132
615500 -- (-1511.074) [-1509.475] (-1509.524) (-1509.730) * (-1514.006) (-1503.850) (-1515.073) [-1506.702] -- 0:00:52
616000 -- (-1505.942) [-1515.127] (-1516.711) (-1509.569) * (-1510.923) (-1510.009) (-1508.217) [-1512.195] -- 0:00:52
616500 -- [-1505.130] (-1513.326) (-1519.120) (-1508.847) * (-1509.629) (-1506.015) (-1513.014) [-1507.576] -- 0:00:52
617000 -- (-1506.768) [-1507.213] (-1509.860) (-1506.778) * (-1512.155) (-1509.892) (-1511.240) [-1509.819] -- 0:00:52
617500 -- (-1510.314) [-1505.620] (-1509.368) (-1508.655) * (-1511.366) (-1511.785) [-1508.629] (-1510.909) -- 0:00:52
618000 -- [-1512.571] (-1507.428) (-1507.468) (-1506.846) * (-1504.888) (-1511.019) [-1509.417] (-1512.973) -- 0:00:52
618500 -- (-1515.166) (-1510.764) (-1509.127) [-1505.808] * (-1509.292) [-1511.641] (-1509.704) (-1512.013) -- 0:00:52
619000 -- (-1509.772) (-1514.405) [-1506.852] (-1508.620) * (-1509.036) (-1510.205) [-1508.078] (-1509.476) -- 0:00:52
619500 -- [-1507.020] (-1513.032) (-1510.869) (-1510.119) * [-1504.859] (-1509.153) (-1513.613) (-1509.926) -- 0:00:52
620000 -- (-1510.130) (-1507.219) (-1505.517) [-1504.203] * (-1508.347) [-1505.914] (-1507.269) (-1509.037) -- 0:00:52
Average standard deviation of split frequencies: 0.020507
620500 -- (-1515.684) (-1509.639) (-1506.579) [-1508.320] * [-1509.277] (-1513.000) (-1508.426) (-1508.041) -- 0:00:51
621000 -- (-1516.119) (-1506.477) [-1505.384] (-1508.898) * (-1511.931) (-1508.253) [-1509.824] (-1511.485) -- 0:00:51
621500 -- (-1514.874) (-1510.212) (-1508.491) [-1509.898] * (-1513.905) (-1513.661) [-1511.808] (-1516.040) -- 0:00:51
622000 -- [-1506.440] (-1512.176) (-1505.320) (-1516.137) * [-1516.292] (-1513.687) (-1509.332) (-1515.680) -- 0:00:51
622500 -- (-1507.498) (-1516.354) [-1510.904] (-1515.417) * (-1517.205) (-1510.020) (-1506.133) [-1508.650] -- 0:00:51
623000 -- [-1506.494] (-1507.774) (-1510.054) (-1508.038) * [-1512.172] (-1507.365) (-1507.294) (-1507.532) -- 0:00:51
623500 -- (-1506.509) (-1512.092) (-1516.234) [-1504.403] * (-1507.768) [-1512.717] (-1506.940) (-1510.635) -- 0:00:51
624000 -- [-1516.638] (-1509.894) (-1513.206) (-1511.406) * (-1510.399) (-1509.774) [-1509.607] (-1521.519) -- 0:00:51
624500 -- (-1507.200) [-1507.596] (-1510.874) (-1508.653) * [-1513.730] (-1507.423) (-1505.649) (-1515.332) -- 0:00:51
625000 -- (-1505.774) (-1510.873) (-1507.247) [-1506.754] * [-1511.947] (-1505.181) (-1511.872) (-1512.167) -- 0:00:51
Average standard deviation of split frequencies: 0.019579
625500 -- (-1503.509) (-1512.801) [-1510.716] (-1515.805) * (-1506.744) [-1509.851] (-1510.693) (-1509.699) -- 0:00:51
626000 -- (-1509.504) (-1513.290) (-1509.774) [-1507.276] * [-1506.178] (-1513.769) (-1510.057) (-1515.839) -- 0:00:51
626500 -- (-1509.297) (-1510.910) (-1507.833) [-1507.487] * (-1509.787) (-1511.457) (-1509.419) [-1507.488] -- 0:00:51
627000 -- (-1511.832) (-1511.579) [-1507.805] (-1506.887) * (-1515.104) [-1511.720] (-1510.158) (-1508.700) -- 0:00:51
627500 -- (-1505.804) [-1507.924] (-1507.259) (-1510.812) * (-1503.859) [-1509.786] (-1502.413) (-1507.851) -- 0:00:51
628000 -- [-1503.019] (-1507.838) (-1511.787) (-1514.152) * (-1508.913) [-1509.636] (-1513.188) (-1511.267) -- 0:00:50
628500 -- (-1519.736) (-1506.799) [-1509.079] (-1515.268) * [-1508.229] (-1509.472) (-1510.821) (-1506.189) -- 0:00:50
629000 -- (-1508.487) (-1511.417) [-1512.861] (-1509.769) * (-1508.931) (-1506.050) (-1510.629) [-1507.724] -- 0:00:50
629500 -- [-1508.827] (-1508.975) (-1512.537) (-1510.938) * (-1510.132) (-1505.163) [-1507.810] (-1509.330) -- 0:00:50
630000 -- [-1505.760] (-1512.445) (-1511.510) (-1508.010) * (-1512.867) (-1507.736) [-1511.814] (-1505.274) -- 0:00:50
Average standard deviation of split frequencies: 0.021677
630500 -- (-1506.095) (-1510.087) (-1509.213) [-1511.101] * (-1508.844) (-1505.558) [-1508.696] (-1507.545) -- 0:00:50
631000 -- (-1514.408) (-1512.324) [-1508.097] (-1515.170) * (-1504.820) (-1514.081) [-1513.247] (-1507.704) -- 0:00:50
631500 -- (-1507.602) (-1508.315) [-1507.956] (-1513.345) * [-1507.161] (-1514.490) (-1509.873) (-1509.749) -- 0:00:50
632000 -- (-1508.691) (-1513.417) (-1518.522) [-1511.267] * [-1508.510] (-1508.426) (-1516.648) (-1508.999) -- 0:00:50
632500 -- [-1509.395] (-1510.946) (-1514.659) (-1505.759) * (-1513.111) (-1509.087) (-1510.875) [-1513.598] -- 0:00:50
633000 -- [-1508.552] (-1510.323) (-1512.232) (-1512.864) * [-1509.398] (-1510.666) (-1509.591) (-1512.711) -- 0:00:50
633500 -- (-1506.222) [-1512.869] (-1511.618) (-1512.107) * [-1508.278] (-1513.033) (-1513.329) (-1510.744) -- 0:00:50
634000 -- (-1510.322) [-1507.518] (-1509.806) (-1506.053) * [-1516.664] (-1514.090) (-1509.277) (-1512.688) -- 0:00:50
634500 -- (-1505.036) [-1505.894] (-1512.819) (-1508.021) * (-1509.664) (-1509.280) [-1516.227] (-1509.698) -- 0:00:50
635000 -- [-1503.481] (-1505.412) (-1516.124) (-1511.420) * [-1508.431] (-1506.948) (-1524.178) (-1510.650) -- 0:00:50
Average standard deviation of split frequencies: 0.020383
635500 -- (-1509.513) (-1506.282) (-1508.511) [-1511.932] * (-1507.523) (-1515.654) (-1513.590) [-1504.301] -- 0:00:49
636000 -- (-1510.091) [-1506.406] (-1513.783) (-1512.425) * [-1503.777] (-1507.339) (-1510.016) (-1504.425) -- 0:00:49
636500 -- [-1508.970] (-1509.370) (-1511.441) (-1513.635) * (-1509.951) (-1504.819) (-1511.025) [-1512.417] -- 0:00:49
637000 -- (-1509.240) [-1507.167] (-1505.818) (-1517.161) * (-1510.730) [-1509.374] (-1513.725) (-1508.472) -- 0:00:49
637500 -- (-1506.848) (-1510.407) [-1511.575] (-1510.462) * (-1507.311) (-1511.216) (-1515.345) [-1505.219] -- 0:00:50
638000 -- [-1506.711] (-1513.415) (-1509.361) (-1517.104) * (-1508.979) (-1506.302) (-1508.521) [-1509.974] -- 0:00:49
638500 -- (-1506.003) (-1508.249) [-1509.786] (-1508.269) * (-1510.109) (-1514.556) [-1508.845] (-1512.676) -- 0:00:49
639000 -- [-1506.358] (-1510.607) (-1514.265) (-1510.242) * [-1512.115] (-1511.800) (-1508.710) (-1511.411) -- 0:00:49
639500 -- (-1509.378) (-1505.595) [-1506.496] (-1516.290) * (-1507.886) (-1508.527) [-1510.587] (-1515.272) -- 0:00:49
640000 -- (-1508.130) (-1507.186) [-1512.226] (-1510.757) * (-1508.815) (-1511.945) (-1507.311) [-1510.159] -- 0:00:49
Average standard deviation of split frequencies: 0.019499
640500 -- [-1511.972] (-1513.097) (-1507.386) (-1508.960) * (-1507.166) (-1521.004) (-1506.785) [-1508.630] -- 0:00:49
641000 -- (-1510.661) (-1509.668) [-1505.735] (-1507.637) * (-1506.018) [-1508.725] (-1507.658) (-1509.124) -- 0:00:49
641500 -- (-1510.465) [-1515.050] (-1507.196) (-1511.859) * (-1504.432) [-1505.196] (-1514.908) (-1511.327) -- 0:00:49
642000 -- [-1508.231] (-1505.811) (-1510.712) (-1515.179) * (-1506.924) (-1507.326) [-1509.546] (-1512.843) -- 0:00:49
642500 -- [-1508.208] (-1509.004) (-1514.086) (-1511.514) * (-1512.005) [-1505.373] (-1504.985) (-1513.741) -- 0:00:48
643000 -- [-1509.261] (-1508.713) (-1513.882) (-1505.045) * (-1509.656) [-1505.727] (-1505.287) (-1509.879) -- 0:00:48
643500 -- (-1507.559) (-1511.373) [-1508.888] (-1508.895) * (-1511.868) (-1507.292) [-1506.413] (-1506.841) -- 0:00:48
644000 -- (-1512.361) (-1504.170) [-1509.500] (-1508.367) * (-1509.648) (-1504.666) [-1509.301] (-1503.542) -- 0:00:48
644500 -- (-1510.249) [-1507.541] (-1509.528) (-1510.280) * (-1507.480) [-1506.608] (-1508.760) (-1506.006) -- 0:00:49
645000 -- [-1508.414] (-1506.026) (-1516.544) (-1511.288) * [-1517.214] (-1509.629) (-1509.638) (-1506.841) -- 0:00:48
Average standard deviation of split frequencies: 0.018608
645500 -- (-1509.463) [-1507.897] (-1514.018) (-1511.311) * (-1512.588) (-1510.129) [-1512.134] (-1508.687) -- 0:00:48
646000 -- (-1503.001) (-1513.528) (-1511.667) [-1512.607] * (-1505.420) (-1508.676) (-1511.004) [-1509.790] -- 0:00:48
646500 -- [-1506.350] (-1506.477) (-1509.304) (-1507.059) * (-1512.719) (-1507.415) (-1507.572) [-1511.070] -- 0:00:48
647000 -- [-1506.889] (-1510.364) (-1510.730) (-1515.366) * (-1510.025) [-1509.850] (-1509.383) (-1508.250) -- 0:00:48
647500 -- [-1505.569] (-1512.176) (-1512.063) (-1507.434) * (-1513.266) (-1512.621) (-1517.907) [-1505.948] -- 0:00:48
648000 -- (-1516.693) (-1505.290) (-1513.507) [-1509.124] * (-1512.821) (-1509.869) [-1508.698] (-1510.528) -- 0:00:48
648500 -- (-1510.211) (-1508.440) [-1511.792] (-1514.689) * (-1509.327) [-1511.021] (-1512.076) (-1508.773) -- 0:00:48
649000 -- (-1512.252) (-1508.363) (-1507.379) [-1504.994] * (-1513.746) [-1511.179] (-1505.277) (-1505.808) -- 0:00:48
649500 -- (-1517.351) [-1505.103] (-1512.373) (-1509.590) * (-1508.717) (-1506.892) [-1508.049] (-1509.194) -- 0:00:48
650000 -- (-1511.607) (-1508.634) (-1507.491) [-1506.651] * (-1515.518) (-1508.512) (-1506.244) [-1508.316] -- 0:00:47
Average standard deviation of split frequencies: 0.022459
650500 -- [-1508.763] (-1511.777) (-1505.297) (-1511.067) * [-1506.096] (-1513.804) (-1506.999) (-1514.477) -- 0:00:47
651000 -- (-1511.695) (-1516.269) (-1503.220) [-1507.260] * (-1504.542) (-1506.769) [-1514.321] (-1515.186) -- 0:00:47
651500 -- (-1506.182) (-1515.722) (-1507.600) [-1504.852] * (-1509.987) (-1511.272) (-1510.772) [-1514.731] -- 0:00:48
652000 -- (-1505.712) (-1508.394) (-1507.140) [-1508.284] * [-1510.032] (-1515.645) (-1508.144) (-1513.718) -- 0:00:48
652500 -- [-1505.908] (-1506.452) (-1508.779) (-1504.953) * (-1512.276) (-1517.305) [-1507.711] (-1512.900) -- 0:00:47
653000 -- (-1507.408) (-1511.291) [-1509.629] (-1509.256) * [-1507.064] (-1506.659) (-1511.233) (-1509.416) -- 0:00:47
653500 -- (-1505.799) (-1507.946) (-1508.905) [-1506.052] * [-1509.489] (-1511.145) (-1514.614) (-1515.878) -- 0:00:47
654000 -- (-1511.607) [-1511.448] (-1508.765) (-1508.257) * (-1510.712) (-1512.156) (-1516.085) [-1514.607] -- 0:00:47
654500 -- (-1511.360) (-1516.027) [-1511.890] (-1511.114) * (-1511.056) (-1508.146) (-1512.332) [-1509.038] -- 0:00:47
655000 -- (-1508.992) (-1505.684) (-1504.344) [-1509.967] * [-1506.691] (-1507.924) (-1507.216) (-1503.985) -- 0:00:47
Average standard deviation of split frequencies: 0.020121
655500 -- (-1505.174) (-1509.876) [-1507.625] (-1517.208) * (-1514.884) [-1510.047] (-1510.256) (-1512.846) -- 0:00:47
656000 -- (-1503.667) [-1511.937] (-1511.674) (-1510.089) * (-1509.994) (-1509.331) [-1511.352] (-1506.971) -- 0:00:47
656500 -- (-1514.378) [-1509.911] (-1511.756) (-1510.064) * [-1509.248] (-1510.667) (-1513.292) (-1507.575) -- 0:00:47
657000 -- [-1510.313] (-1507.940) (-1519.043) (-1511.164) * (-1512.830) (-1508.496) (-1509.666) [-1509.552] -- 0:00:46
657500 -- (-1514.616) (-1506.994) (-1510.199) [-1509.588] * (-1516.250) (-1504.774) [-1510.869] (-1508.906) -- 0:00:46
658000 -- (-1510.447) (-1512.550) (-1506.682) [-1506.653] * (-1511.926) (-1511.006) [-1512.761] (-1512.900) -- 0:00:47
658500 -- (-1508.736) (-1512.358) [-1510.114] (-1511.089) * [-1512.350] (-1510.168) (-1511.621) (-1513.386) -- 0:00:47
659000 -- (-1505.444) [-1508.122] (-1509.131) (-1510.737) * (-1504.013) (-1509.018) [-1510.065] (-1508.759) -- 0:00:47
659500 -- (-1506.991) [-1504.849] (-1510.049) (-1509.702) * (-1508.037) (-1514.371) (-1510.507) [-1506.582] -- 0:00:46
660000 -- (-1509.071) (-1508.555) (-1509.048) [-1506.691] * (-1510.002) (-1508.802) [-1511.154] (-1508.060) -- 0:00:46
Average standard deviation of split frequencies: 0.022119
660500 -- [-1511.932] (-1511.185) (-1510.287) (-1507.200) * (-1510.438) (-1507.035) [-1504.809] (-1510.589) -- 0:00:46
661000 -- (-1512.390) (-1511.459) (-1515.654) [-1505.588] * [-1511.217] (-1507.664) (-1509.420) (-1508.620) -- 0:00:46
661500 -- (-1513.972) [-1505.422] (-1515.671) (-1508.367) * (-1507.423) [-1505.907] (-1510.837) (-1511.924) -- 0:00:46
662000 -- (-1514.335) [-1510.224] (-1509.170) (-1510.585) * [-1508.769] (-1510.532) (-1510.380) (-1507.230) -- 0:00:46
662500 -- (-1508.624) [-1512.033] (-1509.973) (-1509.827) * (-1512.049) [-1508.285] (-1510.189) (-1510.553) -- 0:00:46
663000 -- [-1508.486] (-1506.431) (-1507.638) (-1506.490) * (-1508.294) (-1510.182) [-1507.117] (-1508.325) -- 0:00:46
663500 -- [-1508.980] (-1508.849) (-1507.109) (-1516.404) * (-1507.589) (-1510.238) (-1508.453) [-1510.020] -- 0:00:46
664000 -- (-1505.903) (-1515.701) (-1508.021) [-1507.920] * (-1506.347) (-1518.446) [-1509.316] (-1513.100) -- 0:00:46
664500 -- (-1506.461) (-1506.424) (-1504.561) [-1512.022] * [-1506.595] (-1511.634) (-1513.114) (-1507.873) -- 0:00:45
665000 -- [-1511.451] (-1507.640) (-1504.914) (-1510.198) * (-1507.151) [-1510.039] (-1513.164) (-1510.834) -- 0:00:46
Average standard deviation of split frequencies: 0.020881
665500 -- (-1509.759) (-1506.732) [-1510.513] (-1505.007) * (-1509.488) (-1516.095) (-1512.309) [-1507.429] -- 0:00:46
666000 -- [-1507.715] (-1515.178) (-1510.279) (-1509.296) * (-1506.797) (-1507.893) [-1520.730] (-1510.106) -- 0:00:46
666500 -- (-1509.057) [-1514.905] (-1511.049) (-1511.292) * (-1504.855) [-1511.526] (-1510.837) (-1509.990) -- 0:00:46
667000 -- [-1511.184] (-1508.314) (-1513.241) (-1506.761) * [-1507.741] (-1505.499) (-1508.046) (-1512.639) -- 0:00:45
667500 -- (-1508.726) (-1504.545) (-1507.595) [-1514.260] * (-1505.523) [-1508.300] (-1511.920) (-1509.992) -- 0:00:45
668000 -- (-1507.306) (-1507.577) (-1508.427) [-1512.151] * (-1509.481) (-1509.152) (-1505.883) [-1508.882] -- 0:00:45
668500 -- (-1515.309) [-1511.761] (-1506.312) (-1506.388) * (-1519.670) (-1510.155) [-1510.815] (-1507.269) -- 0:00:45
669000 -- (-1512.529) (-1504.393) [-1508.525] (-1507.392) * (-1529.965) (-1510.734) [-1508.984] (-1513.230) -- 0:00:45
669500 -- (-1510.657) (-1508.330) [-1510.093] (-1509.444) * (-1516.285) (-1512.997) (-1506.618) [-1508.730] -- 0:00:45
670000 -- (-1505.896) [-1506.743] (-1511.860) (-1512.752) * (-1506.089) (-1509.628) [-1506.769] (-1508.806) -- 0:00:45
Average standard deviation of split frequencies: 0.024601
670500 -- [-1510.053] (-1505.343) (-1514.316) (-1510.753) * (-1511.511) [-1507.739] (-1510.564) (-1508.969) -- 0:00:45
671000 -- (-1510.507) (-1511.065) (-1511.627) [-1509.778] * (-1510.224) (-1508.854) [-1508.121] (-1517.567) -- 0:00:45
671500 -- [-1509.141] (-1507.659) (-1506.468) (-1507.282) * [-1508.978] (-1506.914) (-1512.765) (-1510.012) -- 0:00:45
672000 -- (-1507.316) (-1517.233) [-1505.154] (-1512.216) * (-1509.274) [-1512.250] (-1512.443) (-1512.562) -- 0:00:45
672500 -- [-1509.220] (-1513.888) (-1510.893) (-1514.023) * (-1513.555) [-1506.375] (-1509.995) (-1510.378) -- 0:00:45
673000 -- (-1507.794) (-1518.899) (-1514.261) [-1505.768] * (-1514.530) (-1509.203) (-1507.580) [-1507.392] -- 0:00:45
673500 -- (-1508.063) (-1509.975) (-1511.285) [-1506.923] * [-1508.685] (-1510.648) (-1510.883) (-1507.976) -- 0:00:45
674000 -- (-1510.646) (-1508.646) [-1506.872] (-1507.484) * (-1508.061) (-1510.963) (-1513.359) [-1503.935] -- 0:00:44
674500 -- [-1508.834] (-1509.087) (-1511.311) (-1507.174) * (-1509.906) (-1509.174) (-1521.725) [-1506.480] -- 0:00:44
675000 -- [-1508.038] (-1510.431) (-1509.872) (-1513.048) * (-1515.692) (-1508.251) (-1520.613) [-1510.708] -- 0:00:44
Average standard deviation of split frequencies: 0.019526
675500 -- [-1510.733] (-1507.235) (-1509.446) (-1507.396) * [-1512.462] (-1505.090) (-1517.385) (-1511.285) -- 0:00:44
676000 -- [-1510.622] (-1514.144) (-1506.200) (-1507.531) * (-1512.209) (-1512.401) [-1518.310] (-1507.281) -- 0:00:44
676500 -- (-1513.300) (-1507.377) [-1515.129] (-1511.158) * (-1510.942) (-1511.688) (-1513.343) [-1510.182] -- 0:00:44
677000 -- (-1515.085) [-1510.642] (-1510.821) (-1511.965) * [-1507.504] (-1508.775) (-1510.077) (-1508.203) -- 0:00:44
677500 -- [-1509.017] (-1509.679) (-1512.644) (-1507.436) * (-1505.281) (-1512.752) [-1508.350] (-1507.158) -- 0:00:44
678000 -- [-1512.297] (-1520.232) (-1514.862) (-1507.162) * (-1511.612) (-1507.374) [-1510.838] (-1509.606) -- 0:00:44
678500 -- (-1510.369) [-1507.405] (-1513.483) (-1510.024) * (-1508.646) (-1507.012) (-1512.132) [-1507.171] -- 0:00:44
679000 -- (-1511.549) [-1510.446] (-1516.017) (-1512.629) * (-1512.074) (-1508.097) [-1506.950] (-1507.042) -- 0:00:44
679500 -- (-1507.986) (-1508.853) (-1510.442) [-1504.969] * [-1508.131] (-1511.372) (-1509.158) (-1510.558) -- 0:00:44
680000 -- (-1507.839) (-1504.261) [-1509.560] (-1509.997) * (-1508.587) (-1509.892) (-1510.493) [-1510.146] -- 0:00:44
Average standard deviation of split frequencies: 0.022855
680500 -- (-1506.337) (-1509.510) (-1515.109) [-1508.394] * (-1508.223) [-1510.454] (-1511.635) (-1509.721) -- 0:00:44
681000 -- (-1505.673) [-1505.921] (-1511.339) (-1510.941) * (-1516.379) [-1511.584] (-1514.326) (-1505.044) -- 0:00:44
681500 -- [-1509.524] (-1507.471) (-1505.426) (-1506.816) * (-1506.612) [-1512.917] (-1510.852) (-1521.035) -- 0:00:43
682000 -- (-1513.360) (-1509.193) (-1515.753) [-1509.943] * (-1513.936) (-1508.235) [-1509.491] (-1514.620) -- 0:00:43
682500 -- (-1510.027) (-1513.063) [-1510.806] (-1513.152) * (-1520.977) [-1511.118] (-1508.828) (-1511.033) -- 0:00:43
683000 -- [-1507.826] (-1512.085) (-1517.452) (-1510.969) * (-1514.769) [-1508.880] (-1512.843) (-1511.235) -- 0:00:43
683500 -- (-1507.602) [-1512.154] (-1516.242) (-1515.599) * (-1514.416) (-1508.864) [-1506.578] (-1506.282) -- 0:00:43
684000 -- (-1509.807) (-1516.951) [-1513.389] (-1510.031) * (-1517.377) (-1512.254) [-1512.787] (-1506.359) -- 0:00:43
684500 -- (-1510.947) (-1507.804) [-1511.006] (-1512.812) * (-1515.028) [-1504.336] (-1513.736) (-1507.568) -- 0:00:43
685000 -- (-1512.281) (-1511.655) (-1509.386) [-1508.423] * (-1511.278) [-1508.521] (-1507.769) (-1506.971) -- 0:00:43
Average standard deviation of split frequencies: 0.023708
685500 -- (-1512.518) (-1511.825) [-1510.564] (-1511.866) * (-1502.915) [-1507.024] (-1511.731) (-1508.633) -- 0:00:43
686000 -- (-1514.728) (-1511.641) [-1504.397] (-1510.318) * (-1505.805) (-1505.074) [-1508.200] (-1514.628) -- 0:00:43
686500 -- [-1512.265] (-1509.634) (-1506.707) (-1514.151) * (-1506.851) (-1509.606) [-1507.545] (-1508.398) -- 0:00:43
687000 -- (-1513.031) (-1505.351) (-1512.054) [-1510.706] * (-1507.662) (-1512.777) [-1506.100] (-1506.135) -- 0:00:43
687500 -- (-1513.053) (-1510.200) [-1508.978] (-1510.761) * (-1510.402) (-1508.044) [-1505.267] (-1505.540) -- 0:00:43
