--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Dec 06 13:57:40 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/398/Snp-PG/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2459.47 -2472.90
2 -2459.62 -2478.33
--------------------------------------
TOTAL -2459.54 -2477.64
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.963388 0.009720 0.787559 1.161425 0.958353 1347.98 1414.00 1.000
r(A<->C){all} 0.115419 0.000552 0.072784 0.162498 0.113530 984.13 998.77 1.000
r(A<->G){all} 0.256849 0.001367 0.183967 0.327682 0.256045 744.41 783.71 1.000
r(A<->T){all} 0.103790 0.001050 0.044508 0.168039 0.102144 693.30 739.19 1.000
r(C<->G){all} 0.053756 0.000169 0.029781 0.080154 0.052941 1060.13 1133.34 1.000
r(C<->T){all} 0.351131 0.001884 0.264480 0.431829 0.350429 550.13 681.33 1.000
r(G<->T){all} 0.119055 0.000603 0.071022 0.164801 0.118510 891.44 984.00 1.000
pi(A){all} 0.233629 0.000246 0.201508 0.263316 0.232983 898.07 1022.71 1.000
pi(C){all} 0.287858 0.000295 0.255101 0.320856 0.287342 1088.96 1182.47 1.000
pi(G){all} 0.295100 0.000265 0.265512 0.327326 0.295080 1191.07 1226.48 1.000
pi(T){all} 0.183414 0.000208 0.155771 0.210337 0.183008 1072.52 1092.26 1.000
alpha{1,2} 0.165480 0.000828 0.111057 0.220057 0.162381 1305.87 1332.15 1.000
alpha{3} 2.392486 0.609610 1.117551 3.998864 2.277428 1393.41 1401.77 1.000
pinvar{all} 0.255745 0.005058 0.110622 0.379742 0.261562 1176.26 1289.74 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -2317.261831
Model 2: PositiveSelection -2317.261832
Model 0: one-ratio -2324.298065
Model 3: discrete -2300.050517
Model 7: beta -2300.962239
Model 8: beta&w>1 -2300.963136
Model 0 vs 1 14.072468000000299
Model 2 vs 1 2.0000006770715117E-6
Model 8 vs 7 0.0017939999997906853
>C1
MQPYSYVIAVDFEATCWEKQAPPEWREAEIIEFPAVLVNLKTGKIEAEFH
QYILPFESPRLSAYCTELTGIQQKTVDSGMPLRTAIVMFNEWLRNEMRAR
NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECSRKGIRKPAYFNQWID
VRAIYRSWYKYRPCNFTDALSHVGLAFEGKAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPRFVL
>C2
MQPYSYVIAVDFEATCWENQAPPHWREAEIIEFPAVLVNLKTGKIEAEFH
QYILPIESPRLSTYCTELTGIQQKTVDSGIPLQTAMVMFHEWLRNEMRAR
NLTLPKTNKSNILGNCAFVTWTDWDFGICLAKECNRKGIRKAAYFNQWID
VRAIYRSWYKYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMMR
DGALFSITKDLTPYQQLNPNIAL
>C3
MQPYSYVIAVDFEATCWENQAPPHWREAEIIEFPAVLVNLKTGKIESEFH
QYILPIESPRLSTYCTELTGIQQKTVDSGIPLTTAIVMFNEWLRHEIRTR
NLTLPKMNKSNVLGNCAFVTWTDWDFGICLAKECNRKGIRKPAYFNQWID
VRAIYRSWYKYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMMR
DGALFSITKDLTPYQQLNPNFSL
>C4
MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
KYILPFESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYRSWYQYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
>C5
MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
KYILPIESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMNKSNIMGNCAFVTWTDWDFGICLSKECTRKRMRKAAYFNQWID
VRAVYRSWYQYRPCNFTDALEHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
>C6
MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNVKTGKIEAEFH
KYILPIESPRLSAYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMNKSNILGNCAFATWTDWDFGICLAKECTRKRMRKGAYFNQWID
VRAVYRSWYKYKPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALICKMVR
DGALFSITKDLTPYQQLNPNCVL
>C7
MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLNTGKIEAEFH
KYILPIESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLVLPKMSKSNILGNVAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
>C8
MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
KYILPVESPRLSSYCTELTGIQQKTVDSGMPLQTAMMMFHEWLRKELRAR
NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYWSWYKYRPCNFSDALSHVGLSFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCGL
>C9
MQPYTYVISVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
QYILPIESPRLSSYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMSKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
>C10
MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
QYILPIESPRLSSYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMSKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=223
C1 MQPYSYVIAVDFEATCWEKQAPPEWREAEIIEFPAVLVNLKTGKIEAEFH
C2 MQPYSYVIAVDFEATCWENQAPPHWREAEIIEFPAVLVNLKTGKIEAEFH
C3 MQPYSYVIAVDFEATCWENQAPPHWREAEIIEFPAVLVNLKTGKIESEFH
C4 MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
C5 MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
C6 MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNVKTGKIEAEFH
C7 MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLNTGKIEAEFH
C8 MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
C9 MQPYTYVISVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
C10 MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
****:***:*********:****.***************::*****:***
C1 QYILPFESPRLSAYCTELTGIQQKTVDSGMPLRTAIVMFNEWLRNEMRAR
C2 QYILPIESPRLSTYCTELTGIQQKTVDSGIPLQTAMVMFHEWLRNEMRAR
C3 QYILPIESPRLSTYCTELTGIQQKTVDSGIPLTTAIVMFNEWLRHEIRTR
C4 KYILPFESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
C5 KYILPIESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
C6 KYILPIESPRLSAYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
C7 KYILPIESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
C8 KYILPVESPRLSSYCTELTGIQQKTVDSGMPLQTAMMMFHEWLRKELRAR
C9 QYILPIESPRLSSYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
C10 QYILPIESPRLSSYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
:****.******:****************:** **::**:****:*:*:*
C1 NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECSRKGIRKPAYFNQWID
C2 NLTLPKTNKSNILGNCAFVTWTDWDFGICLAKECNRKGIRKAAYFNQWID
C3 NLTLPKMNKSNVLGNCAFVTWTDWDFGICLAKECNRKGIRKPAYFNQWID
C4 NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
C5 NLTLPKMNKSNIMGNCAFVTWTDWDFGICLSKECTRKRMRKAAYFNQWID
C6 NLTLPKMNKSNILGNCAFATWTDWDFGICLAKECTRKRMRKGAYFNQWID
C7 NLVLPKMSKSNILGNVAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
C8 NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
C9 NLTLPKMSKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
C10 NLTLPKMSKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
**.*** .***::** **.***********:***.** :** ********
C1 VRAIYRSWYKYRPCNFTDALSHVGLAFEGKAHSGIDDAKNLGALMCKMVR
C2 VRAIYRSWYKYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMMR
C3 VRAIYRSWYKYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMMR
C4 VRAIYRSWYQYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
C5 VRAVYRSWYQYRPCNFTDALEHVGLAFEGRAHSGIDDAKNLGALMCKMVR
C6 VRAVYRSWYKYKPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALICKMVR
C7 VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
C8 VRAIYWSWYKYRPCNFSDALSHVGLSFEGRAHSGIDDAKNLGALMCKMVR
C9 VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
C10 VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
***:* ***:*:****:***.****:***:**************:***:*
C1 DGALFSITKDLTPYQQLNPRFVL
C2 DGALFSITKDLTPYQQLNPNIAL
C3 DGALFSITKDLTPYQQLNPNFSL
C4 DGALFSITKDLTPYQQLNPNCVL
C5 DGALFSITKDLTPYQQLNPNCVL
C6 DGALFSITKDLTPYQQLNPNCVL
C7 DGALFSITKDLTPYQQLNPNCVL
C8 DGALFSITKDLTPYQQLNPNCGL
C9 DGALFSITKDLTPYQQLNPNCVL
C10 DGALFSITKDLTPYQQLNPNCVL
*******************. *
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 223 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 223 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [20070]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [20070]--->[20070]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/398/Snp-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.552 Mb, Max= 31.095 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MQPYSYVIAVDFEATCWEKQAPPEWREAEIIEFPAVLVNLKTGKIEAEFH
QYILPFESPRLSAYCTELTGIQQKTVDSGMPLRTAIVMFNEWLRNEMRAR
NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECSRKGIRKPAYFNQWID
VRAIYRSWYKYRPCNFTDALSHVGLAFEGKAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPRFVL
>C2
MQPYSYVIAVDFEATCWENQAPPHWREAEIIEFPAVLVNLKTGKIEAEFH
QYILPIESPRLSTYCTELTGIQQKTVDSGIPLQTAMVMFHEWLRNEMRAR
NLTLPKTNKSNILGNCAFVTWTDWDFGICLAKECNRKGIRKAAYFNQWID
VRAIYRSWYKYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMMR
DGALFSITKDLTPYQQLNPNIAL
>C3
MQPYSYVIAVDFEATCWENQAPPHWREAEIIEFPAVLVNLKTGKIESEFH
QYILPIESPRLSTYCTELTGIQQKTVDSGIPLTTAIVMFNEWLRHEIRTR
NLTLPKMNKSNVLGNCAFVTWTDWDFGICLAKECNRKGIRKPAYFNQWID
VRAIYRSWYKYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMMR
DGALFSITKDLTPYQQLNPNFSL
>C4
MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
KYILPFESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYRSWYQYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
>C5
MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
KYILPIESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMNKSNIMGNCAFVTWTDWDFGICLSKECTRKRMRKAAYFNQWID
VRAVYRSWYQYRPCNFTDALEHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
>C6
MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNVKTGKIEAEFH
KYILPIESPRLSAYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMNKSNILGNCAFATWTDWDFGICLAKECTRKRMRKGAYFNQWID
VRAVYRSWYKYKPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALICKMVR
DGALFSITKDLTPYQQLNPNCVL
>C7
MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLNTGKIEAEFH
KYILPIESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLVLPKMSKSNILGNVAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
>C8
MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
KYILPVESPRLSSYCTELTGIQQKTVDSGMPLQTAMMMFHEWLRKELRAR
NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYWSWYKYRPCNFSDALSHVGLSFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCGL
>C9
MQPYTYVISVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
QYILPIESPRLSSYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMSKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
>C10
MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
QYILPIESPRLSSYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMSKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
FORMAT of file /tmp/tmp7421014061972363825aln Not Supported[FATAL:T-COFFEE]
>C1
MQPYSYVIAVDFEATCWEKQAPPEWREAEIIEFPAVLVNLKTGKIEAEFH
QYILPFESPRLSAYCTELTGIQQKTVDSGMPLRTAIVMFNEWLRNEMRAR
NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECSRKGIRKPAYFNQWID
VRAIYRSWYKYRPCNFTDALSHVGLAFEGKAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPRFVL
>C2
MQPYSYVIAVDFEATCWENQAPPHWREAEIIEFPAVLVNLKTGKIEAEFH
QYILPIESPRLSTYCTELTGIQQKTVDSGIPLQTAMVMFHEWLRNEMRAR
NLTLPKTNKSNILGNCAFVTWTDWDFGICLAKECNRKGIRKAAYFNQWID
VRAIYRSWYKYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMMR
DGALFSITKDLTPYQQLNPNIAL
>C3
MQPYSYVIAVDFEATCWENQAPPHWREAEIIEFPAVLVNLKTGKIESEFH
QYILPIESPRLSTYCTELTGIQQKTVDSGIPLTTAIVMFNEWLRHEIRTR
NLTLPKMNKSNVLGNCAFVTWTDWDFGICLAKECNRKGIRKPAYFNQWID
VRAIYRSWYKYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMMR
DGALFSITKDLTPYQQLNPNFSL
>C4
MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
KYILPFESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYRSWYQYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
>C5
MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
KYILPIESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMNKSNIMGNCAFVTWTDWDFGICLSKECTRKRMRKAAYFNQWID
VRAVYRSWYQYRPCNFTDALEHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
>C6
MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNVKTGKIEAEFH
KYILPIESPRLSAYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMNKSNILGNCAFATWTDWDFGICLAKECTRKRMRKGAYFNQWID
VRAVYRSWYKYKPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALICKMVR
DGALFSITKDLTPYQQLNPNCVL
>C7
MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLNTGKIEAEFH
KYILPIESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLVLPKMSKSNILGNVAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
>C8
MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
KYILPVESPRLSSYCTELTGIQQKTVDSGMPLQTAMMMFHEWLRKELRAR
NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYWSWYKYRPCNFSDALSHVGLSFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCGL
>C9
MQPYTYVISVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
QYILPIESPRLSSYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMSKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
>C10
MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
QYILPIESPRLSSYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMSKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:223 S:100 BS:223
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# PW_SEQ_DISTANCES
BOT 0 1 92.83 C1 C2 92.83
TOP 1 0 92.83 C2 C1 92.83
BOT 0 2 92.83 C1 C3 92.83
TOP 2 0 92.83 C3 C1 92.83
BOT 0 3 91.48 C1 C4 91.48
TOP 3 0 91.48 C4 C1 91.48
BOT 0 4 89.69 C1 C5 89.69
TOP 4 0 89.69 C5 C1 89.69
BOT 0 5 89.69 C1 C6 89.69
TOP 5 0 89.69 C6 C1 89.69
BOT 0 6 89.69 C1 C7 89.69
TOP 6 0 89.69 C7 C1 89.69
BOT 0 7 90.58 C1 C8 90.58
TOP 7 0 90.58 C8 C1 90.58
BOT 0 8 90.58 C1 C9 90.58
TOP 8 0 90.58 C9 C1 90.58
BOT 0 9 91.03 C1 C10 91.03
TOP 9 0 91.03 C10 C1 91.03
BOT 1 2 94.62 C2 C3 94.62
TOP 2 1 94.62 C3 C2 94.62
BOT 1 3 91.93 C2 C4 91.93
TOP 3 1 91.93 C4 C2 91.93
BOT 1 4 91.03 C2 C5 91.03
TOP 4 1 91.03 C5 C2 91.03
BOT 1 5 89.69 C2 C6 89.69
TOP 5 1 89.69 C6 C2 89.69
BOT 1 6 91.03 C2 C7 91.03
TOP 6 1 91.03 C7 C2 91.03
BOT 1 7 91.48 C2 C8 91.48
TOP 7 1 91.48 C8 C2 91.48
BOT 1 8 91.48 C2 C9 91.48
TOP 8 1 91.48 C9 C2 91.48
BOT 1 9 91.93 C2 C10 91.93
TOP 9 1 91.93 C10 C2 91.93
BOT 2 3 89.69 C3 C4 89.69
TOP 3 2 89.69 C4 C3 89.69
BOT 2 4 88.79 C3 C5 88.79
TOP 4 2 88.79 C5 C3 88.79
BOT 2 5 87.89 C3 C6 87.89
TOP 5 2 87.89 C6 C3 87.89
BOT 2 6 88.79 C3 C7 88.79
TOP 6 2 88.79 C7 C3 88.79
BOT 2 7 88.79 C3 C8 88.79
TOP 7 2 88.79 C8 C3 88.79
BOT 2 8 89.24 C3 C9 89.24
TOP 8 2 89.24 C9 C3 89.24
BOT 2 9 89.69 C3 C10 89.69
TOP 9 2 89.69 C10 C3 89.69
BOT 3 4 97.31 C4 C5 97.31
TOP 4 3 97.31 C5 C4 97.31
BOT 3 5 95.96 C4 C6 95.96
TOP 5 3 95.96 C6 C4 95.96
BOT 3 6 96.41 C4 C7 96.41
TOP 6 3 96.41 C7 C4 96.41
BOT 3 7 95.52 C4 C8 95.52
TOP 7 3 95.52 C8 C4 95.52
BOT 3 8 96.86 C4 C9 96.86
TOP 8 3 96.86 C9 C4 96.86
BOT 3 9 97.31 C4 C10 97.31
TOP 9 3 97.31 C10 C4 97.31
BOT 4 5 95.07 C5 C6 95.07
TOP 5 4 95.07 C6 C5 95.07
BOT 4 6 95.52 C5 C7 95.52
TOP 6 4 95.52 C7 C5 95.52
BOT 4 7 94.17 C5 C8 94.17
TOP 7 4 94.17 C8 C5 94.17
BOT 4 8 95.07 C5 C9 95.07
TOP 8 4 95.07 C9 C5 95.07
BOT 4 9 95.52 C5 C10 95.52
TOP 9 4 95.52 C10 C5 95.52
BOT 5 6 94.17 C6 C7 94.17
TOP 6 5 94.17 C7 C6 94.17
BOT 5 7 93.27 C6 C8 93.27
TOP 7 5 93.27 C8 C6 93.27
BOT 5 8 95.07 C6 C9 95.07
TOP 8 5 95.07 C9 C6 95.07
BOT 5 9 95.52 C6 C10 95.52
TOP 9 5 95.52 C10 C6 95.52
BOT 6 7 95.07 C7 C8 95.07
TOP 7 6 95.07 C8 C7 95.07
BOT 6 8 96.86 C7 C9 96.86
TOP 8 6 96.86 C9 C7 96.86
BOT 6 9 97.31 C7 C10 97.31
TOP 9 6 97.31 C10 C7 97.31
BOT 7 8 95.52 C8 C9 95.52
TOP 8 7 95.52 C9 C8 95.52
BOT 7 9 95.96 C8 C10 95.96
TOP 9 7 95.96 C10 C8 95.96
BOT 8 9 99.55 C9 C10 99.55
TOP 9 8 99.55 C10 C9 99.55
AVG 0 C1 * 90.93
AVG 1 C2 * 91.78
AVG 2 C3 * 90.03
AVG 3 C4 * 94.72
AVG 4 C5 * 93.57
AVG 5 C6 * 92.92
AVG 6 C7 * 93.87
AVG 7 C8 * 93.37
AVG 8 C9 * 94.47
AVG 9 C10 * 94.87
TOT TOT * 93.05
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCAACCCTACTCATATGTGATTGCCGTGGACTTTGAGGCAACCTGCTG
C2 ATGCAGCCCTACTCGTATGTGATTGCCGTGGACTTTGAGGCAACCTGCTG
C3 ATGCAGCCCTACTCGTATGTGATTGCCGTGGACTTTGAGGCTACCTGCTG
C4 ATGCAGCCCTACACCTATGTGATTGCCGTGGACTTTGAGGCAACCTGCTG
C5 ATGCAGCCCTACTCCTATGTGATTGCCGTGGACTTTGAGGCAACCTGCTG
C6 ATGCAGCCCTATACATATGTAATTGCAGTGGATTTTGAGGCCACCTGCTG
C7 ATGCAACCATACTCCTATGTGATTGCCGTGGATTTTGAGGCCACCTGCTG
C8 ATGCAGCCCTATTCGTATGTGATCGCTGTGGACTTTGAGGCAACCTGCTG
C9 ATGCAGCCCTACACATATGTGATTTCCGTGGACTTTGAGGCCACCTGCTG
C10 ATGCAGCCCTACACGTATGTGATTGCCGTGGACTTTGAGGCCACTTGCTG
*****.**.** :* *****.** * ***** ******** ** *****
C1 GGAAAAGCAGGCTCCGCCAGAGTGGCGAGAAGCGGAGATAATTGAATTCC
C2 GGAAAATCAGGCACCACCACATTGGCGAGAAGCGGAGATAATTGAATTCC
C3 GGAAAATCAGGCTCCACCACATTGGCGAGAAGCGGAGATAATTGAATTCC
C4 GGAGAAGCAGGCACCACCACAATGGCGAGAAGCGGAGATCATTGAATTCC
C5 GGAGAAACAGGCTCCACCACAATGGCGTGAGGCGGAGATTATTGAGTTCC
C6 GGAGAAGCAGGCGCCACCGCAATGGCGAGAGGCGGAGATTATTGAATTCC
C7 GGAGAAGCAGGCTCCACCACAGTGGCGAGAAGCGGAGATTATTGAATTCC
C8 GGAGAAACAGGCGCCACCGCAATGGCGAGAAGCGGAGATCATTGAATTTC
C9 GGAAAAGCAGGCGCCACCGCAGTGGCGAGAAGCGGAGATAATTGAATTCC
C10 GGAGAAGCAGGCGCCCCCGCAGTGGCGAGAAGCGGAGATTATTGAATTCC
***.** ***** ** **. * *****:**.******** *****.** *
C1 CAGCAGTGCTTGTTAACCTTAAGACAGGAAAGATCGAGGCGGAATTCCAC
C2 CAGCAGTGCTCGTTAACCTTAAGACAGGAAAGATCGAGGCGGAGTTCCAC
C3 CAGCAGTGCTCGTTAACCTTAAGACAGGAAAGATCGAGTCGGAGTTCCAC
C4 CAGCAGTGCTTGTTAACCTGAAGACAGGAAAGATCGAAGCGGAGTTTCAC
C5 CAGCAGTGCTTGTGAACCTTAAGACAGGAAAGATCGAGGCGGAGTTCCAC
C6 CAGCTGTCCTGGTCAACGTTAAGACAGGCAAAATTGAGGCCGAATTCCAC
C7 CAGCAGTGCTTGTCAACCTGAATACAGGCAAGATCGAGGCGGAGTTCCAC
C8 CAGCCGTGCTGGTCAACCTGAAGACTGGCAAGATCGAGGCCGAGTTTCAC
C9 CAGCCGTGCTGGTCAACCTGAAGACGGGCAAGATCGAGGCGGAGTTTCAC
C10 CAGCCGTGCTGGTCAACCTGAAGACGGGCAAGATCGAGGCGGAGTTCCAC
**** ** ** ** *** * ** ** **.**.** **. * **.** ***
C1 CAGTACATCCTTCCCTTCGAGTCGCCGCGCTTGAGCGCCTACTGCACGGA
C2 CAGTACATACTTCCCATCGAGTCGCCGCGCTTGAGCACCTACTGCACGGA
C3 CAGTACATCCTTCCCATCGAGTCGCCGCGCTTGAGCACCTACTGCACGGA
C4 AAGTATATCCTACCCTTCGAGTCGCCGCGCTTGAGCACCTACTGTACGGA
C5 AAGTATATTCTACCCATAGAGTCGCCCCGCTTGAGCACCTACTGTACGGA
C6 AAGTACATCCTGCCCATCGAGTCGCCCCGCCTGAGTGCCTACTGTACAGA
C7 AAGTATATCCTGCCCATCGAGTCGCCACGCTTAAGTACCTACTGTACGGA
C8 AAGTATATCCTGCCCGTTGAGTCGCCGCGCTTGAGTAGCTACTGTACGGA
C9 CAATATATACTGCCCATCGAGTCACCACGCTTGAGTAGCTACTGTACGGA
C10 CAGTACATACTGCCCATCGAGTCGCCACGCTTGAGTAGCTACTGCACGGA
.*.** ** ** *** * *****.** *** *.** . ****** **.**
C1 GCTGACGGGCATCCAGCAGAAGACTGTGGACAGCGGAATGCCGCTGCGGA
C2 GCTGACGGGCATCCAGCAGAAAACTGTGGACAGCGGAATACCGCTGCAGA
C3 GCTGACGGGCATCCAGCAGAAGACTGTGGACAGCGGAATACCGCTGACGA
C4 GCTGACGGGCATCCAGCAGAAGACTGTGGACAGCGGAGTGCCGCTGCAGA
C5 GCTGACGGGCATCCAGCAGAAGACTGTGGACAGCGGAGTGCCGCTGCAGA
C6 GCTGACGGGCATCCAGCAGAAGACGGTGGACAGCGGAGTGCCACTGCAGA
C7 GCTGACAGGCATCCAACAGAAGACTGTTGACAGCGGAGTGCCACTGCAGA
C8 ACTGACTGGCATCCAGCAGAAGACTGTGGACAGCGGAATGCCGCTGCAGA
C9 GCTGACGGGCATCCAGCAGAAGACTGTGGACAGCGGAGTGCCGCTGCAGA
C10 GCTGACGGGCATCCAGCAGAAGACTGTGGACAGCGGAGTGCCGCTGCAGA
.***** ********.*****.** ** *********.*.**.***. **
C1 CGGCGATCGTGATGTTTAACGAATGGCTGCGCAATGAGATGCGAGCCCGC
C2 CGGCGATGGTGATGTTTCATGAGTGGCTGCGCAATGAGATGCGCGCCCGG
C3 CGGCGATTGTGATGTTTAACGAGTGGCTGCGCCATGAGATACGCACCAGG
C4 CGGCGCTAATGATGTTTCACGAGTGGCTGCGCAAGGAGCTGCGTGCCCGG
C5 CGGCGCTAATGATGTTTCACGAGTGGTTGCGCAAGGAGCTGCGCGCCCGG
C6 CGGCGCTAATGATGTTCCACGAGTGGCTGCGCAAGGAGCTGCGTGCCCGC
C7 CGGCGCTGATGATGTTCCATGAGTGGCTGCGTAAGGAGCTGCGCGCCCGC
C8 CGGCGATGATGATGTTCCACGAGTGGCTGCGCAAGGAGCTGCGCGCCCGC
C9 CGGCGCTGATGATGTTCCACGAGTGGCTGCGCAAGGAGCTCCGCGCCCGC
C10 CGGCACTGATGATGTTCCACGAGTGGCTGCGCAAGGAGCTGCGAGCCCGC
****..* .******* .* **.*** **** .* ***.* ** .**.*
C1 AACCTTACCTTGCCCAAGATGAACAAGTCAAACATACTGGGCAACTGTGC
C2 AACCTCACCTTGCCCAAGACGAACAAGTCAAACATACTGGGTAACTGTGC
C3 AACCTCACCTTGCCCAAGATGAACAAGTCAAACGTACTGGGTAACTGTGC
C4 AACCTCACCTTGCCCAAGATGAACAAGTCCAACATACTGGGCAACTGTGC
C5 AACCTCACCTTGCCCAAGATGAACAAGTCCAACATAATGGGCAACTGTGC
C6 AACCTGACCTTGCCGAAGATGAACAAGTCAAACATATTAGGGAACTGCGC
C7 AACCTAGTCTTGCCGAAGATGAGCAAGTCAAACATACTTGGCAACGTCGC
C8 AACCTCACCTTGCCGAAGATGAACAAGTCGAATATACTGGGCAACTGCGC
C9 AACCTCACCTTGCCGAAGATGAGCAAATCGAACATACTGGGCAACTGCGC