688000 -- (-1509.121) (-1511.995) [-1509.524] (-1512.134) * (-1508.392) [-1509.477] (-1508.802) (-1513.119) -- 0:00:43
688500 -- [-1504.499] (-1509.114) (-1504.507) (-1506.477) * (-1511.892) (-1523.562) [-1506.172] (-1507.228) -- 0:00:42
689000 -- (-1506.353) (-1507.728) (-1510.646) [-1505.597] * [-1504.599] (-1509.168) (-1509.249) (-1512.344) -- 0:00:42
689500 -- [-1505.561] (-1505.655) (-1515.109) (-1510.904) * [-1511.457] (-1511.452) (-1507.848) (-1505.196) -- 0:00:42
690000 -- (-1514.460) (-1511.863) (-1507.039) [-1507.642] * (-1510.720) [-1507.863] (-1505.971) (-1509.217) -- 0:00:42
Average standard deviation of split frequencies: 0.023206
690500 -- (-1513.709) (-1512.385) (-1511.170) [-1506.422] * [-1507.602] (-1512.200) (-1508.082) (-1510.018) -- 0:00:42
691000 -- (-1515.207) (-1512.518) (-1510.770) [-1505.586] * (-1507.110) (-1512.647) [-1507.593] (-1511.393) -- 0:00:42
691500 -- (-1514.014) [-1509.466] (-1512.824) (-1509.357) * [-1513.487] (-1510.459) (-1512.729) (-1508.239) -- 0:00:42
692000 -- (-1514.611) (-1515.478) [-1509.651] (-1510.601) * (-1511.905) [-1509.382] (-1508.892) (-1514.962) -- 0:00:42
692500 -- (-1524.943) (-1514.227) (-1508.938) [-1509.166] * [-1510.420] (-1511.588) (-1508.318) (-1510.621) -- 0:00:42
693000 -- (-1522.733) (-1516.255) [-1505.260] (-1507.456) * (-1513.896) (-1510.176) [-1505.534] (-1508.657) -- 0:00:42
693500 -- (-1519.929) (-1508.665) [-1508.291] (-1518.669) * (-1511.715) (-1517.634) [-1509.300] (-1511.018) -- 0:00:42
694000 -- (-1522.266) (-1511.430) (-1505.426) [-1509.357] * (-1516.708) (-1522.888) [-1508.027] (-1508.160) -- 0:00:42
694500 -- (-1518.662) [-1507.189] (-1507.164) (-1512.115) * (-1513.593) (-1517.822) [-1511.950] (-1509.770) -- 0:00:42
695000 -- (-1516.143) (-1509.530) (-1509.300) [-1505.411] * (-1508.698) (-1511.808) (-1512.073) [-1510.055] -- 0:00:42
Average standard deviation of split frequencies: 0.024383
695500 -- (-1524.205) [-1503.528] (-1509.137) (-1508.644) * (-1511.876) (-1511.816) [-1507.827] (-1506.618) -- 0:00:42
696000 -- [-1513.953] (-1515.540) (-1508.484) (-1507.141) * (-1510.959) (-1509.493) [-1509.514] (-1511.387) -- 0:00:41
696500 -- (-1507.912) (-1504.777) [-1510.812] (-1509.716) * (-1510.052) (-1510.265) (-1506.869) [-1509.938] -- 0:00:41
697000 -- (-1516.025) [-1507.780] (-1507.570) (-1515.671) * (-1508.023) (-1510.636) (-1514.260) [-1508.143] -- 0:00:41
697500 -- (-1513.987) [-1507.661] (-1510.022) (-1513.137) * (-1505.446) [-1506.231] (-1513.304) (-1510.467) -- 0:00:42
698000 -- (-1509.027) (-1506.221) [-1506.904] (-1510.709) * [-1510.227] (-1506.565) (-1518.794) (-1512.689) -- 0:00:41
698500 -- (-1508.859) (-1510.779) (-1506.316) [-1508.158] * (-1505.605) (-1508.016) [-1507.755] (-1512.525) -- 0:00:41
699000 -- (-1505.725) [-1507.920] (-1508.448) (-1514.528) * [-1503.838] (-1512.136) (-1506.370) (-1508.929) -- 0:00:41
699500 -- (-1512.153) (-1504.647) (-1514.589) [-1513.534] * [-1506.658] (-1512.828) (-1508.999) (-1509.091) -- 0:00:41
700000 -- (-1507.296) (-1507.996) (-1509.995) [-1511.213] * (-1514.811) (-1505.807) (-1507.425) [-1504.673] -- 0:00:41
Average standard deviation of split frequencies: 0.022539
700500 -- (-1510.311) (-1513.498) (-1508.455) [-1512.082] * [-1511.998] (-1508.608) (-1508.672) (-1510.558) -- 0:00:41
701000 -- (-1512.345) (-1509.932) [-1509.712] (-1509.361) * (-1513.197) [-1506.920] (-1508.613) (-1510.315) -- 0:00:41
701500 -- (-1507.394) (-1509.748) (-1512.151) [-1508.178] * (-1511.383) (-1509.526) (-1508.885) [-1513.135] -- 0:00:41
702000 -- [-1506.370] (-1506.617) (-1510.321) (-1511.124) * (-1507.951) (-1509.239) (-1509.534) [-1507.963] -- 0:00:41
702500 -- (-1507.798) [-1510.180] (-1513.884) (-1505.877) * [-1510.202] (-1505.704) (-1509.550) (-1511.770) -- 0:00:41
703000 -- (-1508.339) (-1508.057) [-1509.474] (-1509.941) * (-1510.749) (-1506.392) (-1505.253) [-1508.857] -- 0:00:40
703500 -- [-1507.314] (-1506.795) (-1511.148) (-1507.276) * (-1509.322) (-1505.808) [-1505.644] (-1509.509) -- 0:00:40
704000 -- (-1506.988) [-1512.567] (-1510.615) (-1514.080) * (-1507.929) (-1507.975) (-1512.291) [-1508.185] -- 0:00:41
704500 -- (-1517.089) [-1508.476] (-1517.458) (-1510.702) * (-1512.467) (-1507.700) [-1508.516] (-1513.245) -- 0:00:41
705000 -- (-1512.010) [-1510.346] (-1511.437) (-1511.597) * (-1511.772) [-1507.257] (-1513.073) (-1512.199) -- 0:00:41
Average standard deviation of split frequencies: 0.018362
705500 -- [-1506.672] (-1507.245) (-1512.893) (-1509.949) * (-1508.617) (-1510.062) (-1511.209) [-1507.098] -- 0:00:40
706000 -- [-1512.560] (-1509.059) (-1510.845) (-1513.063) * (-1510.469) (-1505.465) (-1511.832) [-1510.966] -- 0:00:40
706500 -- (-1510.575) (-1516.907) (-1513.174) [-1510.338] * (-1507.368) [-1504.305] (-1516.399) (-1505.341) -- 0:00:40
707000 -- [-1507.537] (-1512.030) (-1508.237) (-1514.331) * [-1510.427] (-1508.594) (-1510.637) (-1509.909) -- 0:00:40
707500 -- (-1511.431) (-1516.335) [-1508.195] (-1508.561) * (-1506.728) (-1510.271) (-1517.000) [-1509.338] -- 0:00:40
708000 -- [-1508.919] (-1513.078) (-1506.764) (-1507.251) * [-1506.178] (-1506.804) (-1510.828) (-1505.941) -- 0:00:40
708500 -- (-1510.773) [-1508.214] (-1506.420) (-1508.231) * (-1507.383) (-1510.757) (-1512.779) [-1505.781] -- 0:00:40
709000 -- (-1507.262) [-1506.138] (-1509.440) (-1513.187) * (-1509.063) (-1516.025) (-1512.731) [-1510.677] -- 0:00:40
709500 -- (-1512.251) (-1505.252) [-1510.268] (-1509.100) * (-1506.163) (-1508.392) (-1510.346) [-1514.650] -- 0:00:40
710000 -- (-1512.293) [-1504.825] (-1518.790) (-1507.676) * (-1506.136) [-1508.185] (-1508.681) (-1519.240) -- 0:00:40
Average standard deviation of split frequencies: 0.019236
710500 -- [-1508.650] (-1504.300) (-1508.958) (-1508.401) * [-1506.704] (-1510.771) (-1509.563) (-1510.081) -- 0:00:40
711000 -- (-1506.651) (-1508.316) [-1510.463] (-1513.464) * (-1509.266) (-1505.474) (-1507.107) [-1512.030] -- 0:00:40
711500 -- (-1514.123) (-1508.329) [-1509.233] (-1510.060) * [-1516.197] (-1508.172) (-1509.965) (-1505.983) -- 0:00:40
712000 -- (-1508.891) (-1511.349) [-1507.710] (-1509.764) * (-1509.480) [-1510.908] (-1508.593) (-1506.533) -- 0:00:40
712500 -- [-1509.509] (-1507.105) (-1510.074) (-1506.971) * (-1513.495) [-1507.742] (-1508.513) (-1507.364) -- 0:00:39
713000 -- (-1518.700) [-1507.336] (-1515.053) (-1510.526) * [-1510.183] (-1509.574) (-1511.472) (-1509.485) -- 0:00:39
713500 -- (-1516.893) (-1511.000) [-1509.259] (-1508.406) * (-1509.720) (-1508.962) (-1512.385) [-1508.166] -- 0:00:39
714000 -- (-1508.860) (-1504.719) (-1512.177) [-1506.799] * (-1508.842) (-1511.559) [-1518.924] (-1508.760) -- 0:00:39
714500 -- (-1512.670) (-1508.860) [-1513.819] (-1509.811) * (-1507.637) (-1508.679) [-1509.735] (-1513.783) -- 0:00:39
715000 -- (-1510.610) [-1506.040] (-1508.026) (-1511.080) * (-1507.563) (-1510.572) [-1504.420] (-1510.707) -- 0:00:39
Average standard deviation of split frequencies: 0.019752
715500 -- (-1514.342) (-1512.958) [-1504.995] (-1510.318) * [-1509.641] (-1508.478) (-1507.360) (-1507.394) -- 0:00:39
716000 -- (-1511.878) (-1507.762) [-1510.574] (-1509.960) * (-1514.293) (-1511.860) [-1507.405] (-1505.644) -- 0:00:39
716500 -- (-1510.907) [-1516.145] (-1513.223) (-1510.085) * (-1510.654) (-1511.504) (-1509.477) [-1506.888] -- 0:00:39
717000 -- [-1510.941] (-1515.684) (-1511.808) (-1511.739) * (-1514.463) [-1505.283] (-1507.628) (-1504.830) -- 0:00:39
717500 -- (-1513.508) (-1511.315) (-1512.679) [-1506.257] * (-1515.045) (-1526.973) (-1513.264) [-1505.320] -- 0:00:39
718000 -- (-1516.364) (-1506.493) [-1506.977] (-1505.299) * (-1509.893) (-1513.752) [-1510.954] (-1510.274) -- 0:00:39
718500 -- [-1513.082] (-1508.261) (-1508.764) (-1505.917) * (-1517.527) [-1507.109] (-1511.902) (-1505.446) -- 0:00:39
719000 -- (-1513.002) [-1507.136] (-1507.740) (-1511.933) * (-1512.037) (-1510.614) [-1511.359] (-1511.120) -- 0:00:39
719500 -- (-1517.000) (-1506.363) (-1506.475) [-1510.332] * [-1506.448] (-1506.852) (-1511.237) (-1508.948) -- 0:00:38
720000 -- (-1512.045) (-1504.875) [-1506.170] (-1512.672) * [-1510.726] (-1511.815) (-1505.287) (-1508.841) -- 0:00:38
Average standard deviation of split frequencies: 0.019297
720500 -- (-1514.701) (-1504.998) (-1517.197) [-1511.301] * (-1506.539) (-1510.640) [-1506.960] (-1507.003) -- 0:00:38
721000 -- (-1515.403) [-1507.291] (-1508.124) (-1507.003) * (-1504.153) (-1509.080) (-1514.457) [-1515.277] -- 0:00:38
721500 -- (-1522.031) (-1509.421) (-1511.167) [-1504.599] * (-1507.409) (-1509.428) [-1506.902] (-1506.157) -- 0:00:38
722000 -- (-1507.247) (-1509.217) [-1506.149] (-1510.355) * (-1506.851) (-1507.816) (-1511.493) [-1510.099] -- 0:00:38
722500 -- (-1507.657) (-1511.143) (-1511.866) [-1506.116] * (-1512.782) (-1508.901) (-1513.467) [-1505.481] -- 0:00:38
723000 -- (-1512.048) (-1510.052) [-1506.587] (-1509.489) * (-1512.921) (-1503.225) (-1506.888) [-1508.315] -- 0:00:38
723500 -- [-1506.218] (-1512.553) (-1508.609) (-1508.308) * (-1507.096) [-1510.374] (-1507.835) (-1509.091) -- 0:00:38
724000 -- [-1512.091] (-1506.362) (-1508.016) (-1508.398) * [-1507.895] (-1507.444) (-1508.384) (-1506.451) -- 0:00:38
724500 -- [-1507.145] (-1510.030) (-1514.950) (-1515.161) * (-1514.064) (-1506.704) (-1509.497) [-1511.857] -- 0:00:38
725000 -- (-1507.617) [-1507.754] (-1511.459) (-1506.641) * (-1507.348) [-1506.087] (-1517.274) (-1513.680) -- 0:00:38
Average standard deviation of split frequencies: 0.022726
725500 -- [-1504.569] (-1507.314) (-1512.461) (-1513.894) * (-1507.171) (-1505.712) [-1508.815] (-1509.414) -- 0:00:38
726000 -- (-1509.623) (-1509.619) [-1507.119] (-1508.437) * (-1511.944) [-1506.341] (-1510.840) (-1508.454) -- 0:00:38
726500 -- (-1506.769) [-1513.733] (-1508.381) (-1509.580) * (-1516.710) (-1510.889) [-1509.820] (-1512.826) -- 0:00:38
727000 -- [-1506.206] (-1507.945) (-1505.385) (-1508.779) * (-1507.780) [-1510.081] (-1513.630) (-1508.206) -- 0:00:37
727500 -- (-1509.620) (-1514.525) (-1511.245) [-1509.426] * [-1508.373] (-1510.080) (-1511.375) (-1507.118) -- 0:00:37
728000 -- (-1509.055) [-1517.892] (-1512.920) (-1508.979) * (-1506.204) (-1510.523) (-1506.053) [-1511.127] -- 0:00:37
728500 -- (-1505.570) (-1512.809) (-1507.828) [-1511.026] * (-1512.525) (-1508.809) (-1509.932) [-1508.969] -- 0:00:37
729000 -- [-1505.499] (-1515.928) (-1505.587) (-1508.988) * [-1508.027] (-1509.018) (-1510.441) (-1508.909) -- 0:00:37
729500 -- (-1508.378) (-1516.746) [-1505.269] (-1506.461) * (-1510.093) (-1510.454) [-1509.929] (-1508.834) -- 0:00:37
730000 -- (-1510.224) [-1509.449] (-1509.516) (-1507.719) * (-1511.154) (-1512.479) (-1507.052) [-1510.050] -- 0:00:37
Average standard deviation of split frequencies: 0.020645
730500 -- (-1511.631) [-1506.979] (-1507.354) (-1514.209) * (-1510.031) (-1506.141) [-1509.436] (-1510.200) -- 0:00:37
731000 -- (-1510.924) (-1508.474) [-1508.580] (-1512.164) * [-1507.323] (-1505.094) (-1505.590) (-1512.904) -- 0:00:37
731500 -- (-1511.196) [-1507.877] (-1509.395) (-1508.113) * (-1514.081) [-1508.544] (-1514.367) (-1511.985) -- 0:00:37
732000 -- (-1510.584) (-1510.602) (-1512.890) [-1506.626] * (-1513.752) (-1512.315) [-1508.026] (-1513.062) -- 0:00:37
732500 -- (-1505.173) (-1512.185) (-1511.749) [-1509.557] * (-1507.941) (-1510.739) (-1504.607) [-1509.011] -- 0:00:37
733000 -- (-1512.124) [-1511.662] (-1506.192) (-1507.855) * (-1507.564) (-1512.301) [-1506.615] (-1509.006) -- 0:00:37
733500 -- (-1507.691) (-1506.787) [-1508.961] (-1512.147) * (-1508.529) (-1513.141) [-1508.975] (-1512.102) -- 0:00:37
734000 -- [-1508.836] (-1517.992) (-1510.601) (-1506.974) * (-1509.198) (-1509.115) [-1506.369] (-1506.482) -- 0:00:36
734500 -- (-1512.333) (-1510.348) (-1507.058) [-1509.674] * [-1504.705] (-1508.358) (-1511.924) (-1507.918) -- 0:00:36
735000 -- (-1512.900) (-1509.288) [-1514.139] (-1507.868) * (-1509.760) [-1507.372] (-1515.601) (-1519.003) -- 0:00:36
Average standard deviation of split frequencies: 0.019215
735500 -- (-1514.482) (-1513.876) (-1513.830) [-1512.883] * (-1509.365) (-1510.805) [-1509.571] (-1515.424) -- 0:00:36
736000 -- (-1507.316) (-1513.755) [-1507.809] (-1513.002) * (-1514.817) [-1511.119] (-1517.371) (-1509.332) -- 0:00:36
736500 -- (-1511.788) (-1516.072) [-1511.457] (-1519.503) * (-1507.907) (-1512.811) (-1514.879) [-1505.505] -- 0:00:36
737000 -- (-1508.822) [-1509.618] (-1509.701) (-1507.287) * (-1506.189) [-1508.516] (-1507.465) (-1510.967) -- 0:00:36
737500 -- (-1505.691) (-1512.772) [-1510.917] (-1508.618) * (-1511.047) (-1507.102) [-1509.393] (-1509.449) -- 0:00:36
738000 -- [-1506.345] (-1508.653) (-1511.886) (-1514.821) * [-1508.579] (-1510.343) (-1511.164) (-1510.908) -- 0:00:36
738500 -- (-1511.397) (-1510.803) (-1505.514) [-1508.113] * (-1507.072) (-1511.571) (-1516.886) [-1515.462] -- 0:00:36
739000 -- (-1507.432) [-1508.550] (-1511.988) (-1511.123) * (-1509.042) [-1507.290] (-1512.307) (-1515.595) -- 0:00:36
739500 -- (-1512.660) (-1518.018) (-1514.037) [-1508.924] * (-1504.953) (-1507.173) (-1510.600) [-1505.417] -- 0:00:36
740000 -- (-1508.660) (-1509.714) [-1511.177] (-1507.093) * [-1508.628] (-1513.556) (-1510.645) (-1511.584) -- 0:00:36
Average standard deviation of split frequencies: 0.019094
740500 -- (-1513.717) [-1507.650] (-1512.851) (-1506.212) * (-1508.004) [-1508.346] (-1507.796) (-1512.380) -- 0:00:36
741000 -- [-1511.626] (-1507.833) (-1514.567) (-1510.887) * (-1513.153) [-1511.371] (-1509.059) (-1508.245) -- 0:00:36
741500 -- (-1507.487) (-1509.427) [-1514.125] (-1507.941) * (-1511.611) [-1511.324] (-1511.133) (-1508.442) -- 0:00:35
742000 -- (-1508.351) (-1511.517) [-1508.354] (-1506.008) * [-1506.929] (-1510.037) (-1510.004) (-1509.356) -- 0:00:35
742500 -- [-1507.675] (-1511.762) (-1513.584) (-1505.374) * (-1513.924) (-1514.606) (-1508.625) [-1511.212] -- 0:00:35
743000 -- (-1509.586) (-1510.375) [-1510.186] (-1514.783) * (-1511.596) (-1506.581) (-1510.622) [-1507.620] -- 0:00:35
743500 -- (-1507.995) (-1509.053) [-1509.325] (-1516.844) * (-1516.208) (-1510.217) (-1508.890) [-1514.199] -- 0:00:35
744000 -- (-1507.738) (-1504.586) [-1513.911] (-1512.420) * [-1512.140] (-1516.282) (-1506.564) (-1509.732) -- 0:00:35
744500 -- (-1512.825) [-1508.055] (-1511.618) (-1515.712) * (-1506.922) [-1507.372] (-1510.561) (-1515.869) -- 0:00:35
745000 -- (-1512.447) (-1505.472) [-1509.107] (-1507.999) * [-1504.040] (-1511.875) (-1510.167) (-1511.752) -- 0:00:35
Average standard deviation of split frequencies: 0.018641
745500 -- (-1512.724) (-1508.808) (-1511.706) [-1503.932] * [-1506.831] (-1516.053) (-1511.714) (-1512.353) -- 0:00:35
746000 -- (-1510.910) (-1512.022) [-1511.017] (-1510.587) * (-1508.438) [-1507.269] (-1511.955) (-1508.902) -- 0:00:35
746500 -- [-1504.774] (-1515.496) (-1513.833) (-1513.836) * (-1524.680) (-1507.626) (-1507.013) [-1512.365] -- 0:00:35
747000 -- (-1509.961) (-1512.466) [-1505.750] (-1509.570) * (-1512.110) (-1510.995) (-1511.887) [-1509.055] -- 0:00:35
747500 -- (-1506.801) [-1508.766] (-1516.776) (-1508.319) * (-1515.346) [-1509.171] (-1509.772) (-1509.037) -- 0:00:35
748000 -- (-1510.702) [-1510.652] (-1512.891) (-1510.843) * (-1515.235) (-1520.149) (-1513.494) [-1509.450] -- 0:00:35
748500 -- (-1514.457) (-1507.158) (-1515.377) [-1513.212] * [-1504.701] (-1525.521) (-1507.345) (-1507.332) -- 0:00:34
749000 -- (-1506.680) (-1505.100) (-1511.421) [-1510.311] * (-1505.349) (-1522.622) [-1508.959] (-1510.931) -- 0:00:34
749500 -- [-1505.358] (-1509.317) (-1510.032) (-1512.288) * (-1506.637) (-1512.577) [-1511.962] (-1510.046) -- 0:00:34
750000 -- (-1506.463) (-1511.654) [-1509.758] (-1510.644) * (-1512.816) (-1515.324) [-1510.316] (-1508.759) -- 0:00:35
Average standard deviation of split frequencies: 0.017897
750500 -- (-1504.923) [-1513.846] (-1504.644) (-1508.586) * (-1511.353) (-1514.888) (-1509.337) [-1506.508] -- 0:00:34
751000 -- (-1508.916) (-1511.684) [-1509.649] (-1509.932) * (-1504.956) [-1511.810] (-1506.796) (-1512.065) -- 0:00:34
751500 -- [-1510.523] (-1512.991) (-1516.127) (-1504.822) * (-1512.961) (-1512.827) [-1510.070] (-1506.213) -- 0:00:34
752000 -- (-1510.621) [-1509.910] (-1508.876) (-1506.717) * [-1509.690] (-1511.589) (-1506.664) (-1511.007) -- 0:00:34
752500 -- (-1510.205) (-1504.216) (-1508.724) [-1511.669] * (-1513.388) (-1512.137) (-1513.261) [-1508.707] -- 0:00:34
753000 -- (-1510.856) [-1507.757] (-1507.005) (-1514.748) * (-1511.798) (-1508.433) (-1510.212) [-1513.204] -- 0:00:34
753500 -- (-1514.540) (-1509.267) (-1509.057) [-1507.629] * (-1514.701) (-1512.565) (-1508.337) [-1506.961] -- 0:00:34
754000 -- (-1514.444) [-1507.823] (-1511.640) (-1507.308) * (-1509.389) [-1509.447] (-1514.556) (-1509.005) -- 0:00:34
754500 -- (-1508.047) [-1509.135] (-1513.562) (-1504.649) * (-1507.228) (-1513.378) (-1509.969) [-1505.948] -- 0:00:34
755000 -- (-1507.897) [-1504.953] (-1511.165) (-1513.999) * [-1505.962] (-1510.278) (-1508.004) (-1513.812) -- 0:00:34
Average standard deviation of split frequencies: 0.015589
755500 -- (-1513.121) (-1510.394) [-1507.536] (-1513.469) * [-1505.366] (-1508.016) (-1511.589) (-1506.559) -- 0:00:33
756000 -- (-1513.414) (-1507.517) (-1505.769) [-1513.452] * [-1507.033] (-1510.895) (-1512.788) (-1513.936) -- 0:00:33
756500 -- (-1514.737) (-1510.328) (-1514.413) [-1508.495] * [-1503.508] (-1511.979) (-1506.319) (-1508.042) -- 0:00:33
757000 -- (-1511.347) (-1511.374) (-1510.621) [-1510.789] * (-1503.649) [-1512.746] (-1516.175) (-1514.738) -- 0:00:34
757500 -- (-1507.594) (-1509.944) (-1509.449) [-1510.332] * (-1506.080) (-1509.342) [-1506.379] (-1507.197) -- 0:00:33
758000 -- (-1505.958) (-1510.300) [-1508.511] (-1511.764) * (-1511.298) (-1512.348) (-1505.494) [-1511.647] -- 0:00:33
758500 -- (-1510.707) [-1512.032] (-1506.790) (-1513.652) * (-1510.674) (-1509.735) (-1517.950) [-1505.154] -- 0:00:33
759000 -- [-1509.657] (-1513.389) (-1513.021) (-1513.089) * (-1508.265) (-1510.643) (-1506.383) [-1505.519] -- 0:00:33
759500 -- (-1518.995) (-1508.484) (-1514.069) [-1515.712] * [-1503.692] (-1509.719) (-1512.846) (-1506.190) -- 0:00:33
760000 -- [-1507.296] (-1507.162) (-1511.860) (-1510.932) * (-1505.953) (-1510.631) [-1507.690] (-1511.754) -- 0:00:33
Average standard deviation of split frequencies: 0.014873