C10 AACCTCACGTTGCCGAAGATGAGCAAGTCGAACATACTGGGCAACTGCGC
***** . ***** **** **.***.** ** .** * ** *** **
C1 ATTCGTCACCTGGACGGACTGGGACTTCGGCATCTGCTTGGCGAAGGAGT
C2 ATTCGTCACCTGGACGGACTGGGACTTCGGCATCTGTTTGGCGAAGGAGT
C3 ATTCGTCACCTGGACGGATTGGGACTTCGGCATCTGCTTGGCCAAGGAGT
C4 ATTCGTCACCTGGACGGACTGGGACTTTGGCATCTGCTTGGCGAAGGAGT
C5 ATTCGTCACCTGGACGGACTGGGACTTTGGCATCTGCTTGTCGAAGGAGT
C6 CTTCGCCACCTGGACGGACTGGGACTTTGGGATCTGCCTGGCGAAGGAGT
C7 CTTCGTCACCTGGACAGACTGGGACTTTGGCATCTGCTTGGCGAAGGAGT
C8 CTTTGTCACCTGGACGGACTGGGACTTTGGCATCTGCTTGGCGAAAGAGT
C9 CTTCGTCACCTGGACAGACTGGGACTTTGGCATCTGCTTGGCGAAGGAGT
C10 CTTCGTCACCTGGACGGACTGGGACTTTGGCATCTGCTTGGCGAAGGAGT
.** * *********.** ******** ** ***** ** * **.****
C1 GCAGCCGCAAAGGGATACGCAAGCCGGCCTACTTTAATCAGTGGATCGAC
C2 GCAACCGGAAAGGGATACGCAAGGCGGCCTACTTTAATCAGTGGATCGAC
C3 GCAACCGGAAAGGGATACGCAAGCCGGCCTACTTTAATCAGTGGATCGAC
C4 GCACTCGCAAGCGGATGCGCAAGGCGGCCTACTTCAATCAGTGGATCGAT
C5 GCACACGCAAACGGATGCGCAAGGCAGCCTACTTCAATCAGTGGATCGAC
C6 GCACCCGCAAGCGGATGCGTAAGGGAGCCTACTTCAATCAATGGATCGAT
C7 GCACTCGGAAGCGGATGCGCAAGGCAGCCTACTTCAATCAGTGGATTGAT
C8 GCACACGCAAACGGATGCGCAAGGCGGCCTACTTCAATCAGTGGATCGAC
C9 GCACTCGCAAGCGAATGCGCAAAGCGGCCTACTTCAACCAGTGGATCGAC
C10 GCACCCGCAAGCGGATGAGGAAGGCGGCCTACTTCAACCAGTGGATCGAT
*** ** **. *.**..* **. .******** ** **.***** **
C1 GTGCGGGCCATTTATCGGTCGTGGTACAAGTACCGTCCGTGCAACTTCAC
C2 GTGAGGGCCATTTATCGGTCGTGGTACAAGTACCGCCCGTGCAACTTCAC
C3 GTGAGGGCCATTTATCGGTCGTGGTACAAGTACCGCCCGTGCAACTTCAC
C4 GTGCGGGCCATCTATCGATCGTGGTACCAGTACCGTCCGTGCAACTTCAC
C5 GTGCGGGCCGTCTATCGGTCGTGGTATCAGTACCGCCCGTGCAACTTCAC
C6 GTGAGGGCAGTGTATAGGTCGTGGTACAAGTACAAGCCGTGCAACTTCAC
C7 GTACGTGCGATTTATCGATCGTGGTACAAGTACCGCCCGTGTAATTTCAG
C8 GTGCGGGCCATTTATTGGTCGTGGTACAAGTACCGTCCGTGCAACTTCAG
C9 GTGCGGGCCATCTATCGGTCGTGGTACAAGTACCGCCCGTGCAACTTCAG
C10 GTGCGGGCCATCTATCGGTCGTGGTACAAGTACCGCCCGTGCAACTTCAG
**..* ** .* *** *.******** .*****.. ***** ** ****
C1 GGATGCCCTGTCGCACGTGGGTCTGGCATTCGAGGGCAAGGCCCACTCGG
C2 GGATGCCCTGTCGCACGTGGGTCTGGCATTCGAGGGCAGGGCCCACTCCG
C3 GGATGCCCTGTCGCACGTGGGTCTGGCATTCGAGGGCAGGGCCCACTCCG
C4 CGATGCCCTGTCGCACGTGGGCTTGGCCTTCGAGGGCAGGGCCCACTCGG
C5 CGATGCCCTGGAGCACGTGGGCTTGGCCTTCGAGGGCAGGGCCCACTCGG
C6 CGACGCCCTGTCGCACGTGGGCCTGGCGTTCGAGGGAAGGGCTCACTCCG
C7 CGATGCCCTGTCCCATGTAGGACTGGCCTTCGAGGGCAGGGCTCATTCCG
C8 CGATGCCCTGTCGCACGTTGGATTGAGCTTCGAGGGCAGGGCTCACTCCG
C9 CGATGCCCTGTCGCACGTGGGGCTGGCCTTTGAGGGCAGGGCTCATTCCG
C10 CGACGCCCTGTCGCACGTGGGACTGGCCTTCGAGGGCAGGGCCCACTCGG
** ****** . ** ** ** **. ** *****.*.*** ** ** *
C1 GGATCGACGATGCCAAGAATCTGGGCGCACTCATGTGCAAGATGGTGCGC
C2 GGATCGACGATGCCAAGAATCTTGGCGCCCTCATGTGCAAGATGATGCGC
C3 GGATCGACGATGCCAAGAATCTGGGCGCCCTCATGTGCAAGATGATGCGC
C4 GGATCGACGATGCCAAGAATCTGGGCGCCCTCATGTGCAAGATGGTGCGC
C5 GGATCGACGATGCCAAGAATCTGGGCGCCCTTATGTGCAAGATGGTGCGC
C6 GTATCGACGATGCCAAGAACCTGGGCGCCCTCATTTGCAAAATGGTGCGC
C7 GGATTGACGATGCCAAGAACCTGGGCGCCCTCATGTGCAAAATGGTGCGT
C8 GGATCGACGATGCCAAGAACCTGGGCGCCCTCATGTGCAAGATGGTGCGC
C9 GGATCGATGATGCGAAGAACCTGGGCGCTCTCATGTGCAAGATGGTGCGC
C10 GGATCGACGATGCCAAGAACCTGGGCGCCCTCATGTGCAAGATGGTGCGC
* ** ** ***** ***** ** ***** ** ** *****.***.****
C1 GACGGGGCGCTATTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT
C2 GACGGGGCGCTATTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT
C3 GACGGGGCGCTATTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT
C4 GACGGGGCGCTCTTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT
C5 GACGGTGCACTCTTCTCGATCACCAAAGACCTGACGCCATATCAGCAGCT
C6 GACGGAGCGCTCTTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT
C7 GATGGAGCGCTCTTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT
C8 GACGGAGCGCTCTTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT
C9 GATGGAGCGCTCTTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT
C10 GACGGAGCTCTGTTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT
** ** ** ** ***************** ********************
C1 TAATCCCAGGTTCGTGTTG
C2 CAATCCCAACATCGCGTTG
C3 CAATCCCAACTTCTCGTTG
C4 CAATCCCAACTGCGTGTTG
C5 CAATCCCAACTGCGTGTTG
C6 CAATCCCAACTGCGTGTTG
C7 CAATCCCAACTGCGTGTTG
C8 CAATCCCAACTGCGGATTG
C9 CAATCCCAACTGCGTGTTG
C10 CAATCCCAACTGCGTGTTG
*******. : * .***
>C1
ATGCAACCCTACTCATATGTGATTGCCGTGGACTTTGAGGCAACCTGCTG
GGAAAAGCAGGCTCCGCCAGAGTGGCGAGAAGCGGAGATAATTGAATTCC
CAGCAGTGCTTGTTAACCTTAAGACAGGAAAGATCGAGGCGGAATTCCAC
CAGTACATCCTTCCCTTCGAGTCGCCGCGCTTGAGCGCCTACTGCACGGA
GCTGACGGGCATCCAGCAGAAGACTGTGGACAGCGGAATGCCGCTGCGGA
CGGCGATCGTGATGTTTAACGAATGGCTGCGCAATGAGATGCGAGCCCGC
AACCTTACCTTGCCCAAGATGAACAAGTCAAACATACTGGGCAACTGTGC
ATTCGTCACCTGGACGGACTGGGACTTCGGCATCTGCTTGGCGAAGGAGT
GCAGCCGCAAAGGGATACGCAAGCCGGCCTACTTTAATCAGTGGATCGAC
GTGCGGGCCATTTATCGGTCGTGGTACAAGTACCGTCCGTGCAACTTCAC
GGATGCCCTGTCGCACGTGGGTCTGGCATTCGAGGGCAAGGCCCACTCGG
GGATCGACGATGCCAAGAATCTGGGCGCACTCATGTGCAAGATGGTGCGC
GACGGGGCGCTATTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT
TAATCCCAGGTTCGTGTTG
>C2
ATGCAGCCCTACTCGTATGTGATTGCCGTGGACTTTGAGGCAACCTGCTG
GGAAAATCAGGCACCACCACATTGGCGAGAAGCGGAGATAATTGAATTCC
CAGCAGTGCTCGTTAACCTTAAGACAGGAAAGATCGAGGCGGAGTTCCAC
CAGTACATACTTCCCATCGAGTCGCCGCGCTTGAGCACCTACTGCACGGA
GCTGACGGGCATCCAGCAGAAAACTGTGGACAGCGGAATACCGCTGCAGA
CGGCGATGGTGATGTTTCATGAGTGGCTGCGCAATGAGATGCGCGCCCGG
AACCTCACCTTGCCCAAGACGAACAAGTCAAACATACTGGGTAACTGTGC
ATTCGTCACCTGGACGGACTGGGACTTCGGCATCTGTTTGGCGAAGGAGT
GCAACCGGAAAGGGATACGCAAGGCGGCCTACTTTAATCAGTGGATCGAC
GTGAGGGCCATTTATCGGTCGTGGTACAAGTACCGCCCGTGCAACTTCAC
GGATGCCCTGTCGCACGTGGGTCTGGCATTCGAGGGCAGGGCCCACTCCG
GGATCGACGATGCCAAGAATCTTGGCGCCCTCATGTGCAAGATGATGCGC
GACGGGGCGCTATTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT
CAATCCCAACATCGCGTTG
>C3
ATGCAGCCCTACTCGTATGTGATTGCCGTGGACTTTGAGGCTACCTGCTG
GGAAAATCAGGCTCCACCACATTGGCGAGAAGCGGAGATAATTGAATTCC
CAGCAGTGCTCGTTAACCTTAAGACAGGAAAGATCGAGTCGGAGTTCCAC
CAGTACATCCTTCCCATCGAGTCGCCGCGCTTGAGCACCTACTGCACGGA
GCTGACGGGCATCCAGCAGAAGACTGTGGACAGCGGAATACCGCTGACGA
CGGCGATTGTGATGTTTAACGAGTGGCTGCGCCATGAGATACGCACCAGG
AACCTCACCTTGCCCAAGATGAACAAGTCAAACGTACTGGGTAACTGTGC
ATTCGTCACCTGGACGGATTGGGACTTCGGCATCTGCTTGGCCAAGGAGT
GCAACCGGAAAGGGATACGCAAGCCGGCCTACTTTAATCAGTGGATCGAC
GTGAGGGCCATTTATCGGTCGTGGTACAAGTACCGCCCGTGCAACTTCAC
GGATGCCCTGTCGCACGTGGGTCTGGCATTCGAGGGCAGGGCCCACTCCG
GGATCGACGATGCCAAGAATCTGGGCGCCCTCATGTGCAAGATGATGCGC
GACGGGGCGCTATTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT
CAATCCCAACTTCTCGTTG
>C4
ATGCAGCCCTACACCTATGTGATTGCCGTGGACTTTGAGGCAACCTGCTG
GGAGAAGCAGGCACCACCACAATGGCGAGAAGCGGAGATCATTGAATTCC
CAGCAGTGCTTGTTAACCTGAAGACAGGAAAGATCGAAGCGGAGTTTCAC
AAGTATATCCTACCCTTCGAGTCGCCGCGCTTGAGCACCTACTGTACGGA
GCTGACGGGCATCCAGCAGAAGACTGTGGACAGCGGAGTGCCGCTGCAGA
CGGCGCTAATGATGTTTCACGAGTGGCTGCGCAAGGAGCTGCGTGCCCGG
AACCTCACCTTGCCCAAGATGAACAAGTCCAACATACTGGGCAACTGTGC
ATTCGTCACCTGGACGGACTGGGACTTTGGCATCTGCTTGGCGAAGGAGT
GCACTCGCAAGCGGATGCGCAAGGCGGCCTACTTCAATCAGTGGATCGAT
GTGCGGGCCATCTATCGATCGTGGTACCAGTACCGTCCGTGCAACTTCAC
CGATGCCCTGTCGCACGTGGGCTTGGCCTTCGAGGGCAGGGCCCACTCGG
GGATCGACGATGCCAAGAATCTGGGCGCCCTCATGTGCAAGATGGTGCGC
GACGGGGCGCTCTTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT
CAATCCCAACTGCGTGTTG
>C5
ATGCAGCCCTACTCCTATGTGATTGCCGTGGACTTTGAGGCAACCTGCTG
GGAGAAACAGGCTCCACCACAATGGCGTGAGGCGGAGATTATTGAGTTCC
CAGCAGTGCTTGTGAACCTTAAGACAGGAAAGATCGAGGCGGAGTTCCAC
AAGTATATTCTACCCATAGAGTCGCCCCGCTTGAGCACCTACTGTACGGA
GCTGACGGGCATCCAGCAGAAGACTGTGGACAGCGGAGTGCCGCTGCAGA
CGGCGCTAATGATGTTTCACGAGTGGTTGCGCAAGGAGCTGCGCGCCCGG
AACCTCACCTTGCCCAAGATGAACAAGTCCAACATAATGGGCAACTGTGC
ATTCGTCACCTGGACGGACTGGGACTTTGGCATCTGCTTGTCGAAGGAGT
GCACACGCAAACGGATGCGCAAGGCAGCCTACTTCAATCAGTGGATCGAC
GTGCGGGCCGTCTATCGGTCGTGGTATCAGTACCGCCCGTGCAACTTCAC
CGATGCCCTGGAGCACGTGGGCTTGGCCTTCGAGGGCAGGGCCCACTCGG
GGATCGACGATGCCAAGAATCTGGGCGCCCTTATGTGCAAGATGGTGCGC
GACGGTGCACTCTTCTCGATCACCAAAGACCTGACGCCATATCAGCAGCT
CAATCCCAACTGCGTGTTG
>C6
ATGCAGCCCTATACATATGTAATTGCAGTGGATTTTGAGGCCACCTGCTG
GGAGAAGCAGGCGCCACCGCAATGGCGAGAGGCGGAGATTATTGAATTCC
CAGCTGTCCTGGTCAACGTTAAGACAGGCAAAATTGAGGCCGAATTCCAC
AAGTACATCCTGCCCATCGAGTCGCCCCGCCTGAGTGCCTACTGTACAGA
GCTGACGGGCATCCAGCAGAAGACGGTGGACAGCGGAGTGCCACTGCAGA
CGGCGCTAATGATGTTCCACGAGTGGCTGCGCAAGGAGCTGCGTGCCCGC
AACCTGACCTTGCCGAAGATGAACAAGTCAAACATATTAGGGAACTGCGC
CTTCGCCACCTGGACGGACTGGGACTTTGGGATCTGCCTGGCGAAGGAGT
GCACCCGCAAGCGGATGCGTAAGGGAGCCTACTTCAATCAATGGATCGAT
GTGAGGGCAGTGTATAGGTCGTGGTACAAGTACAAGCCGTGCAACTTCAC
CGACGCCCTGTCGCACGTGGGCCTGGCGTTCGAGGGAAGGGCTCACTCCG
GTATCGACGATGCCAAGAACCTGGGCGCCCTCATTTGCAAAATGGTGCGC
GACGGAGCGCTCTTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT
CAATCCCAACTGCGTGTTG
>C7
ATGCAACCATACTCCTATGTGATTGCCGTGGATTTTGAGGCCACCTGCTG
GGAGAAGCAGGCTCCACCACAGTGGCGAGAAGCGGAGATTATTGAATTCC
CAGCAGTGCTTGTCAACCTGAATACAGGCAAGATCGAGGCGGAGTTCCAC
AAGTATATCCTGCCCATCGAGTCGCCACGCTTAAGTACCTACTGTACGGA
GCTGACAGGCATCCAACAGAAGACTGTTGACAGCGGAGTGCCACTGCAGA
CGGCGCTGATGATGTTCCATGAGTGGCTGCGTAAGGAGCTGCGCGCCCGC
AACCTAGTCTTGCCGAAGATGAGCAAGTCAAACATACTTGGCAACGTCGC
CTTCGTCACCTGGACAGACTGGGACTTTGGCATCTGCTTGGCGAAGGAGT
GCACTCGGAAGCGGATGCGCAAGGCAGCCTACTTCAATCAGTGGATTGAT
GTACGTGCGATTTATCGATCGTGGTACAAGTACCGCCCGTGTAATTTCAG
CGATGCCCTGTCCCATGTAGGACTGGCCTTCGAGGGCAGGGCTCATTCCG
GGATTGACGATGCCAAGAACCTGGGCGCCCTCATGTGCAAAATGGTGCGT
GATGGAGCGCTCTTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT
CAATCCCAACTGCGTGTTG
>C8
ATGCAGCCCTATTCGTATGTGATCGCTGTGGACTTTGAGGCAACCTGCTG
GGAGAAACAGGCGCCACCGCAATGGCGAGAAGCGGAGATCATTGAATTTC
CAGCCGTGCTGGTCAACCTGAAGACTGGCAAGATCGAGGCCGAGTTTCAC
AAGTATATCCTGCCCGTTGAGTCGCCGCGCTTGAGTAGCTACTGTACGGA
ACTGACTGGCATCCAGCAGAAGACTGTGGACAGCGGAATGCCGCTGCAGA
CGGCGATGATGATGTTCCACGAGTGGCTGCGCAAGGAGCTGCGCGCCCGC
AACCTCACCTTGCCGAAGATGAACAAGTCGAATATACTGGGCAACTGCGC
CTTTGTCACCTGGACGGACTGGGACTTTGGCATCTGCTTGGCGAAAGAGT
GCACACGCAAACGGATGCGCAAGGCGGCCTACTTCAATCAGTGGATCGAC
GTGCGGGCCATTTATTGGTCGTGGTACAAGTACCGTCCGTGCAACTTCAG
CGATGCCCTGTCGCACGTTGGATTGAGCTTCGAGGGCAGGGCTCACTCCG
GGATCGACGATGCCAAGAACCTGGGCGCCCTCATGTGCAAGATGGTGCGC
GACGGAGCGCTCTTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT
CAATCCCAACTGCGGATTG
>C9
ATGCAGCCCTACACATATGTGATTTCCGTGGACTTTGAGGCCACCTGCTG
GGAAAAGCAGGCGCCACCGCAGTGGCGAGAAGCGGAGATAATTGAATTCC
CAGCCGTGCTGGTCAACCTGAAGACGGGCAAGATCGAGGCGGAGTTTCAC
CAATATATACTGCCCATCGAGTCACCACGCTTGAGTAGCTACTGTACGGA
GCTGACGGGCATCCAGCAGAAGACTGTGGACAGCGGAGTGCCGCTGCAGA
CGGCGCTGATGATGTTCCACGAGTGGCTGCGCAAGGAGCTCCGCGCCCGC
AACCTCACCTTGCCGAAGATGAGCAAATCGAACATACTGGGCAACTGCGC
CTTCGTCACCTGGACAGACTGGGACTTTGGCATCTGCTTGGCGAAGGAGT
GCACTCGCAAGCGAATGCGCAAAGCGGCCTACTTCAACCAGTGGATCGAC
GTGCGGGCCATCTATCGGTCGTGGTACAAGTACCGCCCGTGCAACTTCAG
CGATGCCCTGTCGCACGTGGGGCTGGCCTTTGAGGGCAGGGCTCATTCCG
GGATCGATGATGCGAAGAACCTGGGCGCTCTCATGTGCAAGATGGTGCGC
GATGGAGCGCTCTTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT
CAATCCCAACTGCGTGTTG
>C10
ATGCAGCCCTACACGTATGTGATTGCCGTGGACTTTGAGGCCACTTGCTG
GGAGAAGCAGGCGCCCCCGCAGTGGCGAGAAGCGGAGATTATTGAATTCC
CAGCCGTGCTGGTCAACCTGAAGACGGGCAAGATCGAGGCGGAGTTCCAC
CAGTACATACTGCCCATCGAGTCGCCACGCTTGAGTAGCTACTGCACGGA
GCTGACGGGCATCCAGCAGAAGACTGTGGACAGCGGAGTGCCGCTGCAGA
CGGCACTGATGATGTTCCACGAGTGGCTGCGCAAGGAGCTGCGAGCCCGC
AACCTCACGTTGCCGAAGATGAGCAAGTCGAACATACTGGGCAACTGCGC
CTTCGTCACCTGGACGGACTGGGACTTTGGCATCTGCTTGGCGAAGGAGT
GCACCCGCAAGCGGATGAGGAAGGCGGCCTACTTCAACCAGTGGATCGAT
GTGCGGGCCATCTATCGGTCGTGGTACAAGTACCGCCCGTGCAACTTCAG
CGACGCCCTGTCGCACGTGGGACTGGCCTTCGAGGGCAGGGCCCACTCGG
GGATCGACGATGCCAAGAACCTGGGCGCCCTCATGTGCAAGATGGTGCGC
GACGGAGCTCTGTTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT
CAATCCCAACTGCGTGTTG
>C1
MQPYSYVIAVDFEATCWEKQAPPEWREAEIIEFPAVLVNLKTGKIEAEFH
QYILPFESPRLSAYCTELTGIQQKTVDSGMPLRTAIVMFNEWLRNEMRAR
NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECSRKGIRKPAYFNQWID
VRAIYRSWYKYRPCNFTDALSHVGLAFEGKAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPRFVL
>C2
MQPYSYVIAVDFEATCWENQAPPHWREAEIIEFPAVLVNLKTGKIEAEFH
QYILPIESPRLSTYCTELTGIQQKTVDSGIPLQTAMVMFHEWLRNEMRAR
NLTLPKTNKSNILGNCAFVTWTDWDFGICLAKECNRKGIRKAAYFNQWID
VRAIYRSWYKYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMMR
DGALFSITKDLTPYQQLNPNIAL
>C3
MQPYSYVIAVDFEATCWENQAPPHWREAEIIEFPAVLVNLKTGKIESEFH
QYILPIESPRLSTYCTELTGIQQKTVDSGIPLTTAIVMFNEWLRHEIRTR
NLTLPKMNKSNVLGNCAFVTWTDWDFGICLAKECNRKGIRKPAYFNQWID
VRAIYRSWYKYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMMR
DGALFSITKDLTPYQQLNPNFSL
>C4
MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
KYILPFESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYRSWYQYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
>C5
MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
KYILPIESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMNKSNIMGNCAFVTWTDWDFGICLSKECTRKRMRKAAYFNQWID
VRAVYRSWYQYRPCNFTDALEHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
>C6
MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNVKTGKIEAEFH
KYILPIESPRLSAYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMNKSNILGNCAFATWTDWDFGICLAKECTRKRMRKGAYFNQWID
VRAVYRSWYKYKPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALICKMVR
DGALFSITKDLTPYQQLNPNCVL
>C7
MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLNTGKIEAEFH
KYILPIESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLVLPKMSKSNILGNVAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
>C8
MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
KYILPVESPRLSSYCTELTGIQQKTVDSGMPLQTAMMMFHEWLRKELRAR
NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYWSWYKYRPCNFSDALSHVGLSFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCGL
>C9
MQPYTYVISVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
QYILPIESPRLSSYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMSKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
>C10
MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
QYILPIESPRLSSYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
NLTLPKMSKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
DGALFSITKDLTPYQQLNPNCVL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 10 taxa and 669 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1481031870
Setting output file names to "/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 858578210
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1335819125
Seed = 1152852779
Swapseed = 1481031870
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 40 unique site patterns
Division 2 has 21 unique site patterns
Division 3 has 109 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -3271.007439 -- -24.412588
Chain 2 -- -3255.420497 -- -24.412588
Chain 3 -- -3240.851710 -- -24.412588
Chain 4 -- -3302.625777 -- -24.412588
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -3246.317295 -- -24.412588
Chain 2 -- -3283.268451 -- -24.412588
Chain 3 -- -3278.892520 -- -24.412588
Chain 4 -- -3263.552223 -- -24.412588
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-3271.007] (-3255.420) (-3240.852) (-3302.626) * [-3246.317] (-3283.268) (-3278.893) (-3263.552)
500 -- (-2538.955) [-2543.152] (-2555.650) (-2538.662) * (-2562.490) (-2543.790) (-2560.598) [-2540.438] -- 0:00:00
1000 -- (-2511.029) (-2520.063) (-2537.954) [-2492.575] * (-2550.628) (-2505.640) (-2516.977) [-2522.733] -- 0:00:00
1500 -- (-2495.119) (-2496.256) (-2519.969) [-2482.560] * (-2529.131) [-2485.974] (-2482.087) (-2497.852) -- 0:11:05
2000 -- (-2489.288) (-2477.478) (-2493.239) [-2464.984] * (-2523.358) (-2475.354) [-2460.737] (-2470.890) -- 0:08:19
2500 -- (-2468.507) [-2465.803] (-2472.681) (-2466.123) * (-2494.641) (-2470.146) [-2457.160] (-2472.551) -- 0:06:39
3000 -- (-2471.142) (-2469.358) (-2471.178) [-2467.745] * (-2486.849) (-2472.063) [-2464.201] (-2466.479) -- 0:05:32
3500 -- [-2463.633] (-2465.477) (-2477.205) (-2473.988) * (-2476.525) (-2468.796) (-2462.524) [-2460.697] -- 0:09:29
4000 -- (-2463.910) [-2467.132] (-2474.684) (-2465.570) * (-2482.682) (-2459.011) [-2460.732] (-2465.001) -- 0:08:18
4500 -- (-2462.771) (-2467.808) (-2472.434) [-2464.545] * (-2475.215) (-2461.033) (-2466.974) [-2462.412] -- 0:07:22
5000 -- [-2465.206] (-2467.147) (-2468.659) (-2462.184) * [-2471.507] (-2473.301) (-2462.535) (-2464.478) -- 0:06:38
Average standard deviation of split frequencies: 0.088388
5500 -- (-2462.917) [-2465.679] (-2466.950) (-2464.770) * (-2466.749) (-2458.458) [-2464.009] (-2468.979) -- 0:06:01
6000 -- [-2468.143] (-2464.518) (-2471.732) (-2461.533) * (-2471.004) [-2462.807] (-2472.822) (-2464.072) -- 0:08:17
6500 -- (-2477.279) [-2464.512] (-2467.867) (-2466.013) * [-2470.034] (-2465.110) (-2462.748) (-2461.957) -- 0:07:38
7000 -- (-2469.817) (-2460.027) (-2462.153) [-2463.476] * [-2466.830] (-2462.494) (-2479.054) (-2466.180) -- 0:07:05
7500 -- (-2468.530) (-2464.367) (-2479.184) [-2466.171] * (-2472.503) (-2464.664) [-2465.229] (-2468.654) -- 0:06:37
8000 -- [-2469.190] (-2471.786) (-2472.293) (-2464.572) * (-2469.647) [-2459.445] (-2467.782) (-2467.534) -- 0:06:12
8500 -- (-2475.837) (-2466.694) [-2458.625] (-2456.919) * (-2479.535) (-2471.062) [-2457.707] (-2471.780) -- 0:07:46
9000 -- [-2465.416] (-2464.991) (-2458.410) (-2464.689) * (-2473.167) (-2469.020) [-2467.049] (-2468.173) -- 0:07:20
9500 -- (-2463.373) [-2463.460] (-2464.454) (-2473.320) * (-2476.536) (-2470.198) [-2463.329] (-2464.043) -- 0:06:57
10000 -- (-2468.692) [-2461.709] (-2463.160) (-2468.287) * (-2471.766) [-2467.602] (-2464.311) (-2468.504) -- 0:06:36
Average standard deviation of split frequencies: 0.088388
10500 -- (-2474.380) (-2469.541) (-2471.795) [-2468.656] * (-2468.530) [-2461.401] (-2469.109) (-2479.200) -- 0:07:51
11000 -- (-2473.263) (-2463.492) [-2458.145] (-2468.194) * [-2457.532] (-2459.681) (-2465.155) (-2469.628) -- 0:07:29
11500 -- (-2463.098) [-2470.288] (-2464.202) (-2464.006) * (-2462.051) [-2459.789] (-2471.106) (-2473.726) -- 0:07:09
12000 -- (-2468.166) (-2464.159) [-2465.743] (-2466.276) * (-2463.834) (-2466.047) (-2466.951) [-2465.218] -- 0:06:51
12500 -- (-2470.837) (-2465.457) [-2462.057] (-2470.278) * (-2472.236) (-2463.528) [-2466.109] (-2467.825) -- 0:06:35
13000 -- [-2471.039] (-2472.610) (-2467.139) (-2463.917) * (-2462.539) (-2465.902) (-2467.638) [-2464.145] -- 0:07:35
13500 -- (-2462.232) (-2468.698) [-2457.476] (-2466.155) * (-2478.838) (-2476.923) (-2470.354) [-2467.934] -- 0:07:18
14000 -- (-2465.499) (-2466.716) [-2461.871] (-2470.555) * (-2466.858) (-2471.356) (-2461.257) [-2466.590] -- 0:07:02
14500 -- (-2462.807) (-2462.623) (-2472.641) [-2465.618] * (-2464.904) [-2461.874] (-2461.646) (-2468.523) -- 0:06:47
15000 -- (-2472.487) [-2466.372] (-2465.562) (-2466.257) * [-2468.863] (-2461.418) (-2461.292) (-2468.059) -- 0:06:34
Average standard deviation of split frequencies: 0.031729
15500 -- (-2469.664) [-2460.024] (-2470.188) (-2475.207) * (-2466.278) (-2469.034) (-2465.173) [-2463.611] -- 0:07:24
16000 -- (-2468.007) (-2465.680) (-2465.115) [-2466.154] * [-2464.916] (-2471.524) (-2462.972) (-2468.824) -- 0:07:10
16500 -- [-2463.525] (-2470.831) (-2463.546) (-2462.247) * (-2467.526) [-2462.582] (-2467.391) (-2464.049) -- 0:06:57
17000 -- (-2464.329) [-2465.268] (-2469.178) (-2462.611) * (-2468.533) (-2466.247) (-2459.983) [-2458.308] -- 0:06:44
17500 -- [-2464.156] (-2463.082) (-2467.147) (-2471.965) * (-2465.734) (-2472.947) (-2465.681) [-2470.430] -- 0:07:29
18000 -- (-2469.805) [-2472.470] (-2471.323) (-2466.828) * (-2465.160) [-2473.817] (-2460.744) (-2458.330) -- 0:07:16