760500 -- (-1509.594) (-1511.028) [-1507.657] (-1514.793) * [-1506.620] (-1508.438) (-1509.716) (-1513.679) -- 0:00:33
761000 -- (-1508.970) [-1510.812] (-1510.120) (-1510.459) * (-1507.688) (-1513.932) (-1508.201) [-1506.451] -- 0:00:33
761500 -- (-1507.303) (-1516.509) (-1510.449) [-1510.589] * [-1506.244] (-1510.053) (-1510.224) (-1513.806) -- 0:00:33
762000 -- (-1508.718) (-1512.226) [-1511.467] (-1509.047) * (-1507.987) [-1511.408] (-1507.060) (-1511.250) -- 0:00:33
762500 -- (-1511.326) (-1506.083) [-1506.256] (-1511.300) * (-1511.450) (-1511.723) [-1513.897] (-1511.221) -- 0:00:33
763000 -- (-1505.785) (-1513.658) [-1507.927] (-1513.870) * [-1510.998] (-1512.480) (-1510.329) (-1510.853) -- 0:00:32
763500 -- (-1511.066) [-1509.781] (-1515.694) (-1518.360) * (-1513.029) (-1511.135) (-1506.673) [-1509.085] -- 0:00:33
764000 -- [-1511.316] (-1506.996) (-1517.676) (-1508.185) * (-1514.784) [-1511.279] (-1509.062) (-1510.649) -- 0:00:33
764500 -- [-1507.123] (-1511.371) (-1509.439) (-1507.961) * (-1511.727) (-1509.985) (-1506.184) [-1504.842] -- 0:00:32
765000 -- (-1507.451) [-1507.532] (-1517.090) (-1510.299) * (-1509.290) [-1505.742] (-1506.926) (-1521.112) -- 0:00:32
Average standard deviation of split frequencies: 0.015385
765500 -- [-1507.757] (-1512.580) (-1507.702) (-1510.404) * (-1513.651) (-1510.781) [-1511.572] (-1510.229) -- 0:00:32
766000 -- [-1507.141] (-1505.723) (-1518.749) (-1516.003) * (-1515.565) (-1506.319) [-1507.330] (-1507.292) -- 0:00:32
766500 -- (-1507.180) (-1511.865) [-1508.147] (-1507.291) * (-1512.742) [-1513.473] (-1508.003) (-1507.251) -- 0:00:32
767000 -- [-1506.081] (-1510.841) (-1508.537) (-1506.150) * (-1518.785) (-1512.531) (-1510.148) [-1508.319] -- 0:00:32
767500 -- (-1510.006) [-1507.208] (-1512.836) (-1506.593) * (-1516.173) (-1509.710) (-1506.572) [-1508.849] -- 0:00:32
768000 -- (-1510.137) [-1508.351] (-1511.462) (-1507.435) * (-1512.054) (-1510.284) (-1507.381) [-1513.562] -- 0:00:32
768500 -- (-1508.361) (-1517.223) (-1512.933) [-1509.769] * [-1515.952] (-1509.543) (-1507.238) (-1508.909) -- 0:00:32
769000 -- (-1512.561) (-1511.731) [-1514.068] (-1507.574) * [-1511.014] (-1509.556) (-1509.894) (-1509.055) -- 0:00:32
769500 -- [-1509.995] (-1514.261) (-1512.405) (-1508.495) * (-1513.791) (-1507.913) (-1507.131) [-1507.841] -- 0:00:32
770000 -- (-1508.860) (-1515.711) [-1510.396] (-1514.653) * (-1515.784) (-1509.199) [-1509.962] (-1509.398) -- 0:00:32
Average standard deviation of split frequencies: 0.013151
770500 -- (-1506.237) (-1509.676) [-1508.867] (-1509.604) * (-1504.794) (-1508.894) (-1509.171) [-1505.619] -- 0:00:32
771000 -- (-1508.526) (-1505.469) (-1508.967) [-1506.896] * (-1510.666) [-1508.926] (-1514.864) (-1508.551) -- 0:00:32
771500 -- [-1511.212] (-1508.917) (-1508.034) (-1510.983) * (-1510.604) [-1512.464] (-1513.355) (-1508.302) -- 0:00:31
772000 -- (-1510.833) (-1508.909) (-1515.705) [-1506.821] * [-1514.887] (-1505.976) (-1514.726) (-1508.237) -- 0:00:31
772500 -- (-1514.665) (-1511.108) (-1511.130) [-1509.825] * (-1510.917) (-1509.045) [-1505.681] (-1513.841) -- 0:00:31
773000 -- (-1511.303) (-1511.857) [-1512.657] (-1508.560) * (-1512.354) (-1509.656) [-1510.020] (-1509.652) -- 0:00:31
773500 -- [-1506.308] (-1511.058) (-1513.864) (-1509.760) * (-1509.876) [-1508.242] (-1516.840) (-1507.475) -- 0:00:31
774000 -- (-1506.096) (-1511.018) (-1518.301) [-1510.180] * (-1507.560) (-1511.576) [-1507.332] (-1519.730) -- 0:00:31
774500 -- [-1507.864] (-1511.750) (-1510.290) (-1514.187) * (-1513.691) [-1507.561] (-1505.586) (-1518.162) -- 0:00:31
775000 -- [-1507.386] (-1504.701) (-1514.748) (-1508.048) * (-1507.549) [-1508.678] (-1510.427) (-1511.668) -- 0:00:31
Average standard deviation of split frequencies: 0.013972
775500 -- (-1512.844) [-1508.455] (-1512.717) (-1506.125) * [-1510.004] (-1514.045) (-1511.687) (-1513.350) -- 0:00:31
776000 -- (-1520.445) (-1511.166) [-1505.998] (-1505.329) * (-1508.663) (-1509.203) (-1510.700) [-1503.911] -- 0:00:31
776500 -- (-1519.192) [-1508.218] (-1505.621) (-1509.009) * (-1509.554) (-1511.037) [-1506.676] (-1505.682) -- 0:00:31
777000 -- (-1513.666) (-1508.497) (-1511.364) [-1505.360] * (-1514.558) [-1511.233] (-1509.946) (-1510.818) -- 0:00:31
777500 -- [-1514.267] (-1503.192) (-1508.256) (-1506.352) * (-1512.048) (-1514.614) [-1508.074] (-1503.772) -- 0:00:31
778000 -- [-1509.798] (-1503.735) (-1509.348) (-1513.808) * (-1511.177) [-1518.467] (-1509.735) (-1509.079) -- 0:00:31
778500 -- (-1507.244) [-1507.375] (-1506.684) (-1507.687) * (-1510.093) [-1515.192] (-1511.774) (-1519.910) -- 0:00:31
779000 -- (-1509.668) (-1507.873) [-1505.262] (-1508.958) * (-1506.678) (-1512.658) [-1512.916] (-1511.412) -- 0:00:30
779500 -- (-1506.654) (-1503.407) (-1511.168) [-1510.412] * (-1506.955) (-1511.017) (-1508.131) [-1513.027] -- 0:00:30
780000 -- [-1506.192] (-1517.368) (-1508.171) (-1515.836) * (-1511.799) [-1509.678] (-1508.576) (-1506.132) -- 0:00:30
Average standard deviation of split frequencies: 0.013889
780500 -- (-1506.068) (-1506.659) [-1510.355] (-1511.945) * (-1511.844) (-1505.468) (-1506.971) [-1508.408] -- 0:00:30
781000 -- [-1507.484] (-1508.084) (-1508.724) (-1507.461) * (-1517.160) [-1510.043] (-1507.841) (-1507.710) -- 0:00:30
781500 -- (-1504.392) (-1505.252) (-1512.280) [-1511.203] * [-1513.253] (-1510.465) (-1504.660) (-1510.538) -- 0:00:30
782000 -- (-1512.649) (-1511.403) (-1518.946) [-1509.910] * [-1509.588] (-1514.782) (-1507.583) (-1520.249) -- 0:00:30
782500 -- (-1511.912) (-1510.958) (-1510.533) [-1508.758] * (-1506.626) [-1511.457] (-1509.511) (-1515.563) -- 0:00:30
783000 -- (-1519.191) [-1507.632] (-1514.046) (-1505.965) * [-1514.946] (-1510.354) (-1518.944) (-1518.694) -- 0:00:30
783500 -- (-1515.699) (-1515.135) [-1504.940] (-1520.774) * [-1507.182] (-1510.886) (-1508.849) (-1518.615) -- 0:00:30
784000 -- (-1508.908) (-1510.171) (-1514.607) [-1507.275] * [-1509.273] (-1507.484) (-1503.848) (-1511.303) -- 0:00:30
784500 -- (-1508.728) [-1503.124] (-1510.131) (-1513.436) * [-1512.480] (-1508.051) (-1509.054) (-1511.666) -- 0:00:30
785000 -- (-1511.585) (-1507.127) [-1508.157] (-1516.005) * (-1511.419) [-1504.620] (-1513.475) (-1507.028) -- 0:00:30
Average standard deviation of split frequencies: 0.014394
785500 -- (-1514.249) [-1511.922] (-1506.975) (-1523.151) * (-1506.023) (-1507.138) (-1510.319) [-1509.764] -- 0:00:30
786000 -- (-1512.414) (-1508.906) [-1506.117] (-1513.238) * (-1507.767) [-1506.583] (-1513.343) (-1510.138) -- 0:00:29
786500 -- (-1510.952) [-1506.583] (-1511.712) (-1510.144) * (-1508.578) [-1504.434] (-1513.380) (-1515.505) -- 0:00:29
787000 -- [-1509.589] (-1510.097) (-1503.458) (-1509.817) * [-1508.919] (-1516.299) (-1511.233) (-1512.400) -- 0:00:29
787500 -- [-1508.939] (-1511.638) (-1508.508) (-1512.567) * (-1508.715) [-1510.055] (-1509.648) (-1507.604) -- 0:00:29
788000 -- (-1513.372) (-1507.439) [-1506.364] (-1510.124) * (-1509.266) (-1512.560) [-1507.553] (-1512.646) -- 0:00:29
788500 -- (-1507.881) (-1513.510) (-1513.937) [-1509.310] * [-1506.020] (-1511.587) (-1505.906) (-1517.374) -- 0:00:29
789000 -- (-1509.363) [-1505.672] (-1507.585) (-1510.565) * [-1506.589] (-1506.405) (-1505.699) (-1508.059) -- 0:00:29
789500 -- (-1507.449) (-1509.415) (-1505.162) [-1505.044] * (-1512.455) [-1509.387] (-1505.245) (-1512.122) -- 0:00:29
790000 -- [-1506.382] (-1513.548) (-1514.143) (-1516.626) * (-1505.691) [-1511.193] (-1507.721) (-1508.184) -- 0:00:29
Average standard deviation of split frequencies: 0.014905
790500 -- [-1505.843] (-1512.011) (-1520.349) (-1512.408) * (-1506.836) (-1516.581) [-1511.421] (-1513.628) -- 0:00:29
791000 -- [-1506.513] (-1511.796) (-1515.585) (-1510.383) * (-1508.389) (-1511.236) [-1511.280] (-1509.691) -- 0:00:29
791500 -- (-1512.178) [-1509.320] (-1510.772) (-1525.238) * (-1508.993) [-1507.867] (-1512.599) (-1512.602) -- 0:00:29
792000 -- [-1506.582] (-1513.851) (-1515.123) (-1511.996) * (-1508.834) (-1512.988) (-1510.051) [-1506.693] -- 0:00:29
792500 -- [-1507.147] (-1506.931) (-1517.552) (-1504.751) * [-1506.749] (-1513.576) (-1510.867) (-1506.374) -- 0:00:29
793000 -- (-1511.767) (-1509.054) [-1504.614] (-1509.269) * (-1509.033) [-1514.339] (-1508.242) (-1506.665) -- 0:00:28
793500 -- (-1509.361) (-1512.560) (-1505.530) [-1505.321] * (-1506.796) [-1510.661] (-1509.444) (-1514.347) -- 0:00:28
794000 -- (-1517.012) (-1505.842) (-1512.485) [-1505.046] * (-1508.402) (-1506.952) (-1507.347) [-1508.024] -- 0:00:28
794500 -- (-1513.706) (-1513.492) (-1512.929) [-1506.482] * (-1505.927) (-1510.205) [-1507.201] (-1510.996) -- 0:00:28
795000 -- (-1511.888) [-1508.416] (-1507.577) (-1514.325) * (-1512.929) [-1508.983] (-1508.046) (-1506.128) -- 0:00:28
Average standard deviation of split frequencies: 0.014509
795500 -- (-1519.641) [-1508.264] (-1507.369) (-1507.311) * (-1506.195) (-1512.769) [-1507.145] (-1507.861) -- 0:00:28
796000 -- (-1511.362) [-1507.767] (-1512.427) (-1511.919) * (-1508.967) (-1504.803) (-1510.271) [-1506.642] -- 0:00:28
796500 -- [-1506.210] (-1506.024) (-1516.373) (-1513.218) * (-1511.039) (-1508.508) (-1513.322) [-1507.828] -- 0:00:28
797000 -- [-1507.151] (-1506.635) (-1508.603) (-1512.047) * [-1510.862] (-1505.716) (-1512.250) (-1511.771) -- 0:00:28
797500 -- (-1508.920) (-1519.011) [-1509.397] (-1505.944) * (-1513.004) [-1512.275] (-1505.000) (-1509.437) -- 0:00:28
798000 -- (-1506.278) (-1507.411) [-1506.800] (-1511.408) * (-1515.464) (-1509.985) [-1507.172] (-1509.074) -- 0:00:28
798500 -- (-1509.395) [-1514.116] (-1507.999) (-1507.761) * (-1515.019) [-1510.043] (-1509.328) (-1509.995) -- 0:00:28
799000 -- (-1508.130) (-1509.734) [-1508.117] (-1504.983) * (-1514.481) (-1511.308) [-1511.493] (-1504.017) -- 0:00:28
799500 -- (-1512.714) (-1511.335) (-1506.711) [-1507.831] * (-1513.425) (-1508.081) (-1510.251) [-1511.131] -- 0:00:28
800000 -- (-1513.904) (-1515.516) (-1507.338) [-1512.647] * [-1516.448] (-1505.614) (-1512.048) (-1509.564) -- 0:00:27
Average standard deviation of split frequencies: 0.015602
800500 -- (-1512.386) (-1510.780) [-1509.800] (-1508.851) * (-1512.256) (-1505.297) [-1511.390] (-1506.427) -- 0:00:27
801000 -- (-1513.539) (-1507.403) (-1509.014) [-1505.316] * [-1503.958] (-1508.433) (-1518.075) (-1504.065) -- 0:00:27
801500 -- (-1512.515) (-1510.078) [-1509.163] (-1506.984) * (-1513.414) [-1512.142] (-1517.683) (-1510.158) -- 0:00:27
802000 -- (-1505.482) (-1516.344) (-1508.383) [-1506.369] * (-1506.999) (-1513.999) [-1510.589] (-1515.118) -- 0:00:27
802500 -- [-1509.658] (-1507.536) (-1508.401) (-1508.863) * [-1509.671] (-1507.202) (-1507.234) (-1507.198) -- 0:00:27
803000 -- (-1509.659) (-1505.565) (-1510.614) [-1510.695] * (-1509.935) [-1506.733] (-1514.778) (-1509.782) -- 0:00:27
803500 -- (-1513.217) [-1505.674] (-1512.324) (-1510.695) * (-1506.522) (-1516.056) [-1513.676] (-1509.009) -- 0:00:27
804000 -- [-1505.330] (-1512.724) (-1511.806) (-1508.744) * [-1506.304] (-1512.047) (-1512.327) (-1508.718) -- 0:00:27
804500 -- (-1510.577) (-1510.880) (-1505.779) [-1506.447] * (-1509.027) (-1512.586) [-1510.259] (-1512.336) -- 0:00:27
805000 -- [-1510.679] (-1514.497) (-1513.556) (-1512.950) * (-1509.548) (-1518.224) (-1506.770) [-1507.903] -- 0:00:27
Average standard deviation of split frequencies: 0.014329
805500 -- (-1509.366) (-1512.222) (-1510.726) [-1504.575] * [-1507.597] (-1510.329) (-1511.271) (-1506.403) -- 0:00:27
806000 -- (-1508.848) [-1508.626] (-1512.834) (-1505.010) * [-1509.099] (-1514.315) (-1506.951) (-1510.983) -- 0:00:27
806500 -- (-1509.209) (-1508.545) (-1516.409) [-1509.385] * (-1505.369) [-1508.221] (-1514.596) (-1511.454) -- 0:00:27
807000 -- (-1505.080) (-1508.521) (-1509.022) [-1508.997] * [-1507.780] (-1507.532) (-1518.670) (-1507.451) -- 0:00:27
807500 -- (-1508.774) (-1506.467) (-1512.132) [-1509.630] * (-1512.243) (-1513.212) [-1508.174] (-1514.444) -- 0:00:26
808000 -- [-1508.122] (-1505.152) (-1512.189) (-1512.336) * (-1506.762) (-1516.774) (-1507.924) [-1507.858] -- 0:00:26
808500 -- (-1511.283) (-1507.647) (-1509.462) [-1510.450] * [-1508.065] (-1514.502) (-1512.743) (-1506.396) -- 0:00:26
809000 -- (-1514.241) (-1506.277) [-1507.645] (-1514.680) * (-1509.563) [-1514.889] (-1508.681) (-1518.400) -- 0:00:26
809500 -- (-1508.304) (-1502.929) (-1512.311) [-1506.961] * (-1509.379) (-1514.664) [-1508.246] (-1517.015) -- 0:00:26
810000 -- (-1514.149) (-1506.931) (-1508.155) [-1511.492] * (-1509.161) (-1513.723) [-1505.139] (-1508.383) -- 0:00:26
Average standard deviation of split frequencies: 0.015119
810500 -- (-1509.547) (-1508.795) (-1506.435) [-1507.824] * (-1506.771) [-1512.819] (-1509.966) (-1508.529) -- 0:00:26
811000 -- (-1517.010) (-1508.535) [-1507.978] (-1513.031) * (-1509.911) [-1511.069] (-1509.621) (-1513.525) -- 0:00:26
811500 -- [-1513.861] (-1510.069) (-1512.346) (-1509.589) * (-1506.573) (-1513.220) [-1507.365] (-1509.805) -- 0:00:26
812000 -- (-1509.806) (-1511.101) (-1517.276) [-1505.775] * (-1506.657) [-1505.686] (-1506.384) (-1510.451) -- 0:00:26
812500 -- (-1513.238) (-1508.256) [-1508.648] (-1515.281) * [-1511.807] (-1506.861) (-1511.997) (-1512.713) -- 0:00:26
813000 -- (-1507.355) (-1510.952) (-1509.892) [-1506.649] * (-1508.920) [-1504.086] (-1509.920) (-1516.952) -- 0:00:26
813500 -- (-1506.788) (-1512.841) [-1504.806] (-1510.218) * (-1506.105) [-1504.400] (-1511.321) (-1520.869) -- 0:00:26
814000 -- (-1512.581) (-1513.503) (-1507.887) [-1511.769] * (-1510.748) (-1507.228) (-1508.555) [-1511.708] -- 0:00:26
814500 -- (-1512.055) (-1505.838) [-1507.199] (-1514.831) * (-1513.303) [-1505.055] (-1516.085) (-1510.127) -- 0:00:25
815000 -- (-1509.842) [-1505.114] (-1513.936) (-1506.305) * (-1517.297) (-1505.071) [-1508.212] (-1509.865) -- 0:00:25
Average standard deviation of split frequencies: 0.012132
815500 -- [-1508.494] (-1517.721) (-1506.859) (-1507.708) * (-1506.797) [-1509.452] (-1514.425) (-1509.615) -- 0:00:25
816000 -- (-1508.230) [-1509.704] (-1516.921) (-1508.123) * [-1509.851] (-1504.596) (-1510.861) (-1513.760) -- 0:00:25
816500 -- [-1506.352] (-1507.374) (-1515.708) (-1508.492) * (-1506.502) (-1504.281) (-1512.923) [-1509.727] -- 0:00:25
817000 -- (-1513.406) [-1506.304] (-1511.813) (-1513.480) * [-1508.845] (-1507.087) (-1515.286) (-1513.510) -- 0:00:25
817500 -- [-1512.714] (-1503.530) (-1508.659) (-1512.398) * (-1507.576) (-1505.478) [-1506.657] (-1511.439) -- 0:00:25
818000 -- (-1507.703) [-1506.212] (-1511.585) (-1509.038) * [-1505.723] (-1504.824) (-1512.098) (-1505.275) -- 0:00:25
818500 -- [-1509.816] (-1507.368) (-1508.295) (-1507.061) * (-1512.754) (-1506.748) (-1513.237) [-1512.306] -- 0:00:25
819000 -- (-1507.635) (-1509.360) [-1510.958] (-1512.229) * (-1512.461) (-1504.703) [-1511.917] (-1511.078) -- 0:00:25
819500 -- (-1508.378) (-1512.833) [-1509.109] (-1512.359) * (-1505.731) [-1507.380] (-1510.555) (-1507.635) -- 0:00:25
820000 -- (-1510.687) (-1514.357) [-1507.309] (-1515.472) * [-1505.525] (-1506.551) (-1510.554) (-1507.905) -- 0:00:25
Average standard deviation of split frequencies: 0.015222
820500 -- (-1513.648) [-1504.456] (-1511.930) (-1517.800) * (-1506.170) (-1511.830) [-1510.320] (-1508.639) -- 0:00:25
821000 -- (-1511.765) (-1510.570) (-1508.785) [-1508.621] * (-1511.215) (-1515.004) [-1507.145] (-1504.835) -- 0:00:25
821500 -- (-1513.692) (-1517.365) (-1514.532) [-1509.816] * (-1510.385) (-1510.461) (-1514.231) [-1505.652] -- 0:00:24
822000 -- (-1509.859) [-1506.669] (-1509.223) (-1513.574) * (-1512.306) (-1514.996) (-1515.354) [-1508.090] -- 0:00:24
822500 -- (-1510.910) [-1510.793] (-1512.087) (-1514.176) * (-1514.289) (-1515.733) (-1512.974) [-1518.725] -- 0:00:24
823000 -- (-1506.588) (-1513.627) [-1515.850] (-1509.792) * [-1510.244] (-1511.081) (-1516.711) (-1515.395) -- 0:00:24
823500 -- (-1508.938) [-1510.467] (-1508.042) (-1515.121) * (-1514.761) [-1507.995] (-1511.448) (-1514.275) -- 0:00:24
824000 -- [-1509.399] (-1510.919) (-1506.622) (-1512.403) * (-1510.992) (-1506.534) (-1517.750) [-1514.137] -- 0:00:24
824500 -- (-1503.676) [-1507.668] (-1511.530) (-1505.411) * [-1509.342] (-1509.273) (-1507.629) (-1510.764) -- 0:00:24
825000 -- (-1507.512) (-1512.025) [-1503.976] (-1509.502) * (-1507.734) [-1506.569] (-1507.974) (-1510.015) -- 0:00:24
Average standard deviation of split frequencies: 0.015409
825500 -- (-1509.687) (-1509.758) (-1510.228) [-1506.990] * (-1509.787) (-1506.896) (-1509.642) [-1512.572] -- 0:00:24
826000 -- (-1509.499) [-1509.614] (-1509.452) (-1512.834) * [-1516.859] (-1518.673) (-1506.343) (-1508.263) -- 0:00:24
826500 -- (-1509.954) [-1509.964] (-1506.578) (-1517.770) * [-1510.213] (-1518.610) (-1507.974) (-1508.120) -- 0:00:24
827000 -- (-1506.103) (-1507.180) (-1511.108) [-1507.925] * (-1513.894) (-1505.741) [-1512.876] (-1512.502) -- 0:00:24
827500 -- [-1511.357] (-1510.075) (-1511.584) (-1508.013) * (-1512.806) (-1506.519) [-1510.410] (-1509.086) -- 0:00:24
828000 -- (-1506.712) (-1509.285) [-1507.938] (-1510.665) * (-1510.227) (-1503.411) (-1510.525) [-1507.010] -- 0:00:24
828500 -- (-1507.616) [-1511.997] (-1509.881) (-1510.049) * (-1513.029) [-1509.462] (-1510.348) (-1512.124) -- 0:00:24
829000 -- (-1510.757) (-1504.915) (-1515.315) [-1510.339] * (-1512.218) (-1507.011) [-1506.615] (-1509.667) -- 0:00:23
829500 -- (-1516.023) (-1512.027) (-1512.922) [-1512.600] * (-1513.800) (-1511.366) (-1512.712) [-1510.656] -- 0:00:23
830000 -- (-1512.847) (-1503.811) (-1511.529) [-1510.467] * (-1511.959) [-1514.167] (-1510.456) (-1512.081) -- 0:00:23
Average standard deviation of split frequencies: 0.015606
830500 -- [-1508.989] (-1509.740) (-1508.129) (-1508.733) * (-1506.072) [-1507.561] (-1511.368) (-1511.653) -- 0:00:23
831000 -- (-1519.340) (-1516.615) (-1514.728) [-1506.549] * (-1509.841) (-1515.914) [-1513.249] (-1514.973) -- 0:00:23
831500 -- (-1506.033) (-1507.661) [-1509.802] (-1508.907) * [-1512.121] (-1511.251) (-1509.614) (-1515.199) -- 0:00:23
832000 -- (-1510.511) [-1504.897] (-1510.016) (-1509.556) * [-1510.419] (-1508.202) (-1510.217) (-1513.435) -- 0:00:23
832500 -- (-1511.205) (-1509.929) [-1507.589] (-1508.535) * (-1511.235) (-1513.364) [-1504.690] (-1508.871) -- 0:00:23
833000 -- [-1509.808] (-1508.456) (-1512.569) (-1515.528) * (-1514.453) (-1512.329) (-1505.582) [-1506.858] -- 0:00:23
833500 -- [-1505.363] (-1506.122) (-1508.707) (-1515.941) * (-1512.537) [-1509.836] (-1509.648) (-1512.411) -- 0:00:23
834000 -- [-1504.611] (-1513.836) (-1506.559) (-1508.184) * (-1504.928) [-1506.371] (-1511.238) (-1506.078) -- 0:00:23
834500 -- (-1504.330) (-1519.385) (-1511.535) [-1505.324] * [-1513.181] (-1509.239) (-1506.916) (-1508.851) -- 0:00:23
835000 -- [-1507.382] (-1514.282) (-1510.038) (-1511.769) * (-1512.836) (-1514.607) [-1510.254] (-1506.620) -- 0:00:23
Average standard deviation of split frequencies: 0.014943
835500 -- (-1505.867) (-1507.764) (-1508.117) [-1509.280] * (-1506.208) [-1509.956] (-1513.271) (-1509.635) -- 0:00:23
836000 -- [-1508.544] (-1510.709) (-1507.518) (-1509.603) * [-1509.033] (-1513.587) (-1513.471) (-1507.617) -- 0:00:22
836500 -- (-1506.599) [-1512.312] (-1509.266) (-1509.599) * [-1505.771] (-1506.140) (-1512.864) (-1514.631) -- 0:00:22
837000 -- (-1506.962) (-1514.502) [-1505.649] (-1509.969) * [-1508.318] (-1506.399) (-1509.495) (-1510.311) -- 0:00:22
837500 -- [-1505.319] (-1512.252) (-1509.275) (-1509.155) * (-1508.591) (-1510.484) (-1512.154) [-1511.149] -- 0:00:22
838000 -- (-1509.932) (-1508.464) (-1514.345) [-1508.523] * [-1508.318] (-1509.895) (-1519.025) (-1517.001) -- 0:00:22
838500 -- [-1509.530] (-1510.499) (-1509.292) (-1511.647) * (-1515.916) (-1508.432) (-1520.579) [-1509.014] -- 0:00:22
839000 -- [-1511.343] (-1512.049) (-1504.325) (-1511.062) * (-1509.594) (-1512.382) (-1518.632) [-1509.107] -- 0:00:22
839500 -- (-1510.128) [-1509.346] (-1509.749) (-1508.075) * [-1509.273] (-1509.358) (-1520.764) (-1510.761) -- 0:00:22
840000 -- (-1513.540) (-1504.598) [-1513.770] (-1509.386) * (-1509.432) (-1511.726) [-1507.292] (-1508.973) -- 0:00:22
Average standard deviation of split frequencies: 0.014019
840500 -- (-1509.257) [-1506.396] (-1511.304) (-1510.275) * [-1506.292] (-1511.124) (-1506.260) (-1506.894) -- 0:00:22
841000 -- [-1504.451] (-1507.316) (-1508.180) (-1509.496) * [-1506.159] (-1516.055) (-1506.414) (-1507.867) -- 0:00:22
841500 -- [-1508.796] (-1509.309) (-1508.992) (-1506.021) * (-1510.111) (-1509.068) [-1506.859] (-1511.265) -- 0:00:22
842000 -- (-1511.839) [-1508.248] (-1507.233) (-1517.410) * [-1507.511] (-1511.261) (-1513.741) (-1509.892) -- 0:00:22
842500 -- [-1506.079] (-1512.466) (-1511.145) (-1508.273) * (-1506.099) (-1515.235) (-1509.213) [-1507.304] -- 0:00:22
843000 -- (-1506.368) [-1506.927] (-1511.206) (-1513.828) * (-1505.316) (-1510.671) (-1508.112) [-1510.148] -- 0:00:21
843500 -- (-1508.560) (-1508.583) [-1506.621] (-1508.711) * (-1509.715) [-1511.596] (-1506.053) (-1512.132) -- 0:00:21
844000 -- (-1510.088) [-1511.897] (-1510.906) (-1508.240) * (-1507.764) (-1518.193) (-1511.916) [-1510.679] -- 0:00:21
844500 -- [-1509.717] (-1509.154) (-1515.586) (-1514.949) * (-1507.550) (-1512.791) [-1508.925] (-1512.078) -- 0:00:21
845000 -- (-1510.631) (-1511.931) (-1508.385) [-1505.604] * (-1508.658) (-1508.232) [-1509.469] (-1509.801) -- 0:00:21
Average standard deviation of split frequencies: 0.014209
845500 -- [-1508.850] (-1506.049) (-1508.510) (-1513.542) * (-1507.038) (-1508.977) (-1506.239) [-1511.395] -- 0:00:21
846000 -- (-1514.056) (-1507.387) [-1506.809] (-1509.462) * (-1509.954) (-1508.040) (-1506.359) [-1503.978] -- 0:00:21
846500 -- (-1511.622) (-1508.349) (-1512.173) [-1507.738] * (-1506.579) (-1504.735) (-1511.567) [-1507.686] -- 0:00:21
847000 -- [-1505.604] (-1518.862) (-1513.614) (-1513.059) * (-1507.179) [-1507.270] (-1512.074) (-1511.005) -- 0:00:21
847500 -- (-1505.237) [-1510.342] (-1513.320) (-1510.803) * [-1505.675] (-1510.464) (-1509.640) (-1507.626) -- 0:00:21
848000 -- (-1507.163) (-1510.131) [-1513.318] (-1506.435) * (-1508.407) [-1505.539] (-1506.679) (-1513.354) -- 0:00:21
848500 -- (-1511.776) (-1508.216) (-1510.231) [-1504.844] * (-1510.972) (-1513.708) (-1514.064) [-1516.663] -- 0:00:21
849000 -- (-1512.671) (-1509.446) (-1506.553) [-1505.596] * (-1504.797) (-1509.202) [-1506.567] (-1506.661) -- 0:00:21
849500 -- (-1509.757) (-1510.049) [-1514.856] (-1516.225) * (-1507.641) (-1508.090) [-1509.941] (-1505.457) -- 0:00:21
850000 -- (-1507.119) [-1507.830] (-1508.117) (-1508.711) * [-1503.919] (-1515.919) (-1515.243) (-1508.360) -- 0:00:20
Average standard deviation of split frequencies: 0.013300
850500 -- (-1508.067) [-1505.994] (-1514.622) (-1509.901) * (-1514.530) [-1510.006] (-1507.905) (-1508.938) -- 0:00:20
851000 -- (-1505.748) (-1508.613) (-1509.238) [-1510.912] * (-1511.484) (-1509.708) (-1512.720) [-1514.149] -- 0:00:20
851500 -- (-1505.830) (-1507.218) (-1512.163) [-1507.626] * [-1509.770] (-1507.624) (-1511.367) (-1513.660) -- 0:00:20
852000 -- (-1508.481) (-1509.541) [-1510.417] (-1509.276) * [-1506.982] (-1504.987) (-1519.158) (-1516.050) -- 0:00:20
852500 -- (-1519.651) [-1506.778] (-1508.378) (-1509.746) * [-1507.506] (-1507.437) (-1523.594) (-1508.434) -- 0:00:20
853000 -- (-1507.188) (-1508.874) [-1509.480] (-1514.254) * [-1512.568] (-1506.530) (-1508.400) (-1511.146) -- 0:00:20
853500 -- (-1515.317) (-1509.464) (-1512.422) [-1510.872] * (-1512.789) (-1507.783) (-1511.352) [-1510.028] -- 0:00:20
854000 -- (-1509.222) (-1506.989) (-1505.801) [-1508.350] * (-1508.936) (-1505.553) (-1511.420) [-1515.692] -- 0:00:20
854500 -- [-1506.914] (-1507.915) (-1507.440) (-1511.141) * (-1512.205) (-1506.573) [-1515.404] (-1508.630) -- 0:00:20
855000 -- (-1512.988) (-1514.418) [-1505.592] (-1507.456) * (-1511.061) (-1509.948) (-1508.431) [-1509.878] -- 0:00:20
Average standard deviation of split frequencies: 0.012666
855500 -- (-1513.436) (-1510.510) [-1503.009] (-1512.546) * (-1512.416) (-1513.519) [-1509.254] (-1513.073) -- 0:00:20
856000 -- (-1510.428) (-1511.676) [-1506.298] (-1515.475) * [-1510.367] (-1513.246) (-1515.150) (-1504.211) -- 0:00:20
856500 -- [-1509.817] (-1511.520) (-1508.582) (-1509.473) * (-1508.312) [-1504.052] (-1507.791) (-1510.335) -- 0:00:20
857000 -- (-1512.165) [-1512.443] (-1510.163) (-1504.184) * (-1506.112) (-1506.066) [-1505.211] (-1507.882) -- 0:00:20
857500 -- (-1509.354) (-1508.771) [-1516.410] (-1515.462) * (-1507.932) [-1508.404] (-1514.259) (-1507.831) -- 0:00:19
858000 -- [-1512.155] (-1511.892) (-1509.315) (-1514.130) * [-1510.723] (-1514.907) (-1511.328) (-1507.418) -- 0:00:19
858500 -- (-1516.942) (-1513.729) (-1509.429) [-1508.082] * (-1511.942) (-1512.467) [-1506.015] (-1518.787) -- 0:00:19
859000 -- (-1505.540) (-1509.835) (-1512.141) [-1514.842] * (-1511.026) (-1509.496) [-1506.655] (-1510.304) -- 0:00:19
859500 -- (-1507.586) [-1512.958] (-1510.892) (-1511.663) * (-1505.854) (-1520.447) (-1509.363) [-1508.825] -- 0:00:19
860000 -- (-1508.809) [-1506.432] (-1509.020) (-1514.525) * (-1507.891) (-1512.120) (-1510.129) [-1508.697] -- 0:00:19
Average standard deviation of split frequencies: 0.013145
860500 -- (-1507.526) [-1511.024] (-1510.492) (-1509.523) * (-1511.994) [-1510.782] (-1515.959) (-1513.639) -- 0:00:19
861000 -- (-1507.956) (-1507.340) [-1510.976] (-1507.013) * (-1510.416) (-1509.727) (-1511.684) [-1507.516] -- 0:00:19
861500 -- (-1511.063) (-1508.767) (-1515.790) [-1509.322] * [-1510.468] (-1509.124) (-1505.874) (-1507.806) -- 0:00:19
862000 -- (-1506.746) [-1506.709] (-1511.132) (-1504.481) * [-1503.855] (-1506.790) (-1507.928) (-1506.323) -- 0:00:19
862500 -- [-1507.064] (-1511.355) (-1508.298) (-1509.993) * (-1506.208) (-1506.989) [-1511.017] (-1505.903) -- 0:00:19
863000 -- (-1508.032) (-1512.778) (-1514.439) [-1509.253] * (-1506.495) (-1508.812) (-1509.846) [-1509.478] -- 0:00:19
863500 -- [-1506.144] (-1512.444) (-1509.344) (-1506.686) * (-1511.127) [-1513.265] (-1509.047) (-1514.241) -- 0:00:19
864000 -- [-1513.561] (-1508.605) (-1510.499) (-1521.188) * (-1518.249) (-1517.481) [-1507.929] (-1508.323) -- 0:00:19
864500 -- (-1507.757) (-1506.693) (-1510.372) [-1510.182] * [-1510.344] (-1511.010) (-1508.624) (-1505.275) -- 0:00:18
865000 -- (-1508.472) (-1513.310) (-1510.065) [-1508.799] * (-1506.954) (-1508.970) (-1508.571) [-1508.668] -- 0:00:18
Average standard deviation of split frequencies: 0.013337
865500 -- (-1515.249) (-1510.196) [-1509.559] (-1510.568) * [-1507.127] (-1513.361) (-1514.112) (-1507.873) -- 0:00:18
866000 -- (-1508.841) (-1512.829) (-1509.535) [-1511.402] * [-1508.113] (-1508.866) (-1516.294) (-1513.109) -- 0:00:18
866500 -- (-1513.309) (-1507.208) (-1512.288) [-1514.194] * (-1508.689) (-1511.487) [-1508.381] (-1512.121) -- 0:00:18
867000 -- [-1508.272] (-1513.608) (-1510.876) (-1505.945) * [-1507.998] (-1513.649) (-1509.984) (-1512.808) -- 0:00:18
867500 -- (-1509.764) [-1509.119] (-1507.709) (-1510.148) * (-1506.468) (-1511.433) (-1506.603) [-1506.001] -- 0:00:18
868000 -- (-1513.709) (-1509.714) [-1511.191] (-1509.533) * (-1508.774) [-1507.644] (-1511.771) (-1511.289) -- 0:00:18
868500 -- (-1507.298) (-1506.862) (-1508.276) [-1505.173] * (-1511.056) (-1509.995) (-1509.853) [-1509.727] -- 0:00:18
869000 -- [-1517.806] (-1512.107) (-1509.997) (-1509.497) * (-1509.265) [-1506.377] (-1509.121) (-1511.204) -- 0:00:18
869500 -- (-1521.784) (-1509.962) [-1507.470] (-1509.570) * [-1506.778] (-1512.395) (-1505.856) (-1516.240) -- 0:00:18
870000 -- (-1508.687) (-1511.720) (-1510.749) [-1507.918] * (-1513.733) (-1512.533) (-1508.690) [-1511.601] -- 0:00:18
Average standard deviation of split frequencies: 0.011099
870500 -- (-1510.560) (-1512.913) [-1508.993] (-1508.473) * (-1512.011) [-1510.378] (-1515.614) (-1506.544) -- 0:00:18
871000 -- (-1507.150) (-1515.577) (-1517.106) [-1513.527] * (-1511.637) (-1511.298) [-1513.157] (-1512.841) -- 0:00:18
871500 -- (-1516.561) [-1511.198] (-1512.027) (-1513.603) * [-1507.465] (-1510.395) (-1508.840) (-1510.831) -- 0:00:17
872000 -- (-1508.007) [-1509.457] (-1509.434) (-1508.327) * (-1508.707) (-1516.312) (-1506.873) [-1512.441] -- 0:00:17
872500 -- (-1507.388) (-1512.538) (-1507.783) [-1517.241] * (-1503.791) (-1505.523) (-1508.452) [-1506.677] -- 0:00:17
873000 -- [-1508.273] (-1504.433) (-1510.667) (-1513.441) * (-1506.539) [-1505.855] (-1513.442) (-1513.086) -- 0:00:17
873500 -- (-1513.953) (-1504.940) [-1507.998] (-1514.320) * (-1507.347) [-1516.065] (-1507.980) (-1506.820) -- 0:00:17
874000 -- (-1508.102) [-1505.942] (-1510.849) (-1512.193) * (-1519.376) (-1506.646) (-1506.090) [-1508.241] -- 0:00:17
874500 -- [-1509.086] (-1507.788) (-1510.392) (-1505.738) * (-1512.732) [-1504.919] (-1509.543) (-1507.541) -- 0:00:17
875000 -- (-1507.615) [-1511.197] (-1508.942) (-1507.877) * (-1507.267) (-1508.229) [-1505.675] (-1511.883) -- 0:00:17
Average standard deviation of split frequencies: 0.010763
875500 -- (-1506.336) [-1509.145] (-1512.848) (-1508.057) * (-1508.341) [-1507.962] (-1510.461) (-1509.802) -- 0:00:17
876000 -- (-1514.288) [-1510.234] (-1507.457) (-1509.976) * (-1508.094) (-1508.281) (-1508.894) [-1505.722] -- 0:00:17
876500 -- (-1513.320) (-1509.963) (-1512.771) [-1508.928] * (-1506.913) (-1508.567) [-1510.033] (-1509.297) -- 0:00:17
877000 -- (-1515.421) (-1508.922) [-1505.356] (-1507.498) * (-1503.814) [-1508.861] (-1507.241) (-1513.058) -- 0:00:17
877500 -- (-1510.899) (-1513.103) [-1507.348] (-1512.368) * (-1504.179) (-1517.200) [-1507.731] (-1507.203) -- 0:00:17
878000 -- (-1509.250) [-1507.625] (-1508.290) (-1504.071) * (-1509.343) (-1509.909) [-1507.522] (-1509.208) -- 0:00:17
878500 -- [-1510.999] (-1511.418) (-1508.707) (-1512.965) * [-1505.344] (-1508.997) (-1519.892) (-1504.659) -- 0:00:17
879000 -- (-1509.239) (-1510.251) [-1507.590] (-1512.546) * [-1507.278] (-1509.650) (-1507.299) (-1507.625) -- 0:00:16
879500 -- (-1506.499) (-1510.573) (-1510.861) [-1513.406] * [-1506.309] (-1512.750) (-1508.822) (-1509.410) -- 0:00:16
880000 -- (-1513.707) [-1506.098] (-1505.049) (-1506.205) * (-1507.799) (-1513.611) [-1505.228] (-1510.627) -- 0:00:16
Average standard deviation of split frequencies: 0.010973
880500 -- (-1512.291) [-1506.995] (-1509.558) (-1509.774) * [-1508.592] (-1511.723) (-1510.518) (-1510.201) -- 0:00:16
881000 -- (-1515.274) (-1503.084) [-1507.069] (-1507.804) * (-1509.551) [-1513.465] (-1508.536) (-1507.994) -- 0:00:16
881500 -- [-1509.676] (-1507.585) (-1507.178) (-1507.450) * (-1516.030) (-1509.853) [-1506.458] (-1514.748) -- 0:00:16
882000 -- (-1508.710) (-1508.911) (-1509.660) [-1509.372] * (-1510.113) [-1508.528] (-1512.399) (-1511.270) -- 0:00:16
882500 -- (-1509.743) (-1509.481) (-1507.815) [-1506.204] * (-1508.525) (-1513.807) [-1506.611] (-1509.110) -- 0:00:16
883000 -- [-1509.740] (-1506.533) (-1507.430) (-1516.183) * (-1519.213) (-1511.760) (-1507.440) [-1506.268] -- 0:00:16
883500 -- (-1515.866) (-1509.976) (-1509.338) [-1514.315] * (-1507.991) (-1513.041) [-1507.861] (-1514.512) -- 0:00:16
884000 -- (-1510.915) (-1513.151) [-1513.472] (-1515.713) * (-1508.523) [-1505.501] (-1513.159) (-1520.295) -- 0:00:16
884500 -- [-1510.148] (-1509.081) (-1511.886) (-1512.757) * [-1505.472] (-1509.143) (-1512.866) (-1516.492) -- 0:00:16
885000 -- (-1512.103) [-1510.390] (-1503.283) (-1508.525) * [-1505.725] (-1506.932) (-1515.353) (-1507.213) -- 0:00:16
Average standard deviation of split frequencies: 0.011439
885500 -- [-1507.931] (-1516.153) (-1510.279) (-1512.320) * (-1508.199) (-1503.602) (-1515.101) [-1506.945] -- 0:00:16
886000 -- (-1509.586) (-1512.409) [-1510.673] (-1515.371) * (-1513.210) (-1508.116) (-1507.587) [-1509.853] -- 0:00:15
886500 -- (-1509.174) (-1509.950) (-1511.861) [-1514.451] * (-1508.039) (-1508.241) [-1507.881] (-1507.049) -- 0:00:15
887000 -- (-1510.950) (-1506.939) (-1507.713) [-1507.151] * (-1507.167) (-1508.536) [-1514.768] (-1511.741) -- 0:00:15
887500 -- (-1514.852) (-1510.721) [-1508.590] (-1507.330) * (-1507.998) (-1506.868) [-1508.824] (-1521.520) -- 0:00:15
888000 -- (-1512.192) (-1510.729) (-1508.198) [-1509.612] * [-1508.728] (-1507.251) (-1512.048) (-1513.485) -- 0:00:15
888500 -- (-1508.945) (-1509.568) [-1516.429] (-1514.840) * (-1509.170) (-1510.550) (-1509.120) [-1516.344] -- 0:00:15
889000 -- (-1518.173) (-1508.779) [-1508.611] (-1513.159) * (-1512.598) (-1508.041) [-1509.328] (-1507.625) -- 0:00:15
889500 -- [-1511.853] (-1507.620) (-1509.147) (-1511.645) * (-1509.841) (-1508.102) [-1504.895] (-1505.722) -- 0:00:15
890000 -- [-1510.783] (-1507.116) (-1511.814) (-1515.283) * (-1508.350) (-1511.404) [-1510.165] (-1507.506) -- 0:00:15
Average standard deviation of split frequencies: 0.009792
890500 -- [-1510.760] (-1514.962) (-1511.935) (-1504.711) * (-1509.724) (-1505.275) (-1513.351) [-1510.652] -- 0:00:15
891000 -- (-1507.210) (-1510.124) (-1507.424) [-1506.082] * (-1512.763) [-1507.389] (-1513.995) (-1510.487) -- 0:00:15
891500 -- [-1505.354] (-1519.075) (-1505.398) (-1509.033) * (-1511.659) (-1507.730) [-1507.681] (-1515.892) -- 0:00:15
892000 -- (-1509.479) (-1515.025) (-1510.988) [-1507.964] * (-1509.936) (-1513.224) [-1509.054] (-1515.629) -- 0:00:15
892500 -- (-1507.706) [-1507.619] (-1510.613) (-1509.563) * (-1510.524) [-1507.380] (-1510.529) (-1509.831) -- 0:00:15
893000 -- [-1506.200] (-1506.509) (-1509.077) (-1511.797) * (-1512.684) [-1508.909] (-1508.835) (-1510.475) -- 0:00:14
893500 -- [-1508.413] (-1508.716) (-1507.735) (-1509.457) * [-1513.625] (-1507.218) (-1510.871) (-1508.697) -- 0:00:14
894000 -- (-1505.353) [-1508.931] (-1508.639) (-1515.848) * (-1509.554) (-1506.377) (-1510.271) [-1505.269] -- 0:00:14
894500 -- [-1510.888] (-1507.025) (-1509.875) (-1509.727) * (-1512.049) [-1514.793] (-1512.452) (-1509.604) -- 0:00:14
895000 -- (-1510.524) (-1511.509) (-1510.063) [-1511.356] * (-1510.960) [-1507.786] (-1509.585) (-1509.120) -- 0:00:14
Average standard deviation of split frequencies: 0.009470
895500 -- (-1518.456) (-1509.063) (-1508.883) [-1510.022] * (-1513.899) [-1504.703] (-1506.561) (-1511.466) -- 0:00:14
896000 -- (-1509.705) [-1505.420] (-1505.569) (-1512.000) * [-1514.741] (-1511.556) (-1509.409) (-1513.621) -- 0:00:14
896500 -- (-1515.356) [-1509.497] (-1504.616) (-1508.019) * (-1507.558) (-1514.755) [-1505.528] (-1511.631) -- 0:00:14
897000 -- (-1511.311) (-1506.482) [-1506.660] (-1510.533) * (-1508.763) [-1506.479] (-1507.503) (-1508.670) -- 0:00:14
897500 -- (-1511.580) [-1511.111] (-1510.244) (-1507.585) * [-1509.042] (-1511.498) (-1506.319) (-1508.997) -- 0:00:14
898000 -- (-1515.608) [-1507.351] (-1507.565) (-1509.816) * (-1511.812) (-1506.228) [-1513.984] (-1508.325) -- 0:00:14
898500 -- (-1506.277) [-1504.231] (-1512.544) (-1505.526) * (-1510.547) [-1509.136] (-1509.629) (-1516.624) -- 0:00:14
899000 -- (-1504.714) (-1508.798) [-1505.238] (-1513.076) * [-1507.473] (-1511.082) (-1511.403) (-1511.568) -- 0:00:14
899500 -- (-1512.276) (-1504.164) [-1507.161] (-1522.208) * (-1511.731) (-1514.943) (-1513.801) [-1510.387] -- 0:00:14
900000 -- (-1511.929) [-1512.690] (-1515.624) (-1519.254) * (-1507.828) [-1508.378] (-1507.288) (-1511.778) -- 0:00:13
Average standard deviation of split frequencies: 0.008374
900500 -- (-1516.449) (-1509.045) (-1508.702) [-1506.861] * (-1507.131) (-1507.966) [-1509.777] (-1514.736) -- 0:00:13
901000 -- [-1513.568] (-1511.848) (-1508.631) (-1512.535) * (-1502.600) (-1511.112) [-1504.696] (-1512.916) -- 0:00:13
901500 -- (-1514.783) (-1511.980) [-1507.842] (-1510.880) * (-1509.006) (-1506.486) (-1504.380) [-1511.519] -- 0:00:13
902000 -- (-1520.566) [-1509.202] (-1507.341) (-1506.187) * (-1515.287) (-1506.097) [-1509.529] (-1506.842) -- 0:00:13
902500 -- (-1511.058) (-1516.874) [-1512.297] (-1509.109) * [-1513.946] (-1512.254) (-1511.883) (-1507.197) -- 0:00:13
903000 -- (-1520.247) [-1506.946] (-1513.350) (-1507.854) * [-1504.609] (-1511.965) (-1512.946) (-1512.819) -- 0:00:13
903500 -- (-1509.531) [-1508.378] (-1508.430) (-1504.766) * (-1504.901) (-1515.922) [-1512.064] (-1506.029) -- 0:00:13
904000 -- [-1510.256] (-1510.384) (-1506.493) (-1507.173) * (-1508.203) (-1512.126) (-1515.222) [-1513.004] -- 0:00:13
904500 -- (-1520.851) (-1512.437) (-1505.971) [-1515.779] * [-1512.024] (-1508.611) (-1513.337) (-1513.712) -- 0:00:13
905000 -- (-1520.815) (-1513.694) [-1505.473] (-1511.901) * (-1510.906) (-1511.078) (-1514.085) [-1511.249] -- 0:00:13
Average standard deviation of split frequencies: 0.006764
905500 -- (-1509.457) (-1506.904) [-1506.994] (-1507.034) * [-1508.459] (-1512.658) (-1509.456) (-1518.733) -- 0:00:13