18500 -- (-2466.088) [-2461.996] (-2465.920) (-2480.845) * [-2460.710] (-2464.468) (-2461.141) (-2465.069) -- 0:07:04
19000 -- (-2468.355) [-2472.020] (-2466.671) (-2468.551) * (-2466.194) (-2462.673) (-2471.753) [-2469.889] -- 0:06:53
19500 -- [-2461.850] (-2479.760) (-2462.095) (-2466.324) * (-2467.293) (-2457.937) [-2464.530] (-2468.276) -- 0:06:42
20000 -- [-2465.879] (-2467.600) (-2455.798) (-2465.673) * [-2466.035] (-2460.464) (-2467.028) (-2462.838) -- 0:07:21
Average standard deviation of split frequencies: 0.026612
20500 -- (-2463.884) [-2467.436] (-2462.535) (-2471.487) * (-2462.347) [-2465.365] (-2465.041) (-2466.867) -- 0:07:10
21000 -- (-2466.303) (-2474.985) (-2464.748) [-2467.859] * (-2465.303) [-2464.110] (-2476.244) (-2466.598) -- 0:06:59
21500 -- (-2472.636) (-2466.028) [-2465.182] (-2466.234) * [-2462.790] (-2472.972) (-2480.799) (-2457.138) -- 0:06:49
22000 -- (-2459.633) (-2466.527) [-2465.131] (-2465.631) * [-2471.152] (-2472.718) (-2464.662) (-2460.805) -- 0:06:40
22500 -- (-2458.911) (-2467.328) [-2464.959] (-2465.187) * (-2467.647) (-2461.792) (-2469.483) [-2468.076] -- 0:07:14
23000 -- [-2465.301] (-2464.513) (-2467.259) (-2470.232) * (-2472.113) (-2472.062) (-2462.387) [-2460.299] -- 0:07:04
23500 -- (-2461.790) (-2460.509) [-2467.042] (-2473.214) * (-2473.337) (-2477.734) (-2462.697) [-2466.460] -- 0:06:55
24000 -- (-2472.546) [-2462.106] (-2463.722) (-2472.193) * [-2466.250] (-2467.645) (-2467.285) (-2464.243) -- 0:06:46
24500 -- (-2463.132) (-2470.251) [-2463.763] (-2474.911) * (-2470.625) (-2472.675) [-2462.878] (-2463.501) -- 0:07:17
25000 -- (-2476.002) (-2476.344) (-2472.504) [-2461.454] * (-2470.074) [-2467.809] (-2468.337) (-2471.945) -- 0:07:09
Average standard deviation of split frequencies: 0.022315
25500 -- (-2459.465) (-2459.927) (-2461.344) [-2466.368] * (-2467.013) (-2465.714) [-2464.018] (-2464.238) -- 0:07:00
26000 -- [-2463.244] (-2466.295) (-2463.293) (-2466.708) * [-2475.259] (-2468.826) (-2475.212) (-2467.019) -- 0:06:52
26500 -- (-2476.810) [-2472.481] (-2477.797) (-2462.727) * (-2472.141) (-2468.371) (-2468.108) [-2465.855] -- 0:06:44
27000 -- [-2467.387] (-2463.981) (-2472.166) (-2471.758) * [-2467.307] (-2466.357) (-2466.456) (-2471.614) -- 0:07:12
27500 -- (-2474.687) [-2463.760] (-2468.641) (-2465.940) * (-2467.377) [-2463.450] (-2469.882) (-2475.542) -- 0:07:04
28000 -- [-2468.192] (-2472.429) (-2464.764) (-2465.558) * (-2475.164) (-2462.668) (-2471.128) [-2465.820] -- 0:06:56
28500 -- (-2461.160) [-2469.600] (-2466.060) (-2460.764) * [-2458.286] (-2458.786) (-2470.636) (-2458.959) -- 0:06:49
29000 -- [-2462.983] (-2477.748) (-2467.552) (-2482.294) * (-2461.963) (-2466.865) [-2470.729] (-2466.541) -- 0:06:41
29500 -- (-2468.677) (-2473.596) (-2468.208) [-2465.789] * (-2468.095) (-2472.754) [-2463.935] (-2461.626) -- 0:07:07
30000 -- [-2459.533] (-2467.542) (-2467.389) (-2460.703) * [-2461.443] (-2469.298) (-2466.904) (-2470.891) -- 0:07:00
Average standard deviation of split frequencies: 0.028379
30500 -- (-2468.612) (-2472.912) [-2475.738] (-2470.282) * (-2469.626) (-2472.382) [-2461.192] (-2471.340) -- 0:06:53
31000 -- (-2472.760) (-2471.603) [-2468.805] (-2472.011) * (-2469.716) (-2470.550) (-2464.466) [-2474.267] -- 0:06:46
31500 -- [-2467.778] (-2471.024) (-2466.054) (-2462.938) * [-2463.943] (-2466.447) (-2470.873) (-2463.703) -- 0:07:10
32000 -- (-2469.980) [-2463.959] (-2471.637) (-2465.336) * (-2470.724) [-2461.774] (-2464.988) (-2465.965) -- 0:07:03
32500 -- (-2468.641) (-2468.640) (-2476.433) [-2466.436] * (-2459.198) (-2470.169) (-2459.212) [-2463.945] -- 0:06:56
33000 -- (-2474.993) (-2463.078) [-2461.996] (-2462.904) * [-2457.094] (-2475.571) (-2464.282) (-2463.444) -- 0:06:50
33500 -- [-2462.790] (-2468.394) (-2467.733) (-2470.568) * (-2459.398) (-2476.096) [-2475.862] (-2461.300) -- 0:06:43
34000 -- (-2463.259) [-2464.910] (-2464.054) (-2466.109) * (-2459.892) (-2464.186) [-2459.097] (-2466.196) -- 0:07:06
34500 -- [-2462.302] (-2469.754) (-2467.884) (-2462.977) * (-2462.029) (-2467.200) (-2468.465) [-2469.893] -- 0:06:59
35000 -- (-2468.219) [-2463.928] (-2458.239) (-2471.691) * (-2464.672) [-2457.823] (-2462.125) (-2471.940) -- 0:06:53
Average standard deviation of split frequencies: 0.026189
35500 -- (-2462.173) [-2467.886] (-2462.875) (-2468.835) * (-2463.219) (-2460.816) (-2466.102) [-2469.322] -- 0:06:47
36000 -- [-2467.971] (-2477.152) (-2466.619) (-2470.421) * (-2466.804) [-2464.358] (-2475.280) (-2471.546) -- 0:07:08
36500 -- [-2462.299] (-2471.310) (-2463.531) (-2460.377) * [-2463.239] (-2477.022) (-2462.547) (-2473.785) -- 0:07:02
37000 -- (-2460.526) (-2463.184) [-2458.546] (-2461.725) * [-2464.029] (-2465.890) (-2467.145) (-2462.030) -- 0:06:56
37500 -- (-2471.385) (-2467.899) [-2463.358] (-2465.382) * [-2462.169] (-2459.585) (-2464.233) (-2463.001) -- 0:06:50
38000 -- (-2467.658) (-2461.706) [-2457.593] (-2464.329) * (-2476.317) (-2462.984) [-2470.218] (-2467.270) -- 0:06:45
38500 -- (-2460.225) [-2470.968] (-2471.448) (-2464.267) * (-2466.098) [-2461.493] (-2475.613) (-2468.792) -- 0:07:04
39000 -- (-2465.072) (-2470.228) (-2472.509) [-2457.204] * (-2473.915) [-2459.035] (-2471.455) (-2470.102) -- 0:06:58
39500 -- (-2466.408) (-2467.094) [-2458.586] (-2460.298) * (-2464.026) [-2462.609] (-2472.053) (-2471.669) -- 0:06:53
40000 -- [-2463.662] (-2467.805) (-2464.303) (-2461.577) * (-2473.967) [-2465.450] (-2478.277) (-2465.861) -- 0:06:48
Average standard deviation of split frequencies: 0.028980
40500 -- (-2464.793) (-2462.828) [-2474.474] (-2465.744) * (-2471.316) (-2472.714) (-2467.648) [-2467.666] -- 0:06:42
41000 -- [-2469.231] (-2460.071) (-2470.541) (-2465.670) * [-2456.422] (-2457.915) (-2471.823) (-2472.515) -- 0:07:01
41500 -- (-2462.428) (-2463.878) (-2465.696) [-2465.004] * (-2461.771) (-2464.843) (-2467.228) [-2469.115] -- 0:06:55
42000 -- (-2467.115) [-2459.377] (-2467.332) (-2466.057) * [-2461.655] (-2463.704) (-2456.851) (-2468.337) -- 0:06:50
42500 -- (-2460.278) [-2462.701] (-2469.957) (-2465.911) * [-2465.238] (-2471.192) (-2465.660) (-2467.049) -- 0:06:45
43000 -- (-2465.525) [-2465.937] (-2463.286) (-2467.641) * (-2466.612) (-2470.836) [-2461.719] (-2464.451) -- 0:07:02
43500 -- (-2474.370) [-2461.906] (-2464.813) (-2466.707) * [-2460.157] (-2466.645) (-2468.155) (-2471.576) -- 0:06:57
44000 -- (-2461.802) (-2460.434) (-2465.783) [-2461.268] * (-2476.308) [-2461.250] (-2466.794) (-2464.363) -- 0:06:52
44500 -- (-2467.108) (-2465.110) (-2468.508) [-2464.605] * (-2466.510) [-2463.429] (-2461.462) (-2474.120) -- 0:06:47
45000 -- (-2471.507) [-2460.096] (-2464.719) (-2470.519) * (-2478.950) [-2462.876] (-2467.853) (-2477.345) -- 0:06:43
Average standard deviation of split frequencies: 0.036262
45500 -- [-2461.311] (-2468.965) (-2465.005) (-2471.583) * (-2480.061) [-2464.970] (-2461.613) (-2471.927) -- 0:06:59
46000 -- (-2464.904) (-2467.336) [-2462.281] (-2461.335) * [-2470.094] (-2464.320) (-2462.114) (-2468.488) -- 0:06:54
46500 -- [-2461.454] (-2465.220) (-2466.551) (-2464.439) * (-2464.632) (-2462.591) [-2456.490] (-2469.026) -- 0:06:50
47000 -- (-2467.696) (-2466.516) [-2463.696] (-2478.693) * (-2463.040) (-2473.728) (-2464.396) [-2467.564] -- 0:06:45
47500 -- (-2468.876) [-2457.942] (-2467.945) (-2468.779) * (-2463.583) (-2460.687) [-2462.775] (-2460.805) -- 0:06:41
48000 -- (-2468.804) (-2464.161) [-2461.998] (-2477.820) * (-2461.022) (-2459.271) [-2468.516] (-2467.818) -- 0:06:56
48500 -- (-2462.825) [-2464.592] (-2467.207) (-2466.053) * (-2466.742) (-2472.584) [-2469.327] (-2467.356) -- 0:06:51
49000 -- (-2463.478) (-2470.523) [-2466.415] (-2461.191) * [-2460.444] (-2469.335) (-2477.432) (-2466.804) -- 0:06:47
49500 -- [-2463.132] (-2463.889) (-2466.559) (-2466.856) * [-2468.804] (-2466.491) (-2467.468) (-2464.564) -- 0:06:43
50000 -- (-2467.911) [-2459.369] (-2469.224) (-2463.767) * (-2468.298) (-2466.026) [-2476.933] (-2468.700) -- 0:06:58
Average standard deviation of split frequencies: 0.037216
50500 -- [-2466.633] (-2468.584) (-2465.679) (-2465.176) * [-2466.931] (-2471.370) (-2468.007) (-2464.259) -- 0:06:53
51000 -- (-2461.151) (-2470.610) [-2458.209] (-2461.251) * (-2469.147) (-2463.751) (-2470.593) [-2474.875] -- 0:06:49
51500 -- (-2466.461) [-2465.075] (-2469.501) (-2467.982) * [-2463.996] (-2468.583) (-2476.056) (-2464.549) -- 0:06:45
52000 -- (-2465.291) [-2460.905] (-2475.178) (-2462.149) * (-2467.407) [-2471.431] (-2470.056) (-2465.877) -- 0:06:41
52500 -- (-2460.994) (-2464.536) (-2477.493) [-2465.615] * [-2458.972] (-2466.340) (-2474.053) (-2467.185) -- 0:06:55
53000 -- (-2460.627) (-2472.798) (-2481.838) [-2463.457] * (-2466.529) (-2460.392) (-2466.636) [-2466.054] -- 0:06:50
53500 -- (-2463.225) (-2466.020) (-2466.034) [-2462.553] * (-2475.078) [-2461.014] (-2464.368) (-2463.342) -- 0:06:46
54000 -- (-2459.551) (-2462.496) [-2467.627] (-2475.609) * (-2456.330) (-2467.926) (-2462.951) [-2460.898] -- 0:06:42
54500 -- (-2468.900) (-2467.841) [-2469.198] (-2481.116) * [-2457.755] (-2476.655) (-2466.095) (-2463.016) -- 0:06:39
55000 -- (-2461.338) [-2463.089] (-2467.471) (-2475.518) * (-2459.633) (-2469.172) (-2465.719) [-2465.500] -- 0:06:52
Average standard deviation of split frequencies: 0.034319
55500 -- (-2466.421) (-2469.507) (-2467.258) [-2461.647] * (-2467.316) [-2467.597] (-2469.518) (-2461.892) -- 0:06:48
56000 -- [-2471.911] (-2472.857) (-2467.046) (-2464.756) * (-2467.562) [-2466.794] (-2476.572) (-2464.885) -- 0:06:44