906000 -- [-1511.039] (-1509.692) (-1508.608) (-1505.845) * (-1507.582) (-1506.422) (-1512.241) [-1508.342] -- 0:00:13
906500 -- [-1506.383] (-1508.558) (-1509.572) (-1508.344) * (-1513.728) [-1503.557] (-1510.613) (-1509.847) -- 0:00:13
907000 -- [-1511.667] (-1508.023) (-1508.489) (-1506.859) * [-1507.887] (-1508.678) (-1518.362) (-1510.440) -- 0:00:13
907500 -- (-1510.699) (-1511.523) (-1507.414) [-1510.711] * [-1505.732] (-1507.671) (-1510.963) (-1508.063) -- 0:00:12
908000 -- [-1506.267] (-1510.011) (-1510.415) (-1507.665) * (-1509.086) (-1506.865) (-1510.119) [-1509.553] -- 0:00:12
908500 -- (-1507.385) (-1510.159) (-1505.123) [-1505.334] * (-1504.754) [-1510.974] (-1511.219) (-1513.302) -- 0:00:12
909000 -- [-1507.305] (-1506.306) (-1513.773) (-1507.696) * [-1507.716] (-1515.512) (-1509.059) (-1507.261) -- 0:00:12
909500 -- [-1505.727] (-1509.081) (-1505.079) (-1508.373) * [-1508.093] (-1511.700) (-1508.867) (-1514.569) -- 0:00:12
910000 -- (-1505.681) (-1510.312) [-1516.046] (-1507.424) * (-1509.698) (-1509.850) (-1508.461) [-1508.470] -- 0:00:12
Average standard deviation of split frequencies: 0.005694
910500 -- [-1511.244] (-1509.483) (-1513.038) (-1506.487) * (-1508.648) (-1511.990) [-1505.339] (-1514.764) -- 0:00:12
911000 -- [-1506.269] (-1509.358) (-1512.210) (-1504.930) * (-1509.027) (-1514.615) [-1506.973] (-1516.762) -- 0:00:12
911500 -- (-1509.522) (-1510.061) (-1513.714) [-1505.588] * (-1509.867) (-1510.535) [-1505.345] (-1509.243) -- 0:00:12
912000 -- (-1513.198) (-1510.106) (-1511.893) [-1505.776] * (-1511.347) [-1515.458] (-1509.410) (-1505.870) -- 0:00:12
912500 -- (-1504.410) (-1508.675) [-1509.513] (-1507.247) * (-1506.811) (-1507.572) (-1507.708) [-1507.449] -- 0:00:12
913000 -- [-1505.809] (-1509.527) (-1512.516) (-1509.321) * (-1511.488) [-1508.611] (-1506.269) (-1507.286) -- 0:00:12
913500 -- [-1513.734] (-1503.937) (-1511.225) (-1513.883) * (-1511.045) [-1515.690] (-1506.705) (-1513.517) -- 0:00:12
914000 -- [-1509.341] (-1509.555) (-1509.140) (-1507.893) * [-1505.781] (-1505.294) (-1511.888) (-1513.758) -- 0:00:12
914500 -- (-1509.906) (-1517.937) [-1506.194] (-1508.454) * (-1503.038) [-1504.196] (-1513.038) (-1511.186) -- 0:00:11
915000 -- (-1509.503) (-1507.679) (-1511.053) [-1509.223] * (-1512.390) [-1507.265] (-1517.115) (-1507.906) -- 0:00:11
Average standard deviation of split frequencies: 0.004374
915500 -- (-1510.408) (-1508.324) [-1506.240] (-1512.142) * (-1506.733) (-1509.009) (-1512.600) [-1511.808] -- 0:00:11
916000 -- (-1512.601) [-1510.655] (-1505.331) (-1508.998) * (-1508.052) (-1509.200) (-1513.205) [-1510.450] -- 0:00:11
916500 -- [-1514.048] (-1509.770) (-1513.479) (-1510.336) * (-1517.592) [-1509.328] (-1503.968) (-1510.125) -- 0:00:11
917000 -- (-1513.451) (-1512.775) [-1510.046] (-1509.414) * (-1512.309) (-1513.510) (-1509.176) [-1507.998] -- 0:00:11
917500 -- (-1506.909) [-1510.889] (-1515.127) (-1517.051) * (-1505.436) [-1514.304] (-1507.289) (-1510.116) -- 0:00:11
918000 -- (-1507.173) (-1513.724) (-1509.707) [-1510.712] * (-1504.289) [-1510.229] (-1511.697) (-1511.410) -- 0:00:11
918500 -- (-1513.450) (-1514.674) [-1507.469] (-1511.747) * [-1504.782] (-1512.893) (-1507.117) (-1514.200) -- 0:00:11
919000 -- (-1507.281) (-1510.371) [-1509.066] (-1508.700) * (-1506.881) [-1507.837] (-1506.220) (-1510.328) -- 0:00:11
919500 -- (-1507.514) [-1510.151] (-1504.600) (-1513.951) * (-1510.214) (-1515.835) (-1506.027) [-1506.133] -- 0:00:11
920000 -- (-1516.356) [-1508.762] (-1507.444) (-1508.790) * (-1513.136) (-1517.149) [-1510.795] (-1507.784) -- 0:00:11
Average standard deviation of split frequencies: 0.003328
920500 -- [-1506.261] (-1505.445) (-1513.276) (-1517.037) * (-1506.152) [-1506.244] (-1510.971) (-1504.666) -- 0:00:11
921000 -- (-1511.977) (-1510.069) (-1516.808) [-1510.304] * (-1511.340) (-1510.763) [-1509.716] (-1508.808) -- 0:00:11
921500 -- (-1506.755) (-1511.110) [-1509.902] (-1510.458) * (-1508.343) [-1517.791] (-1511.770) (-1508.471) -- 0:00:10
922000 -- [-1509.391] (-1508.660) (-1513.557) (-1506.974) * [-1506.150] (-1513.086) (-1507.480) (-1505.246) -- 0:00:10
922500 -- (-1511.328) [-1509.124] (-1508.874) (-1507.316) * (-1513.566) [-1511.395] (-1513.436) (-1509.178) -- 0:00:10
923000 -- (-1513.920) (-1510.088) [-1511.089] (-1511.632) * (-1508.260) (-1516.241) [-1510.110] (-1512.549) -- 0:00:10
923500 -- (-1516.604) [-1504.771] (-1513.132) (-1506.868) * (-1507.688) [-1505.342] (-1509.697) (-1508.650) -- 0:00:10
924000 -- (-1518.731) [-1510.522] (-1512.100) (-1507.993) * (-1509.206) (-1508.941) (-1507.464) [-1509.861] -- 0:00:10
924500 -- (-1511.591) (-1504.460) [-1504.565] (-1508.458) * (-1513.911) [-1507.480] (-1511.377) (-1515.715) -- 0:00:10
925000 -- [-1504.213] (-1515.095) (-1505.376) (-1507.907) * (-1507.517) (-1507.366) [-1504.464] (-1509.162) -- 0:00:10
Average standard deviation of split frequencies: 0.003054
925500 -- [-1504.298] (-1512.290) (-1508.008) (-1512.751) * (-1506.560) (-1508.099) (-1504.830) [-1505.769] -- 0:00:10
926000 -- (-1506.415) (-1511.364) (-1514.560) [-1509.368] * (-1512.630) (-1508.036) [-1514.264] (-1504.652) -- 0:00:10
926500 -- (-1509.100) (-1506.760) [-1506.974] (-1511.943) * (-1511.124) (-1511.964) [-1509.841] (-1512.265) -- 0:00:10
927000 -- (-1508.791) (-1513.087) [-1507.872] (-1505.440) * (-1505.740) (-1508.066) (-1506.827) [-1505.577] -- 0:00:10
927500 -- (-1513.019) [-1511.135] (-1510.311) (-1514.204) * (-1513.878) (-1509.154) [-1508.948] (-1515.039) -- 0:00:10
928000 -- (-1516.754) (-1512.743) (-1510.570) [-1517.004] * (-1509.451) [-1508.240] (-1507.706) (-1513.081) -- 0:00:10
928500 -- (-1511.357) (-1507.500) [-1506.383] (-1519.339) * (-1508.445) (-1504.810) [-1513.339] (-1509.204) -- 0:00:10
929000 -- (-1518.035) (-1509.478) (-1511.626) [-1507.516] * [-1505.793] (-1508.818) (-1512.337) (-1510.686) -- 0:00:09
929500 -- (-1517.802) [-1507.280] (-1513.791) (-1510.720) * (-1505.259) (-1507.917) [-1509.248] (-1510.713) -- 0:00:09
930000 -- (-1509.621) [-1509.194] (-1513.158) (-1512.410) * (-1505.791) (-1507.494) (-1513.132) [-1505.837] -- 0:00:09
Average standard deviation of split frequencies: 0.002533
930500 -- [-1507.858] (-1511.171) (-1508.859) (-1512.858) * (-1505.136) (-1511.635) (-1518.089) [-1511.248] -- 0:00:09
931000 -- (-1507.121) (-1506.077) (-1508.160) [-1514.818] * (-1508.674) (-1509.862) [-1511.426] (-1514.320) -- 0:00:09
931500 -- (-1513.408) [-1510.060] (-1506.966) (-1505.409) * (-1507.392) (-1506.672) (-1506.422) [-1508.610] -- 0:00:09
932000 -- (-1506.300) (-1505.537) (-1506.718) [-1504.999] * (-1509.951) (-1504.105) (-1507.864) [-1509.306] -- 0:00:09
932500 -- (-1513.838) (-1519.708) [-1510.924] (-1505.167) * (-1507.708) (-1509.712) [-1510.344] (-1517.839) -- 0:00:09
933000 -- (-1508.117) (-1510.991) [-1511.403] (-1511.014) * (-1506.589) [-1510.743] (-1513.967) (-1512.548) -- 0:00:09
933500 -- [-1508.778] (-1511.133) (-1513.124) (-1506.819) * (-1516.874) (-1507.450) [-1512.037] (-1512.543) -- 0:00:09
934000 -- (-1510.626) (-1508.742) [-1506.835] (-1516.302) * (-1510.141) [-1506.644] (-1507.855) (-1514.435) -- 0:00:09
934500 -- (-1514.981) (-1506.416) (-1510.514) [-1514.653] * (-1511.996) (-1509.800) (-1508.782) [-1514.074] -- 0:00:09
935000 -- (-1506.103) [-1507.939] (-1507.039) (-1506.641) * [-1508.335] (-1516.779) (-1513.780) (-1511.276) -- 0:00:09
Average standard deviation of split frequencies: 0.001763
935500 -- [-1509.882] (-1509.619) (-1511.875) (-1510.625) * (-1509.418) (-1507.849) (-1514.053) [-1512.342] -- 0:00:09
936000 -- (-1512.134) (-1507.611) [-1510.682] (-1508.965) * [-1507.873] (-1514.902) (-1517.643) (-1505.577) -- 0:00:08
936500 -- (-1509.893) [-1513.516] (-1511.248) (-1508.101) * (-1508.285) (-1511.530) [-1509.055] (-1507.895) -- 0:00:08
937000 -- [-1506.562] (-1507.429) (-1510.730) (-1510.200) * [-1507.997] (-1508.872) (-1509.453) (-1510.459) -- 0:00:08
937500 -- (-1511.646) (-1515.430) (-1516.204) [-1507.977] * [-1511.234] (-1510.294) (-1510.310) (-1512.016) -- 0:00:08
938000 -- [-1513.027] (-1510.886) (-1512.658) (-1509.933) * [-1509.801] (-1506.845) (-1508.187) (-1504.682) -- 0:00:08
938500 -- (-1510.582) [-1510.872] (-1508.835) (-1511.076) * [-1507.868] (-1507.900) (-1509.368) (-1513.639) -- 0:00:08
939000 -- (-1524.449) (-1511.094) (-1508.375) [-1510.390] * [-1512.946] (-1513.657) (-1507.000) (-1509.675) -- 0:00:08
939500 -- [-1511.825] (-1504.989) (-1508.176) (-1514.514) * [-1505.427] (-1507.849) (-1507.268) (-1507.344) -- 0:00:08
940000 -- (-1513.293) [-1506.869] (-1508.603) (-1506.839) * (-1510.245) (-1507.635) (-1507.141) [-1508.113] -- 0:00:08
Average standard deviation of split frequencies: 0.001253
940500 -- (-1507.713) (-1512.220) (-1511.680) [-1509.689] * (-1514.745) [-1509.600] (-1509.673) (-1505.174) -- 0:00:08
941000 -- (-1511.765) (-1512.625) [-1508.150] (-1507.681) * (-1511.127) [-1506.081] (-1511.022) (-1514.896) -- 0:00:08
941500 -- [-1509.452] (-1507.496) (-1509.909) (-1514.240) * (-1508.226) (-1507.294) [-1516.206] (-1518.865) -- 0:00:08
942000 -- (-1505.946) (-1512.641) [-1505.176] (-1513.204) * (-1513.313) (-1513.795) (-1514.433) [-1507.949] -- 0:00:08
942500 -- (-1509.391) (-1509.984) (-1512.894) [-1507.296] * (-1508.124) [-1511.184] (-1511.670) (-1511.651) -- 0:00:08
943000 -- (-1508.084) (-1508.854) [-1508.858] (-1508.800) * (-1506.596) [-1506.842] (-1513.549) (-1510.370) -- 0:00:07
943500 -- (-1510.829) (-1509.571) (-1507.447) [-1513.228] * [-1510.374] (-1509.707) (-1512.479) (-1511.016) -- 0:00:07
944000 -- (-1509.494) [-1508.336] (-1507.083) (-1510.690) * [-1512.895] (-1507.576) (-1504.371) (-1508.903) -- 0:00:07
944500 -- (-1509.120) (-1507.031) [-1508.783] (-1512.253) * (-1510.720) (-1512.254) [-1506.198] (-1510.411) -- 0:00:07
945000 -- [-1511.351] (-1512.842) (-1506.227) (-1513.050) * (-1507.801) (-1508.168) [-1508.283] (-1508.714) -- 0:00:07
Average standard deviation of split frequencies: 0.000498
945500 -- (-1508.647) [-1513.265] (-1516.634) (-1508.522) * (-1518.471) (-1510.807) (-1509.196) [-1507.126] -- 0:00:07
946000 -- [-1511.129] (-1509.033) (-1505.990) (-1514.683) * (-1509.884) (-1520.936) (-1512.312) [-1506.390] -- 0:00:07
946500 -- (-1508.746) [-1513.272] (-1508.029) (-1508.620) * (-1508.974) (-1512.165) (-1506.506) [-1504.918] -- 0:00:07
947000 -- (-1505.568) (-1511.324) (-1519.960) [-1511.026] * [-1511.349] (-1512.515) (-1510.064) (-1508.436) -- 0:00:07
947500 -- (-1512.195) [-1508.693] (-1513.055) (-1514.434) * [-1508.597] (-1511.881) (-1509.992) (-1513.141) -- 0:00:07
948000 -- (-1506.600) (-1510.078) (-1513.141) [-1504.994] * (-1514.047) (-1508.895) (-1508.831) [-1512.393] -- 0:00:07
948500 -- (-1512.746) (-1508.988) (-1513.308) [-1511.823] * (-1506.741) [-1512.377] (-1512.788) (-1506.897) -- 0:00:07
949000 -- (-1509.393) (-1510.297) (-1514.524) [-1515.442] * (-1508.538) [-1511.666] (-1508.330) (-1506.817) -- 0:00:07
949500 -- [-1510.896] (-1511.665) (-1513.646) (-1510.077) * (-1516.063) (-1504.134) (-1510.718) [-1511.812] -- 0:00:07
950000 -- (-1507.822) [-1510.689] (-1509.321) (-1509.655) * (-1514.483) [-1507.715] (-1518.037) (-1520.703) -- 0:00:06
Average standard deviation of split frequencies: 0.002231
950500 -- [-1509.129] (-1506.347) (-1515.743) (-1512.290) * [-1510.350] (-1509.380) (-1511.879) (-1510.301) -- 0:00:06
951000 -- (-1517.556) [-1506.765] (-1510.561) (-1505.293) * (-1514.574) [-1511.002] (-1514.348) (-1511.256) -- 0:00:06
951500 -- (-1519.032) (-1504.693) (-1508.044) [-1508.104] * [-1508.506] (-1512.056) (-1507.643) (-1508.148) -- 0:00:06
952000 -- (-1518.644) [-1507.366] (-1507.342) (-1506.849) * (-1511.808) (-1509.308) (-1513.063) [-1506.361] -- 0:00:06
952500 -- (-1510.252) [-1508.208] (-1507.558) (-1512.355) * (-1510.442) (-1514.125) [-1509.997] (-1508.852) -- 0:00:06
953000 -- [-1513.543] (-1508.960) (-1516.676) (-1516.764) * [-1506.668] (-1509.773) (-1505.827) (-1509.810) -- 0:00:06
953500 -- [-1504.225] (-1510.312) (-1507.544) (-1506.495) * [-1507.373] (-1512.004) (-1509.291) (-1509.921) -- 0:00:06
954000 -- (-1506.898) (-1503.497) [-1506.815] (-1512.721) * [-1504.158] (-1514.745) (-1514.889) (-1510.122) -- 0:00:06
954500 -- (-1511.026) (-1516.804) [-1506.146] (-1514.592) * (-1513.560) (-1512.030) [-1507.913] (-1511.661) -- 0:00:06
955000 -- (-1509.161) (-1514.017) (-1514.824) [-1511.426] * (-1511.703) (-1511.859) (-1508.581) [-1507.039] -- 0:00:06
Average standard deviation of split frequencies: 0.003452
955500 -- [-1509.736] (-1512.816) (-1512.541) (-1508.789) * (-1506.166) [-1512.948] (-1508.766) (-1508.957) -- 0:00:06
956000 -- (-1510.486) [-1509.870] (-1511.782) (-1510.555) * (-1510.598) (-1519.084) [-1508.984] (-1514.317) -- 0:00:06
956500 -- (-1507.711) [-1508.420] (-1508.468) (-1513.212) * (-1511.709) (-1507.737) (-1510.893) [-1507.866] -- 0:00:06
957000 -- (-1514.511) (-1514.206) [-1507.105] (-1506.974) * (-1506.735) (-1511.243) [-1509.203] (-1511.904) -- 0:00:06
957500 -- (-1505.094) [-1507.759] (-1507.173) (-1509.155) * [-1508.615] (-1509.781) (-1512.367) (-1508.493) -- 0:00:05
958000 -- (-1510.750) (-1513.394) [-1506.928] (-1509.258) * [-1506.967] (-1511.666) (-1505.434) (-1512.753) -- 0:00:05
958500 -- (-1511.878) [-1511.172] (-1508.003) (-1510.252) * (-1505.446) (-1506.058) (-1508.777) [-1515.035] -- 0:00:05
959000 -- [-1510.342] (-1511.178) (-1508.890) (-1508.792) * (-1506.422) [-1506.746] (-1513.114) (-1510.283) -- 0:00:05
959500 -- (-1516.682) [-1510.462] (-1513.664) (-1514.405) * (-1506.809) (-1507.404) (-1507.766) [-1514.483] -- 0:00:05
960000 -- (-1513.292) (-1510.178) [-1508.171] (-1512.230) * (-1508.090) [-1508.880] (-1514.809) (-1508.118) -- 0:00:05
Average standard deviation of split frequencies: 0.003926
960500 -- [-1510.818] (-1514.401) (-1508.288) (-1510.138) * (-1508.619) (-1507.433) (-1510.731) [-1504.245] -- 0:00:05
961000 -- (-1510.665) [-1510.992] (-1513.308) (-1515.115) * (-1506.938) [-1504.858] (-1503.788) (-1505.603) -- 0:00:05
961500 -- (-1512.598) (-1509.605) (-1508.184) [-1514.166] * (-1507.449) (-1506.233) [-1509.728] (-1512.604) -- 0:00:05
962000 -- (-1510.916) (-1509.739) [-1509.466] (-1510.480) * (-1509.788) (-1510.867) (-1511.009) [-1520.965] -- 0:00:05
962500 -- (-1509.627) [-1510.355] (-1510.256) (-1510.241) * (-1511.639) (-1510.733) (-1509.274) [-1514.834] -- 0:00:05
963000 -- (-1509.432) (-1512.197) (-1507.704) [-1510.592] * (-1505.710) (-1512.255) (-1505.625) [-1510.696] -- 0:00:05
963500 -- (-1512.188) [-1508.602] (-1512.402) (-1510.997) * (-1512.544) [-1509.207] (-1508.817) (-1509.563) -- 0:00:05
964000 -- (-1511.612) (-1508.589) (-1510.228) [-1504.135] * (-1505.538) (-1509.082) [-1505.640] (-1512.259) -- 0:00:05
964500 -- (-1506.313) [-1509.436] (-1514.536) (-1511.380) * (-1511.680) (-1510.158) [-1507.344] (-1510.375) -- 0:00:04
965000 -- (-1507.621) (-1507.873) (-1515.135) [-1507.375] * (-1507.354) (-1503.677) [-1511.667] (-1512.182) -- 0:00:04
Average standard deviation of split frequencies: 0.003172
965500 -- [-1505.381] (-1508.723) (-1508.632) (-1506.846) * [-1505.204] (-1508.162) (-1506.016) (-1509.030) -- 0:00:04
966000 -- (-1502.858) (-1510.956) [-1510.924] (-1509.141) * (-1512.178) (-1505.584) [-1505.005] (-1506.236) -- 0:00:04
966500 -- [-1510.668] (-1508.010) (-1508.115) (-1517.521) * (-1507.395) [-1508.237] (-1508.779) (-1512.300) -- 0:00:04
967000 -- (-1509.445) (-1515.807) (-1509.347) [-1505.491] * [-1513.896] (-1506.628) (-1508.606) (-1505.355) -- 0:00:04
967500 -- (-1511.894) [-1510.933] (-1514.612) (-1510.210) * (-1513.900) (-1508.128) (-1509.370) [-1505.830] -- 0:00:04
968000 -- (-1508.278) [-1508.375] (-1516.957) (-1505.701) * [-1505.273] (-1508.080) (-1508.618) (-1513.025) -- 0:00:04
968500 -- [-1507.759] (-1508.640) (-1507.887) (-1508.854) * [-1509.411] (-1512.138) (-1505.722) (-1508.971) -- 0:00:04
969000 -- (-1511.106) (-1511.463) [-1512.935] (-1511.929) * (-1506.882) (-1508.184) (-1506.413) [-1507.344] -- 0:00:04
969500 -- (-1513.923) [-1508.105] (-1508.590) (-1514.976) * (-1506.865) (-1503.915) (-1505.990) [-1504.616] -- 0:00:04
970000 -- (-1509.939) [-1514.925] (-1513.125) (-1515.465) * (-1508.078) (-1514.573) [-1509.317] (-1514.396) -- 0:00:04
Average standard deviation of split frequencies: 0.002428
970500 -- (-1509.162) (-1512.348) [-1506.137] (-1508.972) * (-1512.274) [-1511.037] (-1513.943) (-1511.341) -- 0:00:04
971000 -- (-1506.722) (-1506.166) (-1513.161) [-1508.897] * [-1509.526] (-1512.833) (-1512.830) (-1512.622) -- 0:00:04
971500 -- (-1508.696) (-1513.718) (-1512.687) [-1509.007] * (-1515.074) (-1506.932) (-1509.308) [-1507.675] -- 0:00:03
972000 -- (-1514.017) [-1506.063] (-1516.505) (-1505.709) * (-1507.323) (-1511.099) [-1513.935] (-1506.436) -- 0:00:03
972500 -- (-1506.863) (-1509.927) (-1510.744) [-1511.966] * (-1504.886) (-1509.483) [-1515.286] (-1508.051) -- 0:00:03
973000 -- (-1505.000) (-1512.027) [-1509.799] (-1515.371) * (-1508.907) (-1512.034) (-1506.640) [-1506.926] -- 0:00:03
973500 -- (-1507.075) (-1510.541) (-1517.845) [-1506.579] * (-1509.575) (-1512.592) (-1514.586) [-1507.060] -- 0:00:03
974000 -- (-1505.176) (-1508.918) [-1516.108] (-1507.244) * (-1511.768) (-1511.799) (-1511.815) [-1508.561] -- 0:00:03
974500 -- (-1511.203) (-1509.245) [-1521.675] (-1507.253) * [-1510.480] (-1510.268) (-1514.131) (-1510.787) -- 0:00:03
975000 -- (-1508.389) (-1510.117) [-1513.593] (-1508.722) * [-1511.364] (-1514.632) (-1512.888) (-1507.890) -- 0:00:03
Average standard deviation of split frequencies: 0.001690
975500 -- [-1511.086] (-1504.095) (-1513.490) (-1507.059) * (-1513.637) (-1511.123) (-1509.342) [-1507.248] -- 0:00:03
976000 -- (-1507.871) (-1513.053) (-1513.281) [-1509.983] * [-1510.350] (-1513.107) (-1512.644) (-1508.511) -- 0:00:03
976500 -- [-1505.581] (-1513.964) (-1511.628) (-1507.916) * (-1512.855) [-1508.843] (-1514.021) (-1508.085) -- 0:00:03
977000 -- (-1506.829) [-1510.925] (-1508.159) (-1506.231) * (-1514.096) [-1506.934] (-1508.255) (-1512.287) -- 0:00:03
977500 -- (-1509.176) [-1510.417] (-1507.849) (-1506.650) * [-1508.997] (-1511.256) (-1510.429) (-1512.079) -- 0:00:03
978000 -- (-1511.812) (-1515.851) (-1510.135) [-1503.211] * (-1511.642) (-1510.950) [-1509.038] (-1506.487) -- 0:00:03