56500 -- (-2472.002) (-2463.896) (-2469.964) [-2464.121] * (-2466.794) (-2467.823) [-2467.991] (-2470.585) -- 0:06:40
57000 -- [-2464.415] (-2459.792) (-2464.874) (-2463.066) * (-2466.862) (-2479.767) (-2465.058) [-2470.920] -- 0:06:53
57500 -- (-2460.970) (-2468.107) (-2472.005) [-2462.132] * (-2465.974) (-2471.230) [-2463.669] (-2464.978) -- 0:06:49
58000 -- (-2464.990) [-2464.686] (-2468.987) (-2468.468) * (-2468.376) (-2474.463) (-2459.140) [-2460.580] -- 0:06:46
58500 -- (-2464.282) [-2465.123] (-2466.600) (-2469.482) * (-2468.807) [-2462.491] (-2472.206) (-2460.746) -- 0:06:42
59000 -- (-2463.950) (-2461.935) [-2465.841] (-2473.143) * [-2464.568] (-2469.688) (-2479.000) (-2465.624) -- 0:06:38
59500 -- (-2462.536) [-2464.116] (-2469.298) (-2466.665) * [-2458.657] (-2469.033) (-2475.049) (-2459.167) -- 0:06:50
60000 -- [-2465.141] (-2463.613) (-2465.028) (-2470.082) * (-2459.255) [-2466.981] (-2476.552) (-2468.703) -- 0:06:47
Average standard deviation of split frequencies: 0.030484
60500 -- [-2461.290] (-2470.788) (-2472.360) (-2471.324) * (-2462.746) (-2466.985) (-2472.630) [-2467.002] -- 0:06:43
61000 -- (-2466.829) (-2469.876) [-2463.595] (-2475.554) * (-2468.437) [-2471.083] (-2465.153) (-2463.043) -- 0:06:40
61500 -- (-2463.147) (-2468.052) (-2460.416) [-2462.750] * (-2468.270) [-2470.115] (-2475.564) (-2467.917) -- 0:06:36
62000 -- (-2469.385) (-2467.550) [-2461.490] (-2475.248) * (-2466.557) (-2473.203) [-2460.251] (-2464.517) -- 0:06:48
62500 -- [-2461.415] (-2467.908) (-2463.526) (-2459.721) * [-2457.717] (-2468.473) (-2470.193) (-2471.945) -- 0:06:45
63000 -- (-2468.264) (-2463.300) [-2463.486] (-2472.346) * (-2464.936) (-2464.878) (-2463.633) [-2463.635] -- 0:06:41
63500 -- (-2469.402) (-2473.710) (-2466.536) [-2467.491] * (-2462.999) (-2463.295) [-2466.166] (-2464.988) -- 0:06:38
64000 -- [-2468.567] (-2464.707) (-2464.421) (-2467.240) * (-2464.506) (-2473.411) (-2464.940) [-2464.533] -- 0:06:49
64500 -- (-2470.525) (-2466.723) [-2465.241] (-2459.318) * (-2479.314) (-2467.221) (-2471.721) [-2463.841] -- 0:06:46
65000 -- [-2467.566] (-2469.292) (-2465.296) (-2475.153) * (-2465.130) [-2470.001] (-2467.204) (-2465.911) -- 0:06:42
Average standard deviation of split frequencies: 0.030611
65500 -- (-2467.949) (-2460.482) [-2468.775] (-2466.579) * [-2463.479] (-2481.484) (-2464.862) (-2467.966) -- 0:06:39
66000 -- (-2468.584) (-2460.838) (-2473.763) [-2460.197] * (-2462.452) (-2473.269) [-2466.499] (-2473.172) -- 0:06:36
66500 -- (-2462.807) [-2466.575] (-2471.742) (-2462.761) * (-2476.878) (-2467.709) [-2466.383] (-2462.563) -- 0:06:47
67000 -- [-2464.419] (-2466.791) (-2477.246) (-2471.171) * (-2459.427) (-2469.021) [-2459.518] (-2463.946) -- 0:06:43
67500 -- (-2467.768) (-2478.775) [-2464.376] (-2461.277) * [-2456.313] (-2474.754) (-2461.027) (-2466.969) -- 0:06:40
68000 -- (-2477.458) (-2466.195) [-2461.390] (-2465.237) * (-2466.595) (-2472.343) (-2463.096) [-2459.588] -- 0:06:37
68500 -- (-2467.176) (-2460.960) [-2462.803] (-2466.489) * [-2463.858] (-2475.290) (-2465.689) (-2462.693) -- 0:06:47
69000 -- (-2466.782) (-2465.711) (-2466.030) [-2462.365] * (-2471.225) [-2462.125] (-2462.278) (-2481.003) -- 0:06:44
69500 -- (-2463.604) [-2463.992] (-2476.404) (-2465.653) * (-2466.193) (-2467.712) [-2464.334] (-2464.064) -- 0:06:41
70000 -- (-2469.694) [-2462.071] (-2468.606) (-2468.665) * (-2463.554) (-2460.193) [-2460.440] (-2465.941) -- 0:06:38
Average standard deviation of split frequencies: 0.032748
70500 -- (-2465.093) (-2475.253) (-2467.527) [-2468.523] * (-2461.324) (-2462.398) [-2470.207] (-2467.834) -- 0:06:35
71000 -- (-2461.005) (-2469.246) (-2468.569) [-2469.634] * (-2467.796) (-2470.205) (-2458.666) [-2465.223] -- 0:06:45
71500 -- [-2466.910] (-2471.816) (-2472.491) (-2466.707) * [-2462.003] (-2464.176) (-2457.986) (-2473.808) -- 0:06:42
72000 -- (-2461.754) [-2461.038] (-2464.529) (-2464.162) * (-2462.166) [-2467.570] (-2471.386) (-2462.858) -- 0:06:39
72500 -- (-2462.259) (-2466.758) [-2465.348] (-2474.686) * (-2466.133) (-2473.914) (-2474.382) [-2465.472] -- 0:06:36
73000 -- [-2466.822] (-2463.992) (-2469.022) (-2474.431) * (-2462.965) (-2467.138) [-2469.718] (-2469.297) -- 0:06:33
73500 -- (-2467.142) (-2470.452) [-2460.678] (-2475.055) * (-2462.101) [-2466.679] (-2464.314) (-2479.925) -- 0:06:43
74000 -- (-2470.908) (-2463.273) [-2461.935] (-2463.263) * (-2466.274) (-2465.763) [-2462.894] (-2465.033) -- 0:06:40
74500 -- [-2465.220] (-2478.438) (-2462.562) (-2462.264) * (-2470.423) (-2470.046) [-2459.816] (-2466.159) -- 0:06:37
75000 -- (-2464.139) [-2463.557] (-2467.868) (-2468.989) * (-2467.902) (-2464.653) (-2463.840) [-2464.940] -- 0:06:34
Average standard deviation of split frequencies: 0.024294
75500 -- [-2456.080] (-2467.216) (-2462.467) (-2468.350) * [-2459.824] (-2469.863) (-2469.019) (-2460.288) -- 0:06:44
76000 -- (-2461.106) (-2480.733) [-2472.542] (-2472.521) * [-2466.230] (-2463.276) (-2461.228) (-2467.171) -- 0:06:41
76500 -- [-2458.859] (-2468.171) (-2457.594) (-2463.559) * [-2466.742] (-2464.882) (-2463.133) (-2461.617) -- 0:06:38
77000 -- (-2474.070) [-2461.575] (-2470.298) (-2463.983) * (-2469.410) (-2465.183) (-2462.920) [-2471.494] -- 0:06:35
77500 -- (-2468.907) (-2461.092) [-2459.842] (-2471.244) * (-2478.212) (-2472.708) [-2468.590] (-2480.127) -- 0:06:32
78000 -- (-2476.114) [-2466.466] (-2474.166) (-2468.904) * [-2468.196] (-2466.839) (-2467.027) (-2467.172) -- 0:06:41
78500 -- (-2463.500) [-2468.681] (-2459.390) (-2467.527) * (-2465.863) [-2463.928] (-2466.826) (-2482.337) -- 0:06:39
79000 -- (-2463.507) (-2461.733) [-2462.773] (-2470.370) * [-2459.356] (-2467.685) (-2468.841) (-2463.453) -- 0:06:36
79500 -- (-2464.683) (-2465.690) [-2455.427] (-2472.789) * (-2464.189) [-2467.881] (-2460.737) (-2467.961) -- 0:06:33
80000 -- (-2463.548) (-2460.176) (-2466.856) [-2463.244] * [-2463.300] (-2465.959) (-2473.738) (-2479.256) -- 0:06:42
Average standard deviation of split frequencies: 0.023375
80500 -- [-2470.372] (-2474.636) (-2470.077) (-2465.174) * (-2476.586) (-2464.015) (-2466.902) [-2463.004] -- 0:06:39
81000 -- (-2468.953) (-2457.302) (-2465.185) [-2466.979] * (-2462.913) (-2467.046) (-2464.529) [-2465.527] -- 0:06:37
81500 -- (-2463.621) [-2464.228] (-2458.663) (-2466.527) * (-2472.887) (-2470.758) [-2463.738] (-2464.684) -- 0:06:34
82000 -- (-2459.701) (-2469.826) [-2461.443] (-2467.651) * (-2478.990) [-2465.845] (-2476.556) (-2470.957) -- 0:06:31
82500 -- (-2469.672) (-2474.135) (-2459.630) [-2468.326] * [-2461.198] (-2467.001) (-2466.125) (-2471.830) -- 0:06:40
83000 -- (-2462.190) [-2466.393] (-2461.255) (-2470.589) * (-2465.330) [-2462.706] (-2472.331) (-2466.157) -- 0:06:37
83500 -- (-2474.457) [-2471.026] (-2466.669) (-2464.806) * (-2456.632) (-2469.818) (-2470.538) [-2468.825] -- 0:06:35
84000 -- [-2462.238] (-2464.083) (-2464.410) (-2464.743) * (-2462.508) (-2457.259) [-2462.615] (-2465.502) -- 0:06:32
84500 -- (-2472.440) [-2463.540] (-2465.122) (-2464.027) * (-2475.619) (-2468.644) (-2463.081) [-2469.467] -- 0:06:30
85000 -- [-2465.625] (-2462.641) (-2469.478) (-2470.225) * (-2470.040) (-2464.815) [-2465.258] (-2460.937) -- 0:06:38
Average standard deviation of split frequencies: 0.013704
85500 -- (-2462.548) [-2464.112] (-2469.426) (-2471.234) * (-2469.911) [-2464.335] (-2465.246) (-2460.587) -- 0:06:35
86000 -- (-2467.566) [-2460.207] (-2465.853) (-2466.277) * (-2468.040) (-2460.275) [-2463.482] (-2473.615) -- 0:06:33
86500 -- (-2465.708) (-2456.504) (-2466.761) [-2466.976] * [-2461.539] (-2468.160) (-2461.761) (-2465.872) -- 0:06:30
87000 -- (-2487.285) [-2459.005] (-2474.775) (-2479.412) * (-2460.637) (-2464.330) [-2467.671] (-2474.604) -- 0:06:38
87500 -- (-2480.361) (-2461.559) [-2466.474] (-2468.410) * (-2471.085) [-2470.302] (-2464.508) (-2463.555) -- 0:06:36
88000 -- (-2481.814) [-2462.196] (-2472.390) (-2464.806) * (-2472.615) [-2461.780] (-2466.728) (-2467.353) -- 0:06:33
88500 -- [-2464.569] (-2469.335) (-2469.326) (-2463.500) * (-2472.727) (-2464.511) [-2460.085] (-2471.613) -- 0:06:31
89000 -- (-2460.317) (-2464.029) [-2462.991] (-2470.917) * (-2472.036) (-2468.763) (-2470.220) [-2460.258] -- 0:06:28
89500 -- (-2467.707) [-2466.136] (-2472.483) (-2470.755) * (-2472.037) (-2467.720) (-2474.548) [-2458.109] -- 0:06:36
90000 -- (-2459.614) [-2459.711] (-2465.531) (-2460.853) * (-2468.431) (-2478.606) (-2472.441) [-2471.643] -- 0:06:34
Average standard deviation of split frequencies: 0.014112
90500 -- [-2463.402] (-2470.938) (-2478.912) (-2464.037) * (-2469.243) (-2474.455) [-2462.709] (-2465.108) -- 0:06:31
91000 -- [-2468.836] (-2471.109) (-2468.984) (-2463.042) * (-2476.753) (-2469.183) (-2472.418) [-2467.514] -- 0:06:29
91500 -- [-2464.903] (-2461.677) (-2481.819) (-2467.102) * (-2466.764) (-2465.130) (-2471.705) [-2465.928] -- 0:06:27
92000 -- [-2467.261] (-2470.635) (-2473.178) (-2476.482) * [-2464.491] (-2470.375) (-2463.366) (-2475.774) -- 0:06:34
92500 -- (-2471.295) [-2464.238] (-2468.612) (-2474.697) * (-2464.010) (-2471.646) [-2468.010] (-2472.719) -- 0:06:32
93000 -- (-2466.261) [-2458.224] (-2469.806) (-2471.335) * (-2463.834) [-2467.821] (-2464.547) (-2483.446) -- 0:06:30
93500 -- (-2463.602) [-2468.583] (-2467.267) (-2467.605) * (-2463.999) (-2465.127) [-2463.540] (-2475.485) -- 0:06:27
94000 -- [-2471.582] (-2461.586) (-2464.788) (-2466.858) * [-2461.304] (-2466.082) (-2467.078) (-2469.055) -- 0:06:35
94500 -- (-2465.973) [-2465.385] (-2462.092) (-2466.139) * [-2460.358] (-2466.621) (-2476.359) (-2465.974) -- 0:06:32