978500 -- (-1512.523) (-1512.043) (-1509.646) [-1507.060] * (-1510.837) [-1507.210] (-1509.073) (-1510.741) -- 0:00:03
979000 -- [-1513.627] (-1517.202) (-1507.603) (-1508.393) * [-1506.627] (-1508.296) (-1508.919) (-1511.716) -- 0:00:02
979500 -- (-1505.439) [-1504.103] (-1510.262) (-1506.214) * (-1504.567) [-1509.410] (-1516.835) (-1507.977) -- 0:00:02
980000 -- [-1506.322] (-1512.595) (-1508.405) (-1508.170) * (-1506.181) (-1512.278) [-1515.104] (-1514.806) -- 0:00:02
Average standard deviation of split frequencies: 0.001202
980500 -- (-1509.191) (-1509.703) (-1510.097) [-1509.021] * [-1510.508] (-1511.230) (-1507.509) (-1507.889) -- 0:00:02
981000 -- (-1507.541) (-1503.771) (-1509.475) [-1506.541] * (-1507.645) [-1510.807] (-1512.840) (-1512.766) -- 0:00:02
981500 -- (-1507.416) [-1508.804] (-1504.917) (-1506.878) * (-1503.675) [-1510.818] (-1516.166) (-1510.906) -- 0:00:02
982000 -- [-1511.659] (-1510.391) (-1509.946) (-1513.317) * (-1507.910) [-1508.307] (-1509.858) (-1511.518) -- 0:00:02
982500 -- (-1508.342) (-1514.721) [-1509.288] (-1509.358) * (-1505.814) [-1507.343] (-1514.937) (-1509.210) -- 0:00:02
983000 -- (-1513.613) (-1515.205) (-1509.769) [-1509.124] * (-1509.992) [-1512.085] (-1509.054) (-1506.434) -- 0:00:02
983500 -- (-1508.364) [-1509.452] (-1512.563) (-1507.281) * (-1507.744) (-1507.632) (-1506.534) [-1507.151] -- 0:00:02
984000 -- [-1503.593] (-1508.587) (-1505.769) (-1512.969) * (-1507.891) (-1509.529) [-1508.323] (-1511.326) -- 0:00:02
984500 -- (-1506.208) [-1508.946] (-1512.324) (-1516.835) * (-1513.177) (-1506.530) [-1510.015] (-1509.008) -- 0:00:02
985000 -- [-1507.578] (-1508.912) (-1511.444) (-1519.922) * (-1509.478) (-1510.768) (-1511.165) [-1506.631] -- 0:00:02
Average standard deviation of split frequencies: 0.000717
985500 -- (-1511.439) (-1509.282) [-1511.964] (-1510.068) * (-1507.513) [-1508.631] (-1514.377) (-1509.982) -- 0:00:02
986000 -- [-1503.689] (-1510.770) (-1507.356) (-1508.512) * (-1509.321) (-1505.753) (-1514.062) [-1510.622] -- 0:00:01
986500 -- (-1505.435) [-1508.510] (-1506.172) (-1510.507) * (-1504.680) (-1510.007) (-1515.834) [-1510.191] -- 0:00:01
987000 -- [-1506.362] (-1510.322) (-1507.707) (-1511.078) * (-1506.433) (-1508.517) [-1507.959] (-1508.375) -- 0:00:01
987500 -- [-1512.789] (-1509.472) (-1509.245) (-1510.280) * (-1510.916) (-1506.966) [-1507.603] (-1510.867) -- 0:00:01
988000 -- (-1509.461) [-1509.551] (-1512.834) (-1509.428) * (-1508.640) (-1508.030) (-1510.974) [-1508.303] -- 0:00:01
988500 -- [-1507.395] (-1509.640) (-1510.294) (-1512.863) * (-1512.036) (-1509.514) [-1507.689] (-1515.411) -- 0:00:01
989000 -- (-1511.022) (-1507.000) [-1510.107] (-1512.591) * [-1507.982] (-1509.504) (-1509.407) (-1517.544) -- 0:00:01
989500 -- (-1506.916) (-1507.782) (-1507.618) [-1508.162] * [-1505.530] (-1507.401) (-1510.199) (-1510.232) -- 0:00:01
990000 -- [-1510.457] (-1507.842) (-1507.094) (-1512.792) * [-1507.130] (-1506.213) (-1515.920) (-1511.379) -- 0:00:01
Average standard deviation of split frequencies: 0.000476
990500 -- (-1507.031) (-1510.914) (-1507.260) [-1505.900] * [-1505.661] (-1511.995) (-1510.915) (-1508.973) -- 0:00:01
991000 -- (-1511.967) [-1505.870] (-1508.940) (-1508.904) * (-1507.829) (-1510.640) [-1511.993] (-1508.639) -- 0:00:01
991500 -- (-1510.714) (-1506.772) (-1507.302) [-1507.239] * (-1507.729) (-1508.340) [-1508.740] (-1509.173) -- 0:00:01
992000 -- (-1509.564) [-1505.744] (-1512.480) (-1507.607) * (-1505.727) (-1508.712) [-1509.751] (-1517.284) -- 0:00:01
992500 -- (-1515.178) [-1510.139] (-1514.758) (-1518.005) * (-1514.967) (-1510.037) [-1512.055] (-1514.855) -- 0:00:01
993000 -- (-1510.797) [-1508.781] (-1508.979) (-1514.144) * (-1510.322) [-1507.443] (-1506.655) (-1520.732) -- 0:00:00
993500 -- (-1511.752) (-1513.015) [-1507.972] (-1511.572) * (-1513.911) [-1508.332] (-1508.099) (-1509.859) -- 0:00:00
994000 -- (-1507.805) [-1507.828] (-1509.907) (-1508.099) * (-1506.009) (-1508.272) (-1512.595) [-1511.604] -- 0:00:00
994500 -- (-1508.602) (-1507.451) [-1509.514] (-1510.456) * (-1506.865) [-1509.698] (-1505.190) (-1509.455) -- 0:00:00
995000 -- (-1507.585) (-1510.648) [-1508.577] (-1514.281) * (-1511.585) (-1507.145) (-1510.658) [-1507.390] -- 0:00:00
Average standard deviation of split frequencies: 0.002366
995500 -- (-1507.812) [-1512.778] (-1510.825) (-1508.585) * [-1510.387] (-1504.590) (-1513.778) (-1511.561) -- 0:00:00
996000 -- (-1507.052) (-1520.368) [-1510.105] (-1510.642) * [-1506.862] (-1507.056) (-1514.042) (-1511.883) -- 0:00:00
996500 -- (-1504.052) (-1510.473) (-1508.056) [-1510.421] * (-1508.609) (-1507.482) [-1508.561] (-1508.584) -- 0:00:00
997000 -- (-1511.676) [-1511.487] (-1515.962) (-1505.763) * (-1509.687) (-1511.347) [-1512.772] (-1506.339) -- 0:00:00
997500 -- (-1505.607) [-1509.547] (-1517.000) (-1507.322) * (-1510.153) (-1515.947) (-1508.235) [-1505.885] -- 0:00:00
998000 -- (-1508.807) (-1510.339) [-1515.088] (-1517.550) * (-1512.026) (-1513.592) [-1506.508] (-1508.742) -- 0:00:00
998500 -- (-1513.495) [-1510.924] (-1515.384) (-1514.727) * [-1510.464] (-1513.826) (-1505.795) (-1510.600) -- 0:00:00
999000 -- (-1510.036) (-1510.350) (-1511.776) [-1505.323] * (-1511.482) (-1506.778) (-1508.061) [-1516.020] -- 0:00:00
999500 -- [-1513.580] (-1513.790) (-1507.635) (-1507.486) * (-1505.267) (-1514.573) [-1510.380] (-1514.855) -- 0:00:00
1000000 -- (-1509.850) (-1507.189) (-1507.389) [-1507.159] * (-1511.452) (-1515.613) [-1507.986] (-1510.384) -- 0:00:00
Average standard deviation of split frequencies: 0.000942
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1509.850045 -- 15.016630
Chain 1 -- -1509.850046 -- 15.016630
Chain 2 -- -1507.189233 -- 14.562877
Chain 2 -- -1507.189233 -- 14.562877
Chain 3 -- -1507.388573 -- 15.081385
Chain 3 -- -1507.388552 -- 15.081385
Chain 4 -- -1507.158602 -- 13.921540
Chain 4 -- -1507.158602 -- 13.921540
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1511.452287 -- 11.426443
Chain 1 -- -1511.452292 -- 11.426443
Chain 2 -- -1515.612783 -- 13.343449
Chain 2 -- -1515.612777 -- 13.343449
Chain 3 -- -1507.986159 -- 13.295961
Chain 3 -- -1507.986159 -- 13.295961
Chain 4 -- -1510.383975 -- 11.143678
Chain 4 -- -1510.383975 -- 11.143678
Analysis completed in 2 mins 20 seconds
Analysis used 140.23 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1501.44
Likelihood of best state for "cold" chain of run 2 was -1501.44
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
58.5 % ( 42 %) Dirichlet(Revmat{all})
74.1 % ( 60 %) Slider(Revmat{all})
26.5 % ( 26 %) Dirichlet(Pi{all})
28.0 % ( 19 %) Slider(Pi{all})
57.8 % ( 30 %) Multiplier(Alpha{1,2})
49.4 % ( 23 %) Multiplier(Alpha{3})
58.0 % ( 37 %) Slider(Pinvar{all})
25.8 % ( 33 %) NNI(Tau{all},V{all})
24.5 % ( 20 %) ParsSPR(Tau{all},V{all})
26.2 % ( 22 %) Multiplier(V{all})
37.2 % ( 34 %) Nodeslider(V{all})
25.8 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
58.3 % ( 42 %) Dirichlet(Revmat{all})
73.5 % ( 57 %) Slider(Revmat{all})
26.6 % ( 24 %) Dirichlet(Pi{all})
27.7 % ( 33 %) Slider(Pi{all})
57.9 % ( 26 %) Multiplier(Alpha{1,2})
49.1 % ( 23 %) Multiplier(Alpha{3})
58.5 % ( 34 %) Slider(Pinvar{all})
25.9 % ( 32 %) NNI(Tau{all},V{all})
24.4 % ( 30 %) ParsSPR(Tau{all},V{all})
26.2 % ( 19 %) Multiplier(V{all})
37.5 % ( 30 %) Nodeslider(V{all})
25.9 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 166443 0.85 0.72
3 | 166755 165968 0.87
4 | 167127 166395 167312
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 166379 0.85 0.72
3 | 166799 166631 0.86
4 | 165971 167034 167186
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1507.28
| 1 1 |
| 2 1 2 |
| 1 1 2 |
| 1 1 22 1 1 |
| 1 1 2 1 1 2 2 1 2 2 1 |
| 2 11 1 1 11 * 1 |
| 1 1 1 1 2 1 1 1 1 |
|2 2 1 1 2 22 1 2 12 2 2 * 2 2|
|11 1 22 2 12 1 2 2 2 2 * 22 * ** * 2 |
| 2 1 2 1 2 * 2 1 12 1|
| 2 * 22 1 2 1 |
| 2 2 2 1 12 2 |
| 2 2 1 1 |
| 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1510.57
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1506.27 -1514.69
2 -1506.53 -1514.86
--------------------------------------
TOTAL -1506.39 -1514.78
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.252387 0.003678 0.151895 0.373944 0.243768 1021.00 1142.94 1.000
r(A<->C){all} 0.131809 0.002224 0.045839 0.223297 0.127497 790.78 860.67 1.000
r(A<->G){all} 0.168353 0.002592 0.076695 0.266294 0.163026 901.31 960.42 1.000
r(A<->T){all} 0.084589 0.002439 0.003556 0.175050 0.077775 952.94 955.71 1.000
r(C<->G){all} 0.027743 0.000535 0.000001 0.073973 0.021818 849.71 982.55 1.000
r(C<->T){all} 0.420456 0.006083 0.281410 0.581248 0.418123 663.09 828.14 1.000
r(G<->T){all} 0.167050 0.002576 0.069914 0.259796 0.162658 1011.87 1138.42 1.000
pi(A){all} 0.245924 0.000227 0.217041 0.274699 0.245829 1416.84 1433.73 1.000
pi(C){all} 0.264489 0.000217 0.234881 0.291627 0.264310 1283.26 1365.28 1.000
pi(G){all} 0.333021 0.000263 0.304681 0.366913 0.332981 1297.41 1303.89 1.000
pi(T){all} 0.156566 0.000149 0.132433 0.180000 0.156183 1327.24 1377.41 1.000
alpha{1,2} 0.120116 0.013610 0.000119 0.314541 0.092237 1129.48 1304.32 1.000
alpha{3} 0.991351 0.320546 0.202877 2.166851 0.859633 1003.38 1168.65 1.000
pinvar{all} 0.438533 0.018065 0.162445 0.687206 0.453138 1016.73 1099.08 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- .**.
6 -- ..**
----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 1595 0.531312 0.000471 0.530979 0.531646 2
6 1285 0.428048 0.001413 0.427049 0.429047 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.028122 0.000102 0.008638 0.047325 0.027678 1.000 2
length{all}[2] 0.009141 0.000017 0.001853 0.017348 0.008455 1.000 2
length{all}[3] 0.004948 0.000013 0.000021 0.011726 0.004353 1.001 2
length{all}[4] 0.201661 0.003301 0.109043 0.319596 0.191555 1.000 2
length{all}[5] 0.011289 0.000058 0.000042 0.025270 0.009995 0.999 2
length{all}[6] 0.005622 0.000014 0.000027 0.012462 0.004913 0.999 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.000942
Maximum standard deviation of split frequencies = 0.001413
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C4 (4)
+
| /------------------------------------ C2 (2)
\-----------------53----------------+
\------------------------------------ C3 (3)
Phylogram (based on average branch lengths):
/---------- C1 (1)
|
|------------------------------------------------------------------------ C4 (4)
+
| /--- C2 (2)
\---+
\- C3 (3)
|-----------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
90 % credible set contains 2 trees
95 % credible set contains 2 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 4 ls = 777
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Sites with gaps or missing data are removed.
21 ambiguity characters in seq. 1
15 ambiguity characters in seq. 2
15 ambiguity characters in seq. 3
21 ambiguity characters in seq. 4
12 sites are removed. 53 54 71 72 114 157 234 235 236 237 258 259
Sequences read..
Counting site patterns.. 0:00
106 patterns at 247 / 247 sites (100.0%), 0:00
Counting codons..
48 bytes for distance
103456 bytes for conP
14416 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 4, (2, 3)); MP score: 77
0.054613 0.277578 0.020634 0.024963 0.011793 0.300000 1.300000
ntime & nrate & np: 5 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 7
lnL0 = -1425.294355
Iterating by ming2
Initial: fx= 1425.294355
x= 0.05461 0.27758 0.02063 0.02496 0.01179 0.30000 1.30000
1 h-m-p 0.0000 0.0020 120.3861 ++YYCCC 1423.731667 4 0.0003 20 | 0/7
2 h-m-p 0.0002 0.0008 188.8805 +YYCYCC 1418.327701 5 0.0005 38 | 0/7
3 h-m-p 0.0001 0.0005 859.9109 +YCCCC 1409.298088 4 0.0003 56 | 0/7
4 h-m-p 0.0001 0.0005 357.4667 YCYC 1407.101407 3 0.0002 70 | 0/7
5 h-m-p 0.0007 0.0037 59.8833 CYC 1406.148125 2 0.0008 83 | 0/7
6 h-m-p 0.0003 0.0027 143.7990 CCCCC 1404.829849 4 0.0005 101 | 0/7
7 h-m-p 0.0025 0.0415 27.5089 +CYCYCCC 1389.134480 6 0.0301 123 | 0/7
8 h-m-p 0.2529 1.2645 0.0845 YCYCCC 1386.801724 5 0.6554 141 | 0/7
9 h-m-p 0.5304 3.7916 0.1045 CCCC 1385.834256 3 0.8605 164 | 0/7
10 h-m-p 0.2059 1.0911 0.4364 CYCC 1385.412816 3 0.1641 186 | 0/7
11 h-m-p 0.6866 5.0618 0.1043 YCCC 1384.695746 3 1.4058 208 | 0/7
12 h-m-p 1.6000 8.0000 0.0478 CCC 1384.463911 2 1.8585 229 | 0/7
13 h-m-p 1.6000 8.0000 0.0390 CCC 1384.391195 2 1.9734 250 | 0/7
14 h-m-p 1.6000 8.0000 0.0032 YC 1384.388926 1 1.2825 268 | 0/7
15 h-m-p 1.6000 8.0000 0.0012 YC 1384.388708 1 1.2541 286 | 0/7
16 h-m-p 1.6000 8.0000 0.0006 Y 1384.388692 0 1.2104 303 | 0/7
17 h-m-p 1.6000 8.0000 0.0001 C 1384.388692 0 1.3394 320 | 0/7
18 h-m-p 1.6000 8.0000 0.0000 ----Y 1384.388692 0 0.0016 341
Out..
lnL = -1384.388692
342 lfun, 342 eigenQcodon, 1710 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 4, (2, 3)); MP score: 77
0.054613 0.277578 0.020634 0.024963 0.011793 1.247061 0.755520 0.234606
ntime & nrate & np: 5 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.172854
np = 8
lnL0 = -1377.949626
Iterating by ming2
Initial: fx= 1377.949626
x= 0.05461 0.27758 0.02063 0.02496 0.01179 1.24706 0.75552 0.23461
1 h-m-p 0.0000 0.0021 88.4318 ++CYC 1377.453867 2 0.0001 18 | 0/8
2 h-m-p 0.0002 0.0009 67.6370 CYCCC 1376.885095 4 0.0003 36 | 0/8
3 h-m-p 0.0001 0.0010 216.6086 +YCCCCC 1374.229573 5 0.0005 57 | 0/8
4 h-m-p 0.0000 0.0001 820.8759 +YCCC 1370.991578 3 0.0001 74 | 0/8
5 h-m-p 0.0001 0.0007 28.2297 ++ 1370.586396 m 0.0007 85 | 1/8
6 h-m-p 0.0003 0.0014 29.6190 CCC 1370.561935 2 0.0001 100 | 1/8
7 h-m-p 0.0024 0.3561 1.3421 +YC 1370.454995 1 0.0179 113 | 1/8
8 h-m-p 0.0037 0.4229 6.5069 +YCCC 1369.302323 3 0.0296 130 | 1/8
9 h-m-p 0.1040 0.7805 1.8555 CYCCC 1368.471595 4 0.1914 148 | 1/8
10 h-m-p 0.7758 3.8791 0.1506 YYC 1367.818929 2 0.6173 161 | 1/8
11 h-m-p 1.6000 8.0000 0.0187 CYC 1367.631338 2 1.7855 182 | 1/8
12 h-m-p 1.6000 8.0000 0.0071 YC 1367.619568 1 1.2445 201 | 1/8
13 h-m-p 1.6000 8.0000 0.0009 YC 1367.619315 1 1.2616 220 | 1/8
14 h-m-p 1.6000 8.0000 0.0006 Y 1367.619309 0 0.9468 238 | 1/8
15 h-m-p 1.6000 8.0000 0.0001 Y 1367.619309 0 1.0634 256 | 1/8
16 h-m-p 1.6000 8.0000 0.0000 Y 1367.619309 0 0.9971 274 | 1/8
17 h-m-p 1.6000 8.0000 0.0000 -Y 1367.619309 0 0.1769 293 | 1/8
18 h-m-p 0.0455 8.0000 0.0000 -------------Y 1367.619309 0 0.0000 324
Out..
lnL = -1367.619309
325 lfun, 975 eigenQcodon, 3250 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 4, (2, 3)); MP score: 77
initial w for M2:NSpselection reset.
0.054613 0.277578 0.020634 0.024963 0.011793 1.155861 1.079469 0.409056 0.257593 2.430889
ntime & nrate & np: 5 3 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.278899
np = 10
lnL0 = -1381.669375
Iterating by ming2
Initial: fx= 1381.669375
x= 0.05461 0.27758 0.02063 0.02496 0.01179 1.15586 1.07947 0.40906 0.25759 2.43089
1 h-m-p 0.0000 0.0083 95.3332 ++CYC 1381.187031 2 0.0001 20 | 0/10
2 h-m-p 0.0002 0.0011 58.3864 CCCC 1380.699631 3 0.0004 39 | 0/10
3 h-m-p 0.0001 0.0021 146.4206 ++ 1374.197579 m 0.0021 52 | 1/10
4 h-m-p 0.0005 0.0027 154.4550 YCCCC 1373.683901 4 0.0003 72 | 1/10
5 h-m-p 0.0007 0.0035 25.9585 YYC 1373.570574 2 0.0006 87 | 1/10
6 h-m-p 0.0004 0.2184 40.0997 ++YCCC 1369.616438 3 0.0141 107 | 1/10
7 h-m-p 0.2111 3.2820 2.6740 +YYCC 1365.008478 3 0.6404 125 | 1/10
8 h-m-p 0.2187 1.0937 3.4183 CYCCC 1362.754588 4 0.3304 145 | 0/10
9 h-m-p 0.0032 0.0158 165.8488 YCCC 1362.515547 3 0.0017 163 | 0/10
10 h-m-p 0.3801 2.7997 0.7587 CCCC 1362.087938 3 0.5481 182 | 0/10
11 h-m-p 1.6000 8.0000 0.1295 C 1362.010686 0 0.4000 205 | 0/10
12 h-m-p 0.5265 8.0000 0.0984 CC 1362.002248 1 0.6637 230 | 0/10
13 h-m-p 1.6000 8.0000 0.0405 CC 1361.998238 1 1.9490 255 | 0/10
14 h-m-p 1.6000 8.0000 0.0316 +YC 1361.993440 1 4.3812 280 | 0/10
15 h-m-p 1.6000 8.0000 0.0702 CCC 1361.988146 2 2.4082 307 | 0/10
16 h-m-p 1.6000 8.0000 0.0698 YCC 1361.983081 2 2.5350 333 | 0/10
17 h-m-p 0.9969 8.0000 0.1775 CYCC 1361.975176 3 1.8071 361 | 0/10
18 h-m-p 1.6000 8.0000 0.1754 CC 1361.968622 1 1.3386 386 | 0/10
19 h-m-p 1.1944 8.0000 0.1966 CCC 1361.963335 2 1.5234 413 | 0/10
20 h-m-p 1.6000 8.0000 0.0613 CC 1361.961130 1 0.4756 438 | 0/10
21 h-m-p 0.3233 8.0000 0.0902 +CC 1361.959655 1 1.7165 464 | 0/10
22 h-m-p 1.6000 8.0000 0.0439 +YC 1361.956100 1 6.9263 489 | 0/10
23 h-m-p 1.5250 8.0000 0.1996 CC 1361.953772 1 1.4685 514 | 0/10
24 h-m-p 1.6000 8.0000 0.1159 YC 1361.951916 1 1.0681 538 | 0/10
25 h-m-p 0.4453 8.0000 0.2779 +YC 1361.950382 1 1.2032 563 | 0/10
26 h-m-p 1.6000 8.0000 0.1552 YC 1361.948700 1 2.5367 587 | 0/10
27 h-m-p 1.4027 8.0000 0.2807 CY 1361.947711 1 1.3519 612 | 0/10
28 h-m-p 1.6000 8.0000 0.1424 YC 1361.947086 1 0.8167 636 | 0/10
29 h-m-p 0.3939 8.0000 0.2953 +CC 1361.946372 1 2.0910 662 | 0/10
30 h-m-p 1.6000 8.0000 0.2221 YY 1361.945832 1 2.3205 686 | 0/10
31 h-m-p 1.1884 8.0000 0.4337 C 1361.945562 0 1.2465 709 | 0/10
32 h-m-p 1.6000 8.0000 0.2756 C 1361.945411 0 1.6000 732 | 0/10
33 h-m-p 1.2672 8.0000 0.3480 YC 1361.945277 1 2.2804 756 | 0/10
34 h-m-p 1.6000 8.0000 0.2428 C 1361.945218 0 2.0010 779 | 0/10
35 h-m-p 1.0283 8.0000 0.4725 Y 1361.945178 0 1.8525 802 | 0/10
36 h-m-p 1.6000 8.0000 0.3331 Y 1361.945160 0 3.2756 825 | 0/10
37 h-m-p 1.6000 8.0000 0.3847 C 1361.945153 0 1.6000 848 | 0/10
38 h-m-p 1.6000 8.0000 0.3453 Y 1361.945150 0 3.4186 871 | 0/10
39 h-m-p 1.6000 8.0000 0.3616 C 1361.945149 0 1.7150 894 | 0/10
40 h-m-p 1.6000 8.0000 0.3412 Y 1361.945149 0 3.4835 917 | 0/10
41 h-m-p 1.6000 8.0000 0.3684 C 1361.945148 0 1.9160 940 | 0/10
42 h-m-p 1.6000 8.0000 0.3889 Y 1361.945148 0 3.4708 963 | 0/10
43 h-m-p 1.6000 8.0000 0.1426 C 1361.945148 0 1.3369 986 | 0/10
44 h-m-p 0.3475 8.0000 0.5484 +C 1361.945148 0 1.2754 1010 | 0/10
45 h-m-p 1.3937 8.0000 0.5019 Y 1361.945148 0 3.0219 1033 | 0/10
46 h-m-p 0.6429 8.0000 2.3590 Y 1361.945148 0 0.3550 1056 | 0/10
47 h-m-p 1.1312 8.0000 0.7404 Y 1361.945148 0 0.6316 1069 | 0/10
48 h-m-p 1.6000 8.0000 0.0307 C 1361.945148 0 1.4801 1092 | 0/10
49 h-m-p 0.7389 8.0000 0.0615 C 1361.945148 0 0.7389 1115 | 0/10
50 h-m-p 1.6000 8.0000 0.0030 ----C 1361.945148 0 0.0016 1142 | 0/10
51 h-m-p 0.0160 8.0000 0.0190 ------Y 1361.945148 0 0.0000 1171 | 0/10
52 h-m-p 0.0160 8.0000 0.1741 -------------.. | 0/10
53 h-m-p 0.0160 8.0000 0.0004 ------------- | 0/10
54 h-m-p 0.0160 8.0000 0.0004 -------------
Out..