95000 -- (-2479.498) (-2466.222) (-2462.369) [-2461.514] * (-2467.959) [-2468.682] (-2476.603) (-2465.624) -- 0:06:30
Average standard deviation of split frequencies: 0.017888
95500 -- [-2462.684] (-2471.624) (-2468.473) (-2465.161) * [-2470.627] (-2466.753) (-2475.721) (-2466.198) -- 0:06:28
96000 -- [-2465.350] (-2469.992) (-2460.874) (-2469.290) * (-2467.301) [-2464.313] (-2466.002) (-2466.326) -- 0:06:26
96500 -- (-2462.242) (-2464.868) (-2461.203) [-2467.135] * (-2462.299) [-2460.993] (-2474.867) (-2470.078) -- 0:06:33
97000 -- (-2473.176) (-2470.102) (-2463.866) [-2467.730] * (-2460.182) (-2468.074) (-2467.508) [-2465.377] -- 0:06:30
97500 -- (-2472.688) (-2467.291) [-2461.562] (-2464.369) * (-2462.823) (-2465.302) (-2480.806) [-2463.231] -- 0:06:28
98000 -- [-2470.597] (-2468.041) (-2464.935) (-2464.123) * (-2461.979) (-2470.033) (-2485.297) [-2462.366] -- 0:06:26
98500 -- (-2464.919) (-2463.243) [-2459.763] (-2464.807) * [-2464.760] (-2467.260) (-2471.359) (-2478.726) -- 0:06:24
99000 -- (-2462.382) [-2465.193] (-2468.338) (-2479.833) * [-2462.637] (-2484.309) (-2464.770) (-2472.474) -- 0:06:31
99500 -- (-2465.182) [-2462.078] (-2466.311) (-2466.224) * (-2465.252) [-2462.472] (-2467.427) (-2473.313) -- 0:06:29
100000 -- (-2461.300) (-2461.904) (-2467.392) [-2468.131] * (-2459.480) (-2473.764) [-2458.912] (-2479.070) -- 0:06:27
Average standard deviation of split frequencies: 0.019066
100500 -- [-2462.932] (-2468.860) (-2467.602) (-2469.178) * (-2465.715) (-2471.195) (-2468.402) [-2466.476] -- 0:06:24
101000 -- (-2463.298) (-2470.166) (-2463.676) [-2468.652] * (-2466.120) [-2471.841] (-2465.041) (-2471.728) -- 0:06:31
101500 -- [-2461.163] (-2466.256) (-2472.111) (-2465.241) * [-2460.765] (-2463.001) (-2471.791) (-2475.503) -- 0:06:29
102000 -- (-2462.364) (-2475.790) (-2462.207) [-2458.371] * (-2463.656) (-2470.287) [-2462.664] (-2472.972) -- 0:06:27
102500 -- [-2464.341] (-2471.140) (-2461.775) (-2463.484) * (-2466.814) [-2473.212] (-2471.515) (-2466.928) -- 0:06:25
103000 -- (-2467.973) [-2473.380] (-2464.820) (-2461.176) * [-2472.882] (-2466.402) (-2466.377) (-2466.820) -- 0:06:23
103500 -- (-2472.767) (-2474.624) [-2459.958] (-2468.024) * (-2466.108) [-2462.045] (-2465.052) (-2473.611) -- 0:06:29
104000 -- (-2470.749) (-2468.250) [-2462.701] (-2461.663) * (-2461.369) (-2468.986) [-2462.075] (-2476.510) -- 0:06:27
104500 -- (-2463.520) (-2461.723) (-2471.704) [-2464.558] * (-2462.084) [-2475.741] (-2467.383) (-2459.715) -- 0:06:25
105000 -- [-2461.025] (-2470.986) (-2467.327) (-2465.620) * (-2463.584) (-2464.274) [-2457.253] (-2469.054) -- 0:06:23
Average standard deviation of split frequencies: 0.019377
105500 -- (-2466.166) (-2471.326) (-2461.666) [-2461.869] * (-2480.617) [-2463.710] (-2462.364) (-2461.971) -- 0:06:21
106000 -- (-2466.622) [-2462.159] (-2462.413) (-2461.748) * (-2469.490) (-2468.564) (-2463.688) [-2465.205] -- 0:06:27
106500 -- (-2471.252) (-2465.507) (-2476.468) [-2458.500] * (-2462.780) (-2460.624) [-2464.008] (-2469.392) -- 0:06:25
107000 -- (-2463.690) (-2470.632) (-2471.001) [-2460.294] * (-2464.162) (-2468.583) (-2467.274) [-2471.089] -- 0:06:23
107500 -- (-2482.073) [-2466.051] (-2478.784) (-2467.956) * (-2466.688) (-2463.206) (-2468.709) [-2472.642] -- 0:06:21
108000 -- [-2467.417] (-2464.654) (-2466.275) (-2470.512) * (-2468.589) [-2463.165] (-2471.572) (-2459.305) -- 0:06:28
108500 -- [-2466.322] (-2469.831) (-2469.242) (-2464.495) * (-2460.319) (-2472.030) (-2465.645) [-2463.608] -- 0:06:26
109000 -- (-2471.356) [-2472.806] (-2464.350) (-2471.924) * (-2468.084) (-2476.137) [-2464.552] (-2465.759) -- 0:06:24
109500 -- (-2461.156) (-2467.960) (-2467.091) [-2466.267] * [-2461.847] (-2467.160) (-2468.182) (-2464.550) -- 0:06:22
110000 -- (-2465.245) [-2468.845] (-2463.813) (-2461.522) * (-2470.078) [-2470.343] (-2466.656) (-2469.180) -- 0:06:20
Average standard deviation of split frequencies: 0.017039
110500 -- (-2455.562) (-2469.110) (-2471.251) [-2465.871] * [-2458.272] (-2473.306) (-2467.207) (-2469.051) -- 0:06:26
111000 -- (-2463.696) [-2459.390] (-2469.036) (-2481.524) * (-2468.166) (-2475.054) [-2466.930] (-2464.255) -- 0:06:24
111500 -- (-2466.536) (-2466.714) (-2465.579) [-2461.031] * (-2467.828) (-2467.236) [-2464.344] (-2467.093) -- 0:06:22
112000 -- [-2456.745] (-2462.318) (-2467.867) (-2474.937) * (-2474.534) [-2463.285] (-2474.953) (-2464.610) -- 0:06:20
112500 -- (-2459.432) [-2465.238] (-2472.944) (-2460.452) * (-2458.620) (-2468.279) (-2466.263) [-2460.556] -- 0:06:18
113000 -- (-2461.291) (-2464.335) (-2461.874) [-2457.357] * (-2468.148) (-2472.929) [-2464.608] (-2470.106) -- 0:06:24
113500 -- (-2459.512) (-2461.171) [-2462.083] (-2477.058) * (-2468.829) (-2465.461) (-2467.574) [-2463.840] -- 0:06:22
114000 -- (-2471.547) (-2461.727) [-2464.583] (-2465.104) * [-2460.957] (-2465.597) (-2466.140) (-2465.099) -- 0:06:20
114500 -- (-2461.763) [-2465.524] (-2466.202) (-2467.757) * (-2465.014) [-2460.453] (-2466.940) (-2480.697) -- 0:06:18
115000 -- (-2464.030) (-2472.232) (-2465.183) [-2465.652] * (-2466.138) [-2461.208] (-2465.152) (-2474.400) -- 0:06:24
Average standard deviation of split frequencies: 0.017126
115500 -- (-2464.831) (-2463.076) (-2464.901) [-2459.951] * (-2464.218) (-2465.100) (-2467.130) [-2466.356] -- 0:06:22
116000 -- (-2466.027) [-2468.748] (-2468.488) (-2464.975) * (-2461.514) [-2465.194] (-2462.156) (-2463.120) -- 0:06:21
116500 -- (-2471.156) (-2460.333) (-2463.747) [-2467.449] * [-2470.899] (-2466.872) (-2460.603) (-2461.996) -- 0:06:19
117000 -- (-2476.979) [-2464.516] (-2466.212) (-2475.542) * [-2465.474] (-2462.853) (-2468.631) (-2465.143) -- 0:06:17
117500 -- (-2470.810) (-2462.048) [-2468.357] (-2471.540) * (-2465.580) (-2469.790) [-2459.720] (-2470.401) -- 0:06:23
118000 -- (-2465.421) (-2475.016) [-2461.438] (-2469.997) * (-2469.595) (-2475.863) [-2468.153] (-2464.890) -- 0:06:21
118500 -- [-2463.793] (-2473.438) (-2458.394) (-2473.880) * (-2465.227) (-2468.435) (-2469.575) [-2459.829] -- 0:06:19
119000 -- (-2462.383) [-2469.147] (-2469.833) (-2471.457) * (-2462.657) (-2467.816) (-2463.061) [-2461.697] -- 0:06:17
119500 -- (-2466.755) (-2460.644) [-2463.919] (-2468.155) * (-2465.352) (-2473.490) (-2459.560) [-2459.546] -- 0:06:15
120000 -- (-2463.365) (-2464.447) (-2463.264) [-2467.097] * (-2472.254) (-2476.218) (-2470.558) [-2457.561] -- 0:06:21
Average standard deviation of split frequencies: 0.020091
120500 -- (-2464.837) (-2469.026) [-2467.214] (-2463.069) * (-2472.414) (-2461.765) (-2463.991) [-2469.170] -- 0:06:19
121000 -- (-2467.314) (-2472.893) (-2467.561) [-2466.825] * [-2462.215] (-2461.688) (-2460.744) (-2468.663) -- 0:06:17
121500 -- [-2475.565] (-2464.796) (-2471.693) (-2468.431) * (-2470.027) (-2469.927) (-2463.633) [-2459.992] -- 0:06:15
122000 -- (-2469.206) [-2465.330] (-2467.596) (-2465.762) * (-2455.747) (-2470.068) [-2467.486] (-2463.709) -- 0:06:21
122500 -- (-2468.792) [-2462.878] (-2462.974) (-2466.206) * [-2466.965] (-2465.320) (-2477.965) (-2461.458) -- 0:06:19
123000 -- (-2461.160) (-2468.421) (-2466.098) [-2460.326] * [-2467.109] (-2467.482) (-2467.719) (-2461.479) -- 0:06:17
123500 -- [-2463.641] (-2464.666) (-2471.706) (-2470.255) * [-2455.544] (-2464.079) (-2473.740) (-2467.143) -- 0:06:16
124000 -- [-2460.158] (-2471.299) (-2476.241) (-2469.912) * (-2470.016) [-2466.659] (-2464.799) (-2479.881) -- 0:06:14
124500 -- (-2469.388) (-2470.516) [-2463.260] (-2466.736) * [-2468.006] (-2464.775) (-2462.884) (-2473.311) -- 0:06:19
125000 -- (-2472.353) [-2465.209] (-2468.390) (-2464.059) * (-2472.590) (-2481.387) [-2461.003] (-2473.605) -- 0:06:18
Average standard deviation of split frequencies: 0.017638
125500 -- (-2477.671) (-2468.803) (-2467.057) [-2471.983] * (-2469.238) [-2457.672] (-2465.200) (-2459.831) -- 0:06:16
126000 -- (-2474.919) (-2475.682) [-2465.852] (-2468.616) * (-2476.695) (-2460.972) [-2457.831] (-2471.130) -- 0:06:14
126500 -- [-2465.914] (-2481.360) (-2472.186) (-2468.176) * (-2467.034) (-2464.732) [-2464.101] (-2469.913) -- 0:06:12
127000 -- (-2466.586) [-2464.663] (-2464.323) (-2463.673) * (-2465.314) (-2460.145) (-2462.454) [-2466.578] -- 0:06:18
127500 -- (-2467.369) [-2469.971] (-2463.652) (-2474.553) * (-2468.233) [-2461.125] (-2467.949) (-2466.359) -- 0:06:16
128000 -- (-2461.232) [-2467.927] (-2469.583) (-2473.661) * (-2471.345) [-2460.730] (-2468.937) (-2467.361) -- 0:06:14
128500 -- (-2468.625) [-2467.985] (-2471.335) (-2477.172) * (-2467.257) [-2463.249] (-2458.244) (-2468.592) -- 0:06:13
129000 -- (-2468.188) [-2468.748] (-2464.825) (-2477.339) * (-2467.903) (-2466.423) [-2466.355] (-2464.207) -- 0:06:18
129500 -- [-2467.066] (-2467.639) (-2470.755) (-2475.362) * (-2463.627) (-2465.471) [-2463.844] (-2462.883) -- 0:06:16
130000 -- (-2470.622) [-2463.851] (-2461.467) (-2485.070) * [-2461.291] (-2467.260) (-2463.365) (-2474.271) -- 0:06:14
Average standard deviation of split frequencies: 0.020358
130500 -- (-2466.793) (-2463.425) [-2463.650] (-2473.958) * [-2459.307] (-2473.332) (-2465.487) (-2468.909) -- 0:06:13
131000 -- (-2466.205) (-2473.794) (-2464.964) [-2465.720] * (-2462.806) [-2479.150] (-2462.741) (-2472.227) -- 0:06:11
131500 -- [-2463.594] (-2468.222) (-2473.816) (-2461.066) * [-2470.545] (-2479.224) (-2464.413) (-2466.838) -- 0:06:16
132000 -- (-2462.891) [-2467.970] (-2469.073) (-2468.094) * (-2469.795) (-2473.462) [-2464.488] (-2469.744) -- 0:06:14