lnL = -1361.945148
1274 lfun, 5096 eigenQcodon, 19110 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1368.761907 S = -1267.155498 -95.087713
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 106 patterns 0:09
did 20 / 106 patterns 0:09
did 30 / 106 patterns 0:09
did 40 / 106 patterns 0:09
did 50 / 106 patterns 0:09
did 60 / 106 patterns 0:09
did 70 / 106 patterns 0:09
did 80 / 106 patterns 0:09
did 90 / 106 patterns 0:09
did 100 / 106 patterns 0:09
did 106 / 106 patterns 0:09
Time used: 0:09
Model 3: discrete
TREE # 1
(1, 4, (2, 3)); MP score: 77
0.054613 0.277578 0.020634 0.024963 0.011793 1.417638 0.408838 0.998206 0.172804 0.375541 0.568141
ntime & nrate & np: 5 4 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 8.421774
np = 11
lnL0 = -1382.871426
Iterating by ming2
Initial: fx= 1382.871426
x= 0.05461 0.27758 0.02063 0.02496 0.01179 1.41764 0.40884 0.99821 0.17280 0.37554 0.56814
1 h-m-p 0.0000 0.0018 85.4001 ++YCCC 1382.499183 3 0.0001 34 | 0/11
2 h-m-p 0.0002 0.0010 35.8825 YYC 1382.408047 2 0.0002 61 | 0/11
3 h-m-p 0.0001 0.0021 42.3337 YCCC 1382.274630 3 0.0003 91 | 0/11
4 h-m-p 0.0002 0.0040 49.8861 +++ 1379.636329 m 0.0040 117 | 1/11
5 h-m-p 0.0005 0.0027 187.4685 CYC 1379.545121 2 0.0001 145 | 1/11
6 h-m-p 0.0008 0.0385 27.0838 +++ 1369.647290 m 0.0385 170 | 2/11
7 h-m-p 0.1271 1.8543 7.7286 CYCCC 1367.287722 4 0.0873 201 | 2/11
8 h-m-p 0.1553 0.8217 4.3440 CCCCC 1363.600625 4 0.1891 232 | 1/11
9 h-m-p 0.0096 0.0480 61.0907 CYC 1363.315998 2 0.0021 258 | 1/11
10 h-m-p 0.0821 3.1260 1.5403 +CCCC 1362.599580 3 0.3861 289 | 1/11
11 h-m-p 0.6318 3.1589 0.4258 CYC 1362.404763 2 0.5162 316 | 1/11
12 h-m-p 0.2797 1.3984 0.3745 CCC 1362.279904 2 0.3056 344 | 0/11
13 h-m-p 0.1004 0.7586 1.1405 YCC 1362.257566 2 0.0415 371 | 0/11
14 h-m-p 0.2157 8.0000 0.2195 +CCC 1362.193974 2 0.7701 401 | 0/11
15 h-m-p 0.3417 8.0000 0.4948 +YYC 1362.090328 2 1.1244 429 | 0/11
16 h-m-p 1.6000 8.0000 0.1545 +YCCC 1361.978361 3 4.5588 460 | 0/11
17 h-m-p 1.6000 8.0000 0.2275 YCC 1361.954170 2 1.1023 488 | 0/11
18 h-m-p 1.6000 8.0000 0.0326 YC 1361.946124 1 0.7905 514 | 0/11
19 h-m-p 0.5761 8.0000 0.0447 YC 1361.945329 1 1.2983 540 | 0/11
20 h-m-p 1.6000 8.0000 0.0041 C 1361.945273 0 1.3045 565 | 0/11
21 h-m-p 1.6000 8.0000 0.0007 C 1361.945265 0 1.9064 590 | 0/11
22 h-m-p 1.1213 8.0000 0.0012 ++ 1361.945254 m 8.0000 615 | 0/11
23 h-m-p 1.6000 8.0000 0.0016 ++ 1361.945207 m 8.0000 640 | 0/11
24 h-m-p 0.8077 7.4233 0.0161 Y 1361.945164 0 1.3386 665 | 0/11
25 h-m-p 1.6000 8.0000 0.0033 C 1361.945150 0 1.9086 690 | 0/11
26 h-m-p 1.6000 8.0000 0.0007 C 1361.945148 0 1.3641 715 | 0/11
27 h-m-p 1.6000 8.0000 0.0004 Y 1361.945148 0 1.0108 740 | 0/11
28 h-m-p 1.6000 8.0000 0.0001 Y 1361.945148 0 0.9824 765 | 0/11
29 h-m-p 1.6000 8.0000 0.0000 C 1361.945148 0 1.6000 790 | 0/11
30 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/11
31 h-m-p 0.0160 8.0000 0.0002 -------C 1361.945148 0 0.0000 861
Out..
lnL = -1361.945148
862 lfun, 3448 eigenQcodon, 12930 P(t)
Time used: 0:13
Model 7: beta
TREE # 1
(1, 4, (2, 3)); MP score: 77
0.054613 0.277578 0.020634 0.024963 0.011793 1.417633 0.996708 1.805788
ntime & nrate & np: 5 1 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 8.419146
np = 8
lnL0 = -1379.215511
Iterating by ming2
Initial: fx= 1379.215511
x= 0.05461 0.27758 0.02063 0.02496 0.01179 1.41763 0.99671 1.80579
1 h-m-p 0.0000 0.0020 82.0117 ++YCCC 1378.883690 3 0.0001 28 | 0/8
2 h-m-p 0.0002 0.0010 31.4646 YCC 1378.823537 2 0.0001 50 | 0/8
3 h-m-p 0.0002 0.0031 25.6276 CCC 1378.766246 2 0.0003 73 | 0/8
4 h-m-p 0.0004 0.0109 18.1367 YC 1378.685239 1 0.0008 93 | 0/8
5 h-m-p 0.0005 0.0041 32.7819 CCC 1378.662897 2 0.0002 116 | 0/8
6 h-m-p 0.0006 0.1302 8.0282 +++YYYYYYCCCC 1377.179476 10 0.0510 151 | 0/8
7 h-m-p 0.0821 0.4105 3.6548 CYCCCC 1376.499861 5 0.1182 179 | 0/8
8 h-m-p 0.0541 0.2705 3.5048 YCCCCC 1376.144298 5 0.0774 207 | 0/8
9 h-m-p 0.0506 0.2531 4.4920 YCYYCCC 1374.698256 6 0.1428 236 | 0/8
10 h-m-p 0.0263 0.1317 4.8756 CYYCCC 1373.907414 5 0.0623 264 | 0/8
11 h-m-p 0.0361 0.1803 2.3375 +YYYCYYYCYC 1368.349063 10 0.1691 297 | 0/8
12 h-m-p 0.8763 8.0000 0.4511 --YCC 1368.322603 2 0.0083 321 | 0/8
13 h-m-p 0.0092 3.1771 0.4087 +++CYCC 1367.770520 3 0.6264 348 | 0/8
14 h-m-p 0.3993 1.9964 0.0180 +CCC 1367.731337 2 1.4871 372 | 0/8
15 h-m-p 1.6000 8.0000 0.0009 C 1367.730931 0 1.4353 391 | 0/8
16 h-m-p 1.6000 8.0000 0.0004 YC 1367.730834 1 3.7757 411 | 0/8
17 h-m-p 0.9370 4.6850 0.0006 +C 1367.730764 0 3.1921 431 | 0/8
18 h-m-p 0.3479 1.7393 0.0005 ++ 1367.730753 m 1.7393 450 | 1/8
19 h-m-p 0.3107 8.0000 0.0027 Y 1367.730751 0 0.0552 469 | 1/8
20 h-m-p 1.6000 8.0000 0.0001 -----------C 1367.730751 0 0.0000 498 | 1/8
21 h-m-p 0.0160 8.0000 0.0005 +Y 1367.730751 0 0.1589 517 | 1/8
22 h-m-p 1.6000 8.0000 0.0000 C 1367.730751 0 1.2831 535 | 1/8
23 h-m-p 1.6000 8.0000 0.0000 Y 1367.730751 0 0.6810 553 | 1/8
24 h-m-p 1.1272 8.0000 0.0000 ----------------.. | 1/8
25 h-m-p 0.0160 8.0000 0.0054 Y 1367.730751 0 0.0022 603 | 1/8
26 h-m-p 0.0068 3.4129 0.1410 -C 1367.730750 0 0.0005 622 | 1/8
27 h-m-p 0.0160 8.0000 0.0709 --C 1367.730750 0 0.0003 642 | 1/8
28 h-m-p 0.0144 7.1791 0.0169 --C 1367.730750 0 0.0002 662 | 1/8
29 h-m-p 0.0160 8.0000 0.0052 --C 1367.730750 0 0.0002 682 | 1/8
30 h-m-p 0.0160 8.0000 0.0030 Y 1367.730750 0 0.0073 700 | 1/8
31 h-m-p 0.0160 8.0000 0.0072 C 1367.730750 0 0.0148 718 | 1/8
32 h-m-p 1.6000 8.0000 0.0000 Y 1367.730750 0 0.9530 736 | 1/8
33 h-m-p 1.6000 8.0000 0.0000 -C 1367.730750 0 0.1022 755
Out..
lnL = -1367.730750
756 lfun, 8316 eigenQcodon, 37800 P(t)
Time used: 0:25
Model 8: beta&w>1
TREE # 1
(1, 4, (2, 3)); MP score: 77
initial w for M8:NSbetaw>1 reset.
0.054613 0.277578 0.020634 0.024963 0.011793 1.176567 0.900000 0.709770 1.329016 2.821721
ntime & nrate & np: 5 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.794460
np = 10
lnL0 = -1372.707747
Iterating by ming2
Initial: fx= 1372.707747
x= 0.05461 0.27758 0.02063 0.02496 0.01179 1.17657 0.90000 0.70977 1.32902 2.82172
1 h-m-p 0.0000 0.0035 86.4096 ++CYC 1372.298926 2 0.0001 30 | 0/10
2 h-m-p 0.0002 0.0010 51.8199 CCCC 1372.015972 3 0.0003 59 | 0/10
3 h-m-p 0.0002 0.0024 82.2175 +YCC 1371.387163 2 0.0005 86 | 0/10
4 h-m-p 0.0003 0.0013 54.8322 YYCC 1371.221475 3 0.0002 113 | 0/10
5 h-m-p 0.0003 0.0127 43.2474 +CCCC 1370.765677 3 0.0013 143 | 0/10
6 h-m-p 0.0004 0.0058 128.0367 ++ 1365.218135 m 0.0058 166 | 1/10
7 h-m-p 0.0383 0.2199 10.1706
QuantileBeta(0.15, 0.00500, 2.98494) = 8.230949e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.47853) = 1.029752e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.24234) = 1.165861e-160 2000 rounds
CCC 1363.756048 4 0.0436 197 | 1/10
8 h-m-p 0.2597 1.2987 0.2855 CYCCC 1362.893559 4 0.3685 226 | 1/10
9 h-m-p 0.4919 7.6977 0.2139
QuantileBeta(0.15, 0.00500, 2.25946) = 1.154811e-160 2000 rounds
YC
QuantileBeta(0.15, 0.00500, 2.17689) = 1.210111e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.13669) = 1.238974e-160 2000 rounds
C 1362.619584 3 0.8667 253 | 1/10
10 h-m-p 0.2877 5.5071 0.6444
QuantileBeta(0.15, 0.00500, 2.16746) = 1.216758e-160 2000 rounds
YCC 1362.564020 2 0.1637 278 | 1/10
11 h-m-p 0.5008 8.0000 0.2107
QuantileBeta(0.15, 0.00500, 2.19988) = 1.194193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14880) = 1.230136e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.14959) = 1.229565e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.17474) = 1.211624e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15021) = 1.229116e-160 2000 rounds
C 1362.538503 2 0.9355 303
QuantileBeta(0.15, 0.00500, 2.15021) = 1.229116e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15021) = 1.229116e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15021) = 1.229116e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15021) = 1.229116e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15021) = 1.229116e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15021) = 1.229116e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15021) = 1.229116e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15021) = 1.229116e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15021) = 1.229116e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15021) = 1.229116e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15021) = 1.229116e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15021) = 1.229116e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15021) = 1.229116e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15021) = 1.229116e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15033) = 1.229029e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15009) = 1.229203e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15021) = 1.229116e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15021) = 1.229116e-160 2000 rounds
| 1/10
12 h-m-p 1.6000 8.0000 0.0033
QuantileBeta(0.15, 0.00500, 2.14906) = 1.229950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14560) = 1.232457e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14957) = 1.229579e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.14957) = 1.229577e-160 2000 rounds
C 1362.538236 1 0.8858 326
QuantileBeta(0.15, 0.00500, 2.14957) = 1.229577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14957) = 1.229577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14957) = 1.229577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14957) = 1.229577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14957) = 1.229577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14957) = 1.229577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14957) = 1.229577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14957) = 1.229577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14957) = 1.229577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14957) = 1.229577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14957) = 1.229577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14957) = 1.229577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14957) = 1.229577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14957) = 1.229577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14969) = 1.229490e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14945) = 1.229665e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14957) = 1.229577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14957) = 1.229577e-160 2000 rounds
| 0/10
13 h-m-p 0.1264 8.0000 0.0229
QuantileBeta(0.05, 0.00788, 2.14970) = 3.438070e-161 2000 rounds
++YCY 1362.499361 2 1.3104 353 | 0/10
14 h-m-p 0.0160 8.0000 2.7113 ---C 1362.499360 0 0.0001 379 | 0/10
15 h-m-p 0.0752 8.0000 0.0019 ++++ 1362.494995 m 8.0000 404 | 0/10
16 h-m-p 0.8908 8.0000 0.0175 ++ 1362.441472 m 8.0000 427 | 0/10
17 h-m-p 0.9239 8.0000 0.1512 +YCCCC 1362.132034 4 5.4521 458 | 0/10
18 h-m-p 1.6000 8.0000 0.3784 YYC 1362.015989 2 1.4113 483 | 0/10
19 h-m-p 1.6000 8.0000 0.1723 CYC 1361.970728 2 1.9835 509 | 0/10
20 h-m-p 1.0198 8.0000 0.3350 CCC 1361.966902 2 0.3175 536 | 0/10
21 h-m-p 0.9798 8.0000 0.1086 CC 1361.963071 1 1.1563 561 | 0/10
22 h-m-p 1.6000 8.0000 0.0281 C 1361.962199 0 1.5686 584 | 0/10
23 h-m-p 1.6000 8.0000 0.0079 C 1361.962127 0 1.5176 607 | 0/10
24 h-m-p 1.6000 8.0000 0.0028 +Y 1361.962095 0 4.6562 631 | 0/10
25 h-m-p 1.6000 8.0000 0.0073 ++ 1361.961736 m 8.0000 654 | 0/10
26 h-m-p 0.1596 8.0000 0.3645 ++CC 1361.958564 1 3.0890 681 | 0/10
27 h-m-p 1.6000 8.0000 0.3732 YC 1361.954034 1 3.4576 705 | 0/10
28 h-m-p 1.6000 8.0000 0.6908 YC 1361.953288 1 0.8643 729 | 0/10
29 h-m-p 1.2170 8.0000 0.4906 +C 1361.951685 0 4.6166 753 | 0/10
30 h-m-p 1.6000 8.0000 0.8718 CC 1361.950869 1 1.8610 778 | 0/10
31 h-m-p 1.6000 8.0000 0.7508 +YC 1361.950228 1 4.9455 803 | 0/10
32 h-m-p 1.6000 8.0000 1.6597 C 1361.949881 0 1.3860 826 | 0/10
33 h-m-p 1.6000 8.0000 1.3083 YC 1361.949620 1 3.2951 850 | 0/10
34 h-m-p 1.6000 8.0000 1.8302 YC 1361.949290 1 3.0412 874 | 0/10
35 h-m-p 1.6000 8.0000 2.8075 YC 1361.949022 1 3.3328 898 | 0/10
36 h-m-p 1.6000 8.0000 3.4003 +YC 1361.948751 1 4.1976 923 | 0/10
37 h-m-p 1.5749 7.8745 6.4836 YC 1361.948558 1 2.7460 947 | 0/10
38 h-m-p 0.8973 4.4867 7.4108 ++ 1361.948356 m 4.4867 970 | 1/10
39 h-m-p 0.5010 8.0000 6.9948 --------------C 1361.948356 0 0.0000 1007 | 1/10
40 h-m-p 0.0160 8.0000 0.0200 +++C 1361.948253 0 1.1379 1032 | 1/10
41 h-m-p 1.6000 8.0000 0.0087 Y 1361.948247 0 0.7945 1054 | 1/10
42 h-m-p 1.6000 8.0000 0.0010 Y 1361.948241 0 3.1467 1076 | 1/10
43 h-m-p 1.6000 8.0000 0.0011 ++ 1361.948157 m 8.0000 1098 | 1/10
44 h-m-p 0.0216 8.0000 0.4187 +++YC 1361.945894 1 1.1678 1124 | 1/10
45 h-m-p 1.6000 8.0000 0.0370 C 1361.945576 0 1.8229 1146 | 1/10
46 h-m-p 1.6000 8.0000 0.0045 Y 1361.945575 0 0.9707 1168 | 1/10
47 h-m-p 1.6000 8.0000 0.0003 Y 1361.945575 0 1.0723 1190 | 1/10
48 h-m-p 1.6000 8.0000 0.0000 -Y 1361.945575 0 0.1000 1213
Out..
lnL = -1361.945575
1214 lfun, 14568 eigenQcodon, 66770 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1368.093587 S = -1267.155301 -95.384038
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 106 patterns 0:47
did 20 / 106 patterns 0:48
did 30 / 106 patterns 0:48
did 40 / 106 patterns 0:48
did 50 / 106 patterns 0:48
did 60 / 106 patterns 0:48
did 70 / 106 patterns 0:48
did 80 / 106 patterns 0:49
did 90 / 106 patterns 0:49
did 100 / 106 patterns 0:49
did 106 / 106 patterns 0:49
Time used: 0:49
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=259
D_melanogaster_Acp32CD-PA MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
D_sechellia_Acp32CD-PA MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
D_simulans_Acp32CD-PA MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV
D_yakuba_Acp32CD-PA MWRMRMRLLTGYLVLLALGHLPEHGALGQKYYMNFAFNNNNPDGEGGTGA
*******************:*****************************.
D_melanogaster_Acp32CD-PA DGGGGGAGGGAAGPGGGTGDSPHSQEGDGSAATDNPNDDHATSADNSLAT
D_sechellia_Acp32CD-PA DGGGGGAGGGAAGPGGGPGD--HSQDGDGSAATDSPNDDHATSADNSLAT
D_simulans_Acp32CD-PA DGGGGGAGGGAAGPGGGPGD--RSQDGDGSAATDSPNDDHATSADNSLAT
D_yakuba_Acp32CD-PA DG--GAAGGGPAGAGGATSD--RSQEGDGSAATDRPNDDHATSADNSLAT
** *.****.**.**...* :**:******** ***************
D_melanogaster_Acp32CD-PA DGDAIGKKESGGG-SDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD
D_sechellia_Acp32CD-PA DGDAIGKKESGNG-SDGKSDAKDSSGGNDATPANGHDDDNDDSDSKDAKD
D_simulans_Acp32CD-PA DGDAIGKKESGNG-SDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD
D_yakuba_Acp32CD-PA DGDAGDKKSSGDGKSDSDSDSKDSSGGNAATPANGHDDDNDDSDSKDVKD
**** .**.**.* **..**:******* ******************.**
D_melanogaster_Acp32CD-PA RQDKEEEAGQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
D_sechellia_Acp32CD-PA RKSKEEEAGQEGKRNDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
D_simulans_Acp32CD-PA RKSKEEEAVQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
D_yakuba_Acp32CD-PA RHSKED-AAAEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG
*:.**: * ****.***********************************
D_melanogaster_Acp32CD-PA SNAGSNQRDNGARESSQENQDAKEVASEAPAQR----AGNVPDGPETGAK
D_sechellia_Acp32CD-PA SNAGSNQRDNGARESSQENQEAKEVVSEAPAQRAALAAGNVPDGPETGAK
D_simulans_Acp32CD-PA SNAGSNQRDNGARESSQENQDAKEVASEAPAQRAALAAGNVPDGPETGAK
D_yakuba_Acp32CD-PA SNAGSNQRDSGARDSSQETQTAKEMASEAPAARAPRVAGNVPDGPETGAK
*********.***:****.* ***:.***** * *************
D_melanogaster_Acp32CD-PA EDDYEEMoo
D_sechellia_Acp32CD-PA DDDYEEM--
D_simulans_Acp32CD-PA DDDYEEM--
D_yakuba_Acp32CD-PA EDDYEEMoo
:******
>D_melanogaster_Acp32CD-PA ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC CCTCGGCCAACTGCCGGAGCATGGCGCTCTGGGCCAGAAGTACTACATGA ACTTTGCCTTCAACAACAATAATCCGGATGGCGAAGGAGGCACCGGCGTC GATGGTGGCGGTGGTGGTGCTGGTGGTGGTGCCGCTGGTCCCGGCGGTGG AACCGGGGATTCGCCTCATTCACAAGAAGGTGACGGTAGTGCTGCGACGG ATAACCCCAATGACGACCACGCTACATCTGCTGATAATAGTTTGGCTACC GATGGCGATGCCATTGGTAAGAAGGAAAGCGGCGGTGGT---AGCGATGG CAAGAGCGACTCCAAAGACTCGAGCGGAGGCAATGATGCCACGCCAGCGA ATGGTCATGACGATGACAACGATGACAGCGACAGCAAGGATGCCAAGGAT CGACAAGATAAGGAAGAGGAGGCCGGACAGGAGGGGAAGCGCACCGATCA CAGCCATCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC GGTACGTGCGGTCCATTTACGAGAGCAGCGAGAGCCACGGACATTCCGGC AGCAATGCCGGCTCCAATCAGCGGGACAATGGAGCCCGTGAGAGCAGTCA GGAGAACCAGGATGCCAAGGAAGTGGCCAGCGAAGCGCCTGCTCAACGG- -----------GCAGGCAACGTGCCAGATGGACCCGAAACTGGAGCCAAG GAAGATGACTACGAGGAGATG------ >D_sechellia_Acp32CD-PA ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC CCTCGGCCAACTGCCGGAGCATGGCGCTCTGGGCCAGAAGTATTACATGA ACTTTGCCTTCAACAACAATAATCCGGATGGCGAAGGAGGCACCGGCGTC GATGGTGGCGGTGGTGGTGCTGGTGGTGGTGCCGCTGGTCCCGGCGGTGG ACCCGGGGAT------CATTCACAAGATGGTGACGGTAGTGCTGCGACGG ATAGCCCCAATGACGACCACGCTACATCTGCTGATAATAGTTTGGCTACT GATGGCGATGCCATTGGTAAGAAGGAAAGCGGCAATGGT---AGCGATGG CAAAAGCGACGCCAAAGACTCGAGCGGAGGCAATGATGCCACGCCAGCGA ATGGTCATGACGATGACAACGATGACAGCGACAGCAAGGATGCCAAGGAT CGAAAATCGAAGGAGGAGGAGGCCGGACAGGAGGGGAAGCGCAACGATCA CAGCCATCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC GGTACGTGCGGTCCATTTACGAGAGCAGCGAGAGCCACGGACATTCCGGC AGCAATGCCGGCTCCAATCAGCGGGACAACGGAGCCCGTGAGAGCAGTCA GGAGAACCAGGAGGCCAAGGAAGTGGTTAGCGAAGCGCCTGCTCAACGGG CAGCTCTCGCCGCTGGCAATGTGCCGGATGGACCCGAAACTGGAGCCAAG GACGATGACTACGAGGAGATG------ >D_simulans_Acp32CD-PA ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC CCTCGGCCAACTGCCGGAGCATGGCGCTCTGGGCCAGAAGTATTACATGA ACTTTGCCTTCAACAACAATAATCCGGATGGCGAAGGAGGCACCGGCGTC GATGGTGGCGGTGGTGGTGCTGGCGGTGGTGCCGCTGGTCCCGGCGGTGG ACCCGGTGAT------CGTTCACAAGATGGTGACGGTAGTGCTGCGACGG ATAGCCCCAATGACGACCACGCTACATCTGCTGATAATAGTTTGGCTACT GATGGCGATGCCATTGGTAAGAAGGAAAGCGGCAATGGT---AGCGATGG CAAAAGCGACTCCAAAGACTCGAGCGGAGGCAATGATGCCACGCCAGCGA ATGGTCATGACGATGACAACGATGACAGCGACAGCAAGGATGCCAAGGAT CGAAAATCGAAGGAGGAGGAGGCCGTACAGGAGGGGAAGCGCACCGATCA CAGCCATCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC GGTACGTGCGGTCCATTTACGAGAGCAGCGAGAGCCACGGACATTCCGGC AGCAATGCCGGCTCCAATCAGCGGGACAACGGAGCCCGTGAGAGCAGTCA GGAGAACCAGGATGCCAAGGAAGTGGCCAGCGAAGCGCCTGCTCAACGGG CAGCTCTCGCCGCTGGCAATGTGCCGGATGGACCCGAAACTGGAGCCAAG GACGATGACTACGAGGAGATG------ >D_yakuba_Acp32CD-PA ATGTGGCGGATGCGGATGCGGCTACTCACTGGCTACCTGGTCCTGCTGGC CCTCGGCCATCTGCCGGAGCATGGCGCTCTGGGCCAGAAGTACTACATGA ACTTCGCCTTCAACAACAATAATCCGGATGGAGAAGGAGGCACCGGCGCC GATGGT------GGCGCTGCTGGTGGTGGTCCCGCTGGTGCCGGTGGTGC AACCAGTGAT------CGTTCACAAGAAGGTGACGGTAGTGCGGCGACGG ATCGTCCCAATGACGACCACGCTACATCCGCTGATAATAGTTTGGCTACT GATGGCGATGCCGGTGATAAGAAAAGTAGTGGAGATGGCAAGAGCGACTC CGACAGCGATTCCAAAGACTCGAGCGGAGGCAATGCTGCCACGCCAGCGA ATGGTCATGACGATGATAACGATGACAGCGACAGCAAGGATGTCAAGGAT CGGCATTCGAAGGAGGAT---GCCGCAGCGGAGGGTAAACGCACCGATCA CAGCCACCACAGTAGCTACGAGATCAGCATCGACGACAGCTTTGGCGGGC GCTACGTGCGCTCCATTTACGAGAGCAGCGAGAGCCACGGCCACTCCGGC AGCAATGCCGGCTCCAATCAGCGGGACAGCGGAGCCCGCGATAGCAGTCA GGAGACCCAGACCGCCAAGGAAATGGCCAGTGAAGCCCCTGCTGCACGGG CACCTCGCGTCGCTGGCAACGTGCCGGATGGGCCCGAAACTGGAGCCAAG GAGGATGACTACGAGGAAATG------
>D_melanogaster_Acp32CD-PA MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV DGGGGGAGGGAAGPGGGTGDSPHSQEGDGSAATDNPNDDHATSADNSLAT DGDAIGKKESGGG-SDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD RQDKEEEAGQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG SNAGSNQRDNGARESSQENQDAKEVASEAPAQR----AGNVPDGPETGAK EDDYEEM >D_sechellia_Acp32CD-PA MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV DGGGGGAGGGAAGPGGGPGD--HSQDGDGSAATDSPNDDHATSADNSLAT DGDAIGKKESGNG-SDGKSDAKDSSGGNDATPANGHDDDNDDSDSKDAKD RKSKEEEAGQEGKRNDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG SNAGSNQRDNGARESSQENQEAKEVVSEAPAQRAALAAGNVPDGPETGAK DDDYEEM >D_simulans_Acp32CD-PA MWRMRMRLLTGYLVLLALGQLPEHGALGQKYYMNFAFNNNNPDGEGGTGV DGGGGGAGGGAAGPGGGPGD--RSQDGDGSAATDSPNDDHATSADNSLAT DGDAIGKKESGNG-SDGKSDSKDSSGGNDATPANGHDDDNDDSDSKDAKD RKSKEEEAVQEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG SNAGSNQRDNGARESSQENQDAKEVASEAPAQRAALAAGNVPDGPETGAK DDDYEEM >D_yakuba_Acp32CD-PA MWRMRMRLLTGYLVLLALGHLPEHGALGQKYYMNFAFNNNNPDGEGGTGA DG--GAAGGGPAGAGGATSD--RSQEGDGSAATDRPNDDHATSADNSLAT DGDAGDKKSSGDGKSDSDSDSKDSSGGNAATPANGHDDDNDDSDSKDVKD RHSKED-AAAEGKRTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSG SNAGSNQRDSGARDSSQETQTAKEMASEAPAARAPRVAGNVPDGPETGAK EDDYEEM
#NEXUS
[ID: 4878404043]
begin taxa;
dimensions ntax=4;
taxlabels
D_melanogaster_Acp32CD-PA
D_sechellia_Acp32CD-PA
D_simulans_Acp32CD-PA
D_yakuba_Acp32CD-PA
;
end;
begin trees;
translate
1 D_melanogaster_Acp32CD-PA,
2 D_sechellia_Acp32CD-PA,
3 D_simulans_Acp32CD-PA,
4 D_yakuba_Acp32CD-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02767772,4:0.1915555,(2:0.008455395,3:0.004353495)0.531:0.00999451);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02767772,4:0.1915555,(2:0.008455395,3:0.004353495):0.00999451);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1506.27 -1514.69
2 -1506.53 -1514.86
--------------------------------------
TOTAL -1506.39 -1514.78
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/Acp32CD-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.252387 0.003678 0.151895 0.373944 0.243768 1021.00 1142.94 1.000
r(A<->C){all} 0.131809 0.002224 0.045839 0.223297 0.127497 790.78 860.67 1.000
r(A<->G){all} 0.168353 0.002592 0.076695 0.266294 0.163026 901.31 960.42 1.000
r(A<->T){all} 0.084589 0.002439 0.003556 0.175050 0.077775 952.94 955.71 1.000
r(C<->G){all} 0.027743 0.000535 0.000001 0.073973 0.021818 849.71 982.55 1.000
r(C<->T){all} 0.420456 0.006083 0.281410 0.581248 0.418123 663.09 828.14 1.000
r(G<->T){all} 0.167050 0.002576 0.069914 0.259796 0.162658 1011.87 1138.42 1.000
pi(A){all} 0.245924 0.000227 0.217041 0.274699 0.245829 1416.84 1433.73 1.000
pi(C){all} 0.264489 0.000217 0.234881 0.291627 0.264310 1283.26 1365.28 1.000
pi(G){all} 0.333021 0.000263 0.304681 0.366913 0.332981 1297.41 1303.89 1.000
pi(T){all} 0.156566 0.000149 0.132433 0.180000 0.156183 1327.24 1377.41 1.000
alpha{1,2} 0.120116 0.013610 0.000119 0.314541 0.092237 1129.48 1304.32 1.000
alpha{3} 0.991351 0.320546 0.202877 2.166851 0.859633 1003.38 1168.65 1.000
pinvar{all} 0.438533 0.018065 0.162445 0.687206 0.453138 1016.73 1099.08 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/3/Acp32CD-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 4 ls = 247
Codon usage in sequences
------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 1 | Ser TCT 1 1 1 0 | Tyr TAT 0 1 1 0 | Cys TGT 0 0 0 0
TTC 1 1 1 2 | TCC 4 3 4 6 | TAC 7 6 6 7 | TGC 0 0 0 0
Leu TTA 0 0 0 0 | TCA 1 1 1 1 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 1 1 1 1 | TCG 1 2 2 2 | TAG 0 0 0 0 | Trp TGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 | Pro CCT 1 1 1 1 | His CAT 5 5 4 4 | Arg CGT 1 1 2 2
CTC 2 2 2 2 | CCC 3 4 4 3 | CAC 4 4 4 6 | CGC 1 1 1 4
CTA 1 1 1 1 | CCA 2 1 1 1 | Gln CAA 4 3 3 1 | CGA 1 1 1 0
CTG 5 5 5 5 | CCG 2 3 3 3 | CAG 5 5 5 4 | CGG 7 7 7 6
------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 1 | Thr ACT 2 3 3 3 | Asn AAT 9 10 10 8 | Ser AGT 4 4 4 8
ATC 2 2 2 2 | ACC 4 1 2 5 | AAC 7 7 6 5 | AGC 16 17 17 15
ATA 0 0 0 0 | ACA 1 1 1 1 | Lys AAA 1 3 3 3 | Arg AGA 0 0 0 0
Met ATG 5 5 5 6 | ACG 2 2 2 2 | AAG 10 9 9 7 | AGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Val GTT 0 1 0 0 | Ala GCT 8 9 9 10 | Asp GAT 18 17 18 20 | Gly GGT 14 13 13 12
GTC 2 2 2 2 | GCC 12 12 12 13 | GAC 13 14 14 13 | GGC 16 16 17 15
GTA 0 0 1 0 | GCA 1 0 0 3 | Glu GAA 8 5 5 6 | GGA 8 8 7 6
GTG 3 3 3 2 | GCG 3 3 3 4 | GAG 10 12 11 9 | GGG 3 3 2 2
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Acp32CD-PA
position 1: T:0.07692 C:0.17814 A:0.26316 G:0.48178
position 2: T:0.10526 C:0.19433 A:0.40891 G:0.29150
position 3: T:0.27126 C:0.38057 A:0.11336 G:0.23482
Average T:0.15115 C:0.25101 A:0.26181 G:0.33603
#2: D_sechellia_Acp32CD-PA
position 1: T:0.07692 C:0.17814 A:0.26721 G:0.47773
position 2: T:0.10931 C:0.19028 A:0.40891 G:0.29150
position 3: T:0.28340 C:0.37247 A:0.09717 G:0.24696
Average T:0.15655 C:0.24696 A:0.25776 G:0.33873
#3: D_simulans_Acp32CD-PA
position 1: T:0.08097 C:0.17814 A:0.26721 G:0.47368
position 2: T:0.10931 C:0.19838 A:0.40081 G:0.29150
position 3: T:0.28340 C:0.38057 A:0.09717 G:0.23887
Average T:0.15789 C:0.25236 A:0.25506 G:0.33468
#4: D_yakuba_Acp32CD-PA
position 1: T:0.08502 C:0.17409 A:0.26721 G:0.47368
position 2: T:0.10121 C:0.23482 A:0.37652 G:0.28745
position 3: T:0.28340 C:0.40486 A:0.09312 G:0.21862
Average T:0.15655 C:0.27126 A:0.24561 G:0.32659
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 7 | Ser S TCT 3 | Tyr Y TAT 2 | Cys C TGT 0
TTC 5 | TCC 17 | TAC 26 | TGC 0
Leu L TTA 0 | TCA 4 | *** * TAA 0 | *** * TGA 0
TTG 4 | TCG 7 | TAG 0 | Trp W TGG 4
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 4 | His H CAT 18 | Arg R CGT 6
CTC 8 | CCC 14 | CAC 18 | CGC 7
CTA 4 | CCA 5 | Gln Q CAA 11 | CGA 3
CTG 20 | CCG 11 | CAG 19 | CGG 27
------------------------------------------------------------------------------
Ile I ATT 7 | Thr T ACT 11 | Asn N AAT 37 | Ser S AGT 20
ATC 8 | ACC 12 | AAC 25 | AGC 65
ATA 0 | ACA 4 | Lys K AAA 10 | Arg R AGA 0
Met M ATG 21 | ACG 8 | AAG 35 | AGG 0
------------------------------------------------------------------------------
Val V GTT 1 | Ala A GCT 36 | Asp D GAT 73 | Gly G GGT 52
GTC 8 | GCC 49 | GAC 54 | GGC 64
GTA 1 | GCA 4 | Glu E GAA 24 | GGA 29
GTG 11 | GCG 13 | GAG 42 | GGG 10
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.07996 C:0.17713 A:0.26619 G:0.47672
position 2: T:0.10628 C:0.20445 A:0.39879 G:0.29049
position 3: T:0.28036 C:0.38462 A:0.10020 G:0.23482
Average T:0.15553 C:0.25540 A:0.25506 G:0.33401
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Acp32CD-PA
D_sechellia_Acp32CD-PA 0.3827 (0.0234 0.0612)
D_simulans_Acp32CD-PA 0.2942 (0.0198 0.0675) 0.5756 (0.0105 0.0183)
D_yakuba_Acp32CD-PA 0.2825 (0.0704 0.2493) 0.3651 (0.0786 0.2151) 0.3222 (0.0690 0.2142)
Model 0: one-ratio
TREE # 1: (1, 4, (2, 3)); MP score: 77
lnL(ntime: 5 np: 7): -1384.388692 +0.000000
5..1 5..4 5..6 6..2 6..3
0.047870 0.287268 0.029360 0.022669 0.014035 1.247061 0.345607
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.40120
(1: 0.047870, 4: 0.287268, (2: 0.022669, 3: 0.014035): 0.029360);
(D_melanogaster_Acp32CD-PA: 0.047870, D_yakuba_Acp32CD-PA: 0.287268, (D_sechellia_Acp32CD-PA: 0.022669, D_simulans_Acp32CD-PA: 0.014035): 0.029360);
Detailed output identifying parameters
kappa (ts/tv) = 1.24706
omega (dN/dS) = 0.34561
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.048 566.0 175.0 0.3456 0.0110 0.0319 6.2 5.6
5..4 0.287 566.0 175.0 0.3456 0.0662 0.1914 37.4 33.5
5..6 0.029 566.0 175.0 0.3456 0.0068 0.0196 3.8 3.4
6..2 0.023 566.0 175.0 0.3456 0.0052 0.0151 3.0 2.6
6..3 0.014 566.0 175.0 0.3456 0.0032 0.0094 1.8 1.6
tree length for dN: 0.0924
tree length for dS: 0.2674
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 77
lnL(ntime: 5 np: 8): -1367.619309 +0.000000
5..1 5..4 5..6 6..2 6..3
0.052703 0.324825 0.027328 0.023025 0.014750 1.155861 0.724545 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.44263
(1: 0.052703, 4: 0.324825, (2: 0.023025, 3: 0.014750): 0.027328);
(D_melanogaster_Acp32CD-PA: 0.052703, D_yakuba_Acp32CD-PA: 0.324825, (D_sechellia_Acp32CD-PA: 0.023025, D_simulans_Acp32CD-PA: 0.014750): 0.027328);
Detailed output identifying parameters
kappa (ts/tv) = 1.15586
dN/dS (w) for site classes (K=2)
p: 0.72454 0.27546
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.053 568.6 172.4 0.2755 0.0109 0.0396 6.2 6.8
5..4 0.325 568.6 172.4 0.2755 0.0672 0.2438 38.2 42.0
5..6 0.027 568.6 172.4 0.2755 0.0057 0.0205 3.2 3.5
6..2 0.023 568.6 172.4 0.2755 0.0048 0.0173 2.7 3.0
6..3 0.015 568.6 172.4 0.2755 0.0030 0.0111 1.7 1.9
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 77
check convergence..
lnL(ntime: 5 np: 10): -1361.945148 +0.000000
5..1 5..4 5..6 6..2 6..3
0.059288 0.396263 0.028040 0.023604 0.016204 1.417638 0.890574 0.000000 0.090991 4.774366
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.52340
(1: 0.059288, 4: 0.396263, (2: 0.023604, 3: 0.016204): 0.028040);
(D_melanogaster_Acp32CD-PA: 0.059288, D_yakuba_Acp32CD-PA: 0.396263, (D_sechellia_Acp32CD-PA: 0.023604, D_simulans_Acp32CD-PA: 0.016204): 0.028040);
Detailed output identifying parameters
kappa (ts/tv) = 1.41764
dN/dS (w) for site classes (K=3)
p: 0.89057 0.00000 0.10943
w: 0.09099 1.00000 4.77437
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.059 561.6 179.4 0.6035 0.0171 0.0283 9.6 5.1
5..4 0.396 561.6 179.4 0.6035 0.1140 0.1888 64.0 33.9
5..6 0.028 561.6 179.4 0.6035 0.0081 0.0134 4.5 2.4
6..2 0.024 561.6 179.4 0.6035 0.0068 0.0112 3.8 2.0
6..3 0.016 561.6 179.4 0.6035 0.0047 0.0077 2.6 1.4
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp32CD-PA)
Pr(w>1) post mean +- SE for w
20 Q 0.564 2.730
54 G 0.533 2.588
62 P 0.517 2.510
65 G 0.766 3.679
66 T 0.605 2.924
67 G 0.708 3.406
69 H 0.983* 4.695
81 N 0.985* 4.706
101 I 0.988* 4.720
105 E 0.999** 4.767
108 G 0.990* 4.726
112 G 0.981* 4.687
113 K 0.973* 4.648
116 S 0.578 2.797
147 Q 0.990* 4.726
148 D 0.999** 4.769
153 G 0.995** 4.750
154 Q 0.983* 4.693
215 D 1.000** 4.772
219 V 0.552 2.676
226 Q 0.991** 4.731
241 E 0.733 3.524
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp32CD-PA)
Pr(w>1) post mean +- SE for w
65 G 0.553 3.600 +- 3.067
69 H 0.768 4.945 +- 2.864
81 N 0.811 5.243 +- 2.816
101 I 0.819 5.272 +- 2.781
105 E 0.893 5.716 +- 2.574
108 G 0.860 5.558 +- 2.704
112 G 0.744 4.779 +- 2.878
113 K 0.724 4.699 +- 2.935
147 Q 0.841 5.415 +- 2.741
148 D 0.966* 6.193 +- 2.297
153 G 0.915 5.894 +- 2.524
154 Q 0.762 4.899 +- 2.866
215 D 0.948 6.078 +- 2.380
226 Q 0.858 5.534 +- 2.701
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.830 0.166 0.004 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.001 0.030 0.115 0.157 0.162 0.156 0.136 0.108 0.079 0.056
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.006
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.025 0.065
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.034 0.284 0.059
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.035 0.215 0.259 0.014
sum of density on p0-p1 = 1.000000
Time used: 0:09
Model 3: discrete (3 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 77
lnL(ntime: 5 np: 11): -1361.945148 +0.000000
5..1 5..4 5..6 6..2 6..3
0.059288 0.396263 0.028039 0.023604 0.016204 1.417633 0.085648 0.804926 0.090981 0.090992 4.774357
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.52340
(1: 0.059288, 4: 0.396263, (2: 0.023604, 3: 0.016204): 0.028039);
(D_melanogaster_Acp32CD-PA: 0.059288, D_yakuba_Acp32CD-PA: 0.396263, (D_sechellia_Acp32CD-PA: 0.023604, D_simulans_Acp32CD-PA: 0.016204): 0.028039);
Detailed output identifying parameters
kappa (ts/tv) = 1.41763
dN/dS (w) for site classes (K=3)
p: 0.08565 0.80493 0.10943
w: 0.09098 0.09099 4.77436
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.059 561.6 179.4 0.6035 0.0171 0.0283 9.6 5.1
5..4 0.396 561.6 179.4 0.6035 0.1140 0.1888 64.0 33.9
5..6 0.028 561.6 179.4 0.6035 0.0081 0.0134 4.5 2.4
6..2 0.024 561.6 179.4 0.6035 0.0068 0.0112 3.8 2.0
6..3 0.016 561.6 179.4 0.6035 0.0047 0.0077 2.6 1.4
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp32CD-PA)
Pr(w>1) post mean +- SE for w
20 Q 0.564 2.730
54 G 0.533 2.588
62 P 0.517 2.510
65 G 0.766 3.679
66 T 0.605 2.924
67 G 0.708 3.406
69 H 0.983* 4.695
81 N 0.985* 4.706
101 I 0.988* 4.720
105 E 0.999** 4.767
108 G 0.990* 4.726
112 G 0.981* 4.687
113 K 0.973* 4.648
116 S 0.578 2.797
147 Q 0.990* 4.726
148 D 0.999** 4.769
153 G 0.995** 4.750
154 Q 0.983* 4.693
215 D 1.000** 4.772
219 V 0.552 2.676
226 Q 0.991** 4.731
241 E 0.733 3.524
Time used: 0:13
Model 7: beta (10 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 77
lnL(ntime: 5 np: 8): -1367.730750 +0.000000
5..1 5..4 5..6 6..2 6..3
0.053209 0.326904 0.027789 0.023323 0.014930 1.176567 0.005000 0.011781
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.44616
(1: 0.053209, 4: 0.326904, (2: 0.023323, 3: 0.014930): 0.027789);
(D_melanogaster_Acp32CD-PA: 0.053209, D_yakuba_Acp32CD-PA: 0.326904, (D_sechellia_Acp32CD-PA: 0.023323, D_simulans_Acp32CD-PA: 0.014930): 0.027789);
Detailed output identifying parameters
kappa (ts/tv) = 1.17657
Parameters in M7 (beta):
p = 0.00500 q = 0.01178
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.053 568.0 173.0 0.3000 0.0115 0.0383 6.5 6.6
5..4 0.327 568.0 173.0 0.3000 0.0705 0.2351 40.1 40.7
5..6 0.028 568.0 173.0 0.3000 0.0060 0.0200 3.4 3.5
6..2 0.023 568.0 173.0 0.3000 0.0050 0.0168 2.9 2.9
6..3 0.015 568.0 173.0 0.3000 0.0032 0.0107 1.8 1.9
Time used: 0:25
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 77
lnL(ntime: 5 np: 10): -1361.945575 +0.000000
5..1 5..4 5..6 6..2 6..3
0.059294 0.396272 0.028033 0.023604 0.016204 1.417517 0.890773 10.009171 99.000000 4.778819
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.52341
(1: 0.059294, 4: 0.396272, (2: 0.023604, 3: 0.016204): 0.028033);
(D_melanogaster_Acp32CD-PA: 0.059294, D_yakuba_Acp32CD-PA: 0.396272, (D_sechellia_Acp32CD-PA: 0.023604, D_simulans_Acp32CD-PA: 0.016204): 0.028033);
Detailed output identifying parameters
kappa (ts/tv) = 1.41752
Parameters in M8 (beta&w>1):
p0 = 0.89077 p = 10.00917 q = 99.00000
(p1 = 0.10923) w = 4.77882
dN/dS (w) for site classes (K=11)
p: 0.08908 0.08908 0.08908 0.08908 0.08908 0.08908 0.08908 0.08908 0.08908 0.08908 0.10923
w: 0.05116 0.06371 0.07204 0.07917 0.08593 0.09280 0.10023 0.10890 0.12034 0.14100 4.77882
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.059 561.6 179.4 0.6035 0.0171 0.0283 9.6 5.1
5..4 0.396 561.6 179.4 0.6035 0.1140 0.1888 64.0 33.9
5..6 0.028 561.6 179.4 0.6035 0.0081 0.0134 4.5 2.4
6..2 0.024 561.6 179.4 0.6035 0.0068 0.0112 3.8 2.0
6..3 0.016 561.6 179.4 0.6035 0.0047 0.0077 2.6 1.4
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp32CD-PA)
Pr(w>1) post mean +- SE for w
20 Q 0.562 2.730
54 G 0.532 2.588
62 P 0.515 2.510
65 G 0.765 3.679
66 T 0.604 2.924
67 G 0.707 3.405
69 H 0.982* 4.693
81 N 0.984* 4.704
101 I 0.987* 4.719
105 E 0.998** 4.771
108 G 0.989* 4.726
112 G 0.980* 4.685
113 K 0.971* 4.643
116 S 0.576 2.797
147 Q 0.989* 4.726
148 D 0.999** 4.773
153 G 0.994** 4.752
154 Q 0.981* 4.691
215 D 0.999** 4.776
219 V 0.551 2.675
226 Q 0.990* 4.731
241 E 0.731 3.519
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp32CD-PA)
Pr(w>1) post mean +- SE for w
65 G 0.554 3.502 +- 3.219
69 H 0.819 5.250 +- 2.976
81 N 0.859 5.548 +- 2.892
101 I 0.867 5.587 +- 2.853
105 E 0.940 6.075 +- 2.563
108 G 0.901 5.844 +- 2.751
112 G 0.795 5.074 +- 3.010
113 K 0.774 4.967 +- 3.078
147 Q 0.886 5.722 +- 2.798
148 D 0.983* 6.375 +- 2.352
153 G 0.946 6.141 +- 2.555
154 Q 0.812 5.198 +- 2.984
215 D 0.975* 6.321 +- 2.394
226 Q 0.901 5.830 +- 2.748
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.336 0.662
p : 0.590 0.313 0.084 0.012 0.001 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.031 0.085 0.082 0.085 0.103 0.125 0.145 0.163 0.180
ws: 0.001 0.039 0.133 0.138 0.129 0.139 0.140 0.122 0.094 0.066
Time used: 0:49
Model 1: NearlyNeutral -1367.619309
Model 2: PositiveSelection -1361.945148
Model 0: one-ratio -1384.388692
Model 3: discrete -1361.945148
Model 7: beta -1367.73075
Model 8: beta&w>1 -1361.945575
Model 0 vs 1 33.53876600000012
Model 2 vs 1 11.348321999999825
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp32CD-PA)
Pr(w>1) post mean +- SE for w
20 Q 0.564 2.730
54 G 0.533 2.588
62 P 0.517 2.510
65 G 0.766 3.679
66 T 0.605 2.924
67 G 0.708 3.406
69 H 0.983* 4.695
81 N 0.985* 4.706
101 I 0.988* 4.720
105 E 0.999** 4.767
108 G 0.990* 4.726
112 G 0.981* 4.687
113 K 0.973* 4.648
116 S 0.578 2.797
147 Q 0.990* 4.726
148 D 0.999** 4.769
153 G 0.995** 4.750
154 Q 0.983* 4.693
215 D 1.000** 4.772
219 V 0.552 2.676
226 Q 0.991** 4.731
241 E 0.733 3.524
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp32CD-PA)
Pr(w>1) post mean +- SE for w
65 G 0.553 3.600 +- 3.067
69 H 0.768 4.945 +- 2.864
81 N 0.811 5.243 +- 2.816
101 I 0.819 5.272 +- 2.781
105 E 0.893 5.716 +- 2.574
108 G 0.860 5.558 +- 2.704
112 G 0.744 4.779 +- 2.878
113 K 0.724 4.699 +- 2.935
147 Q 0.841 5.415 +- 2.741
148 D 0.966* 6.193 +- 2.297
153 G 0.915 5.894 +- 2.524
154 Q 0.762 4.899 +- 2.866
215 D 0.948 6.078 +- 2.380
226 Q 0.858 5.534 +- 2.701
Model 8 vs 7 11.570349999999962
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp32CD-PA)
Pr(w>1) post mean +- SE for w
20 Q 0.562 2.730
54 G 0.532 2.588
62 P 0.515 2.510
65 G 0.765 3.679
66 T 0.604 2.924
67 G 0.707 3.405
69 H 0.982* 4.693
81 N 0.984* 4.704
101 I 0.987* 4.719
105 E 0.998** 4.771
108 G 0.989* 4.726
112 G 0.980* 4.685
113 K 0.971* 4.643
116 S 0.576 2.797
147 Q 0.989* 4.726
148 D 0.999** 4.773
153 G 0.994** 4.752
154 Q 0.981* 4.691
215 D 0.999** 4.776
219 V 0.551 2.675
226 Q 0.990* 4.731
241 E 0.731 3.519
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp32CD-PA)
Pr(w>1) post mean +- SE for w
65 G 0.554 3.502 +- 3.219
69 H 0.819 5.250 +- 2.976
81 N 0.859 5.548 +- 2.892
101 I 0.867 5.587 +- 2.853
105 E 0.940 6.075 +- 2.563
108 G 0.901 5.844 +- 2.751
112 G 0.795 5.074 +- 3.010
113 K 0.774 4.967 +- 3.078
147 Q 0.886 5.722 +- 2.798
148 D 0.983* 6.375 +- 2.352
153 G 0.946 6.141 +- 2.555
154 Q 0.812 5.198 +- 2.984
215 D 0.975* 6.321 +- 2.394
226 Q 0.901 5.830 +- 2.748
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