132500 -- (-2461.922) (-2468.557) [-2462.990] (-2471.776) * (-2464.376) (-2476.860) [-2464.533] (-2463.325) -- 0:06:13
133000 -- (-2467.427) [-2458.476] (-2469.209) (-2477.369) * [-2463.534] (-2466.942) (-2463.019) (-2466.456) -- 0:06:11
133500 -- [-2470.924] (-2470.262) (-2468.945) (-2469.578) * [-2462.195] (-2477.081) (-2467.724) (-2466.762) -- 0:06:16
134000 -- (-2469.583) [-2462.012] (-2472.172) (-2470.604) * (-2469.363) (-2468.579) (-2464.070) [-2465.397] -- 0:06:14
134500 -- (-2471.830) [-2468.254] (-2466.129) (-2470.610) * (-2467.873) (-2473.998) [-2463.389] (-2461.317) -- 0:06:13
135000 -- [-2461.693] (-2466.607) (-2467.861) (-2474.017) * (-2463.221) [-2463.984] (-2473.056) (-2483.021) -- 0:06:11
Average standard deviation of split frequencies: 0.022283
135500 -- (-2467.094) [-2462.234] (-2468.415) (-2468.312) * (-2464.210) [-2468.843] (-2463.431) (-2466.697) -- 0:06:10
136000 -- [-2463.742] (-2463.683) (-2462.186) (-2464.029) * (-2467.404) (-2466.867) [-2466.597] (-2466.540) -- 0:06:14
136500 -- [-2470.293] (-2467.085) (-2458.793) (-2473.870) * (-2473.965) (-2465.377) [-2461.887] (-2469.410) -- 0:06:13
137000 -- [-2467.416] (-2460.459) (-2464.812) (-2469.893) * (-2475.039) [-2466.430] (-2466.954) (-2468.138) -- 0:06:11
137500 -- (-2468.968) [-2460.385] (-2466.315) (-2465.636) * (-2465.599) (-2471.025) (-2474.961) [-2461.243] -- 0:06:10
138000 -- [-2460.338] (-2457.785) (-2465.271) (-2467.666) * [-2467.291] (-2471.213) (-2464.920) (-2463.580) -- 0:06:08
138500 -- [-2463.632] (-2483.269) (-2463.346) (-2467.932) * (-2467.699) [-2468.888] (-2461.442) (-2467.386) -- 0:06:13
139000 -- [-2461.084] (-2466.450) (-2464.736) (-2463.576) * [-2458.377] (-2469.794) (-2467.310) (-2470.054) -- 0:06:11
139500 -- (-2472.934) (-2467.850) (-2464.546) [-2460.226] * [-2462.102] (-2471.696) (-2462.653) (-2471.994) -- 0:06:10
140000 -- (-2465.119) (-2462.554) [-2470.044] (-2460.379) * [-2463.990] (-2470.061) (-2471.141) (-2463.934) -- 0:06:08
Average standard deviation of split frequencies: 0.022740
140500 -- (-2469.407) [-2463.009] (-2465.598) (-2476.165) * (-2464.453) [-2464.459] (-2470.196) (-2467.262) -- 0:06:13
141000 -- (-2467.866) [-2466.894] (-2466.034) (-2471.105) * (-2463.877) (-2470.157) (-2463.697) [-2465.049] -- 0:06:11
141500 -- (-2470.774) (-2464.355) [-2470.366] (-2460.030) * (-2465.512) (-2460.540) (-2467.396) [-2466.257] -- 0:06:10
142000 -- [-2459.720] (-2470.015) (-2466.850) (-2464.454) * (-2462.555) (-2466.042) (-2459.700) [-2462.782] -- 0:06:08
142500 -- [-2458.193] (-2473.631) (-2466.328) (-2463.034) * (-2461.744) (-2473.204) (-2459.779) [-2459.988] -- 0:06:07
143000 -- (-2467.194) [-2471.179] (-2460.176) (-2462.571) * (-2463.837) [-2463.099] (-2471.595) (-2467.014) -- 0:06:11
143500 -- [-2465.574] (-2473.573) (-2472.904) (-2462.076) * (-2464.491) [-2465.305] (-2467.149) (-2461.020) -- 0:06:10
144000 -- (-2471.744) (-2465.720) [-2467.326] (-2471.208) * [-2462.106] (-2466.632) (-2460.703) (-2467.814) -- 0:06:08
144500 -- [-2463.989] (-2466.699) (-2465.836) (-2465.967) * (-2461.472) [-2466.225] (-2466.474) (-2461.741) -- 0:06:07
145000 -- (-2466.181) (-2464.704) [-2464.522] (-2469.844) * [-2457.699] (-2463.102) (-2469.455) (-2474.155) -- 0:06:05
Average standard deviation of split frequencies: 0.022371
145500 -- (-2463.939) (-2476.305) [-2460.929] (-2469.549) * [-2463.511] (-2468.423) (-2467.484) (-2476.441) -- 0:06:09
146000 -- [-2461.718] (-2464.806) (-2462.225) (-2469.952) * [-2459.185] (-2459.225) (-2463.341) (-2465.778) -- 0:06:08
146500 -- [-2466.540] (-2475.193) (-2464.030) (-2478.324) * (-2469.454) (-2470.030) [-2460.017] (-2462.636) -- 0:06:07
147000 -- (-2472.944) (-2470.909) (-2476.362) [-2467.028] * [-2469.668] (-2471.306) (-2460.197) (-2468.764) -- 0:06:05
147500 -- (-2467.177) (-2461.504) (-2464.163) [-2469.488] * (-2464.409) [-2460.598] (-2469.385) (-2470.823) -- 0:06:09
148000 -- (-2463.680) (-2459.779) [-2468.730] (-2467.628) * [-2463.545] (-2466.579) (-2464.531) (-2465.208) -- 0:06:08
148500 -- (-2461.221) (-2466.002) (-2472.611) [-2466.532] * [-2458.592] (-2470.595) (-2467.695) (-2459.881) -- 0:06:06
149000 -- (-2467.355) (-2463.959) [-2466.872] (-2475.970) * [-2459.634] (-2468.095) (-2464.897) (-2467.784) -- 0:06:05
149500 -- (-2460.623) (-2465.669) [-2464.855] (-2461.451) * (-2466.459) [-2459.576] (-2466.021) (-2470.207) -- 0:06:04
150000 -- (-2466.295) [-2461.434] (-2465.714) (-2463.835) * [-2466.329] (-2463.626) (-2461.649) (-2468.689) -- 0:06:08
Average standard deviation of split frequencies: 0.021902
150500 -- (-2464.043) (-2464.730) (-2470.046) [-2468.356] * [-2460.612] (-2468.038) (-2463.445) (-2465.393) -- 0:06:06
151000 -- (-2468.106) [-2470.572] (-2469.586) (-2464.732) * (-2473.639) (-2465.113) [-2462.518] (-2467.910) -- 0:06:05
151500 -- (-2466.302) (-2463.552) (-2466.659) [-2464.153] * (-2465.893) (-2466.808) (-2465.934) [-2467.001] -- 0:06:04
152000 -- (-2463.081) (-2475.327) [-2465.677] (-2459.484) * (-2463.598) (-2466.999) (-2466.266) [-2451.813] -- 0:06:02
152500 -- (-2470.158) [-2456.922] (-2470.999) (-2467.530) * [-2457.002] (-2468.874) (-2471.042) (-2462.891) -- 0:06:06
153000 -- (-2466.669) [-2466.447] (-2465.980) (-2476.392) * (-2460.765) (-2471.948) (-2465.747) [-2459.366] -- 0:06:05
153500 -- (-2466.280) (-2458.921) [-2461.154] (-2465.601) * [-2463.642] (-2463.462) (-2466.882) (-2462.049) -- 0:06:03
154000 -- (-2465.426) (-2467.369) (-2466.321) [-2465.345] * (-2463.230) (-2462.129) [-2461.921] (-2464.455) -- 0:06:02
154500 -- (-2469.844) [-2467.587] (-2471.893) (-2462.768) * (-2469.105) (-2466.650) (-2465.592) [-2459.826] -- 0:06:06
155000 -- (-2471.155) [-2467.110] (-2467.423) (-2465.761) * (-2471.320) [-2462.506] (-2460.690) (-2470.234) -- 0:06:05
Average standard deviation of split frequencies: 0.018347
155500 -- (-2474.450) (-2470.115) [-2465.602] (-2464.550) * (-2470.089) [-2461.251] (-2463.843) (-2468.857) -- 0:06:03
156000 -- (-2469.466) [-2458.400] (-2480.382) (-2464.802) * (-2462.026) [-2461.385] (-2464.883) (-2469.374) -- 0:06:02
156500 -- (-2465.268) (-2460.466) (-2464.156) [-2465.285] * (-2466.761) [-2457.255] (-2461.228) (-2465.140) -- 0:06:01
157000 -- [-2460.699] (-2466.572) (-2474.236) (-2470.486) * (-2459.710) (-2472.296) (-2465.884) [-2466.831] -- 0:06:05
157500 -- (-2468.928) (-2476.159) (-2481.623) [-2472.615] * [-2462.256] (-2471.587) (-2468.487) (-2474.046) -- 0:06:03
158000 -- (-2463.435) (-2472.245) [-2471.891] (-2466.064) * (-2460.751) (-2471.102) [-2464.199] (-2470.478) -- 0:06:02
158500 -- (-2475.870) (-2467.437) [-2474.372] (-2472.288) * (-2472.177) (-2463.563) (-2479.420) [-2461.739] -- 0:06:01
159000 -- (-2469.133) (-2461.656) (-2465.968) [-2462.617] * (-2469.305) [-2465.101] (-2471.944) (-2461.734) -- 0:05:59
159500 -- (-2475.250) (-2463.471) [-2467.671] (-2473.084) * [-2465.682] (-2460.738) (-2462.370) (-2456.908) -- 0:06:03
160000 -- (-2479.954) (-2470.857) [-2467.193] (-2464.818) * (-2477.070) [-2461.117] (-2467.524) (-2463.568) -- 0:06:02
Average standard deviation of split frequencies: 0.018233
160500 -- (-2477.402) (-2468.088) [-2469.755] (-2475.993) * (-2467.721) (-2471.478) [-2467.958] (-2472.368) -- 0:06:00
161000 -- (-2478.900) (-2469.468) [-2464.264] (-2465.393) * (-2471.160) (-2479.648) (-2461.810) [-2459.765] -- 0:05:59
161500 -- (-2469.400) (-2463.246) (-2466.391) [-2465.491] * (-2460.482) (-2464.078) [-2469.048] (-2464.854) -- 0:06:03
162000 -- (-2468.835) [-2463.449] (-2463.303) (-2473.195) * (-2465.314) [-2462.600] (-2473.966) (-2466.126) -- 0:06:02
162500 -- (-2469.539) [-2457.279] (-2468.116) (-2478.292) * (-2465.731) [-2460.314] (-2463.781) (-2463.802) -- 0:06:00
163000 -- (-2463.465) [-2462.350] (-2463.337) (-2464.364) * (-2464.632) (-2463.649) [-2462.057] (-2457.394) -- 0:05:59
163500 -- (-2461.429) (-2466.844) [-2462.890] (-2463.364) * [-2465.856] (-2467.847) (-2472.795) (-2462.855) -- 0:05:58
164000 -- (-2469.500) (-2461.845) [-2463.808] (-2471.193) * (-2473.533) [-2468.452] (-2469.004) (-2461.321) -- 0:06:01
164500 -- [-2463.278] (-2470.498) (-2463.319) (-2463.131) * (-2471.607) [-2467.882] (-2462.984) (-2461.466) -- 0:06:00
165000 -- [-2467.000] (-2471.196) (-2472.546) (-2471.814) * (-2460.923) (-2467.122) (-2464.985) [-2459.469] -- 0:05:59
Average standard deviation of split frequencies: 0.016227
165500 -- [-2468.795] (-2467.189) (-2474.863) (-2466.154) * (-2474.900) (-2469.116) (-2465.656) [-2461.467] -- 0:05:58
166000 -- (-2467.945) (-2463.320) (-2471.566) [-2467.297] * (-2464.037) [-2475.027] (-2470.148) (-2460.040) -- 0:05:56
166500 -- (-2478.080) (-2464.307) (-2475.118) [-2466.048] * (-2472.271) (-2465.321) (-2464.473) [-2460.989] -- 0:06:00
167000 -- (-2468.798) (-2469.329) [-2462.628] (-2462.717) * (-2467.386) (-2462.239) (-2467.277) [-2460.914] -- 0:05:59
167500 -- (-2471.474) [-2468.392] (-2462.221) (-2468.543) * (-2467.918) [-2463.767] (-2458.815) (-2466.911) -- 0:05:57
168000 -- (-2471.286) [-2461.933] (-2460.363) (-2464.193) * (-2468.609) (-2467.743) (-2468.863) [-2468.990] -- 0:05:56
168500 -- (-2477.307) (-2476.769) (-2465.152) [-2466.138] * [-2460.963] (-2477.482) (-2460.583) (-2466.795) -- 0:06:00
169000 -- (-2476.533) (-2469.745) [-2458.025] (-2469.952) * (-2461.588) [-2468.064] (-2464.122) (-2470.796) -- 0:05:58
169500 -- (-2474.118) [-2465.856] (-2469.212) (-2465.376) * (-2472.717) (-2465.533) [-2465.916] (-2465.810) -- 0:05:57
170000 -- [-2465.218] (-2463.559) (-2462.683) (-2462.944) * (-2464.952) [-2469.314] (-2465.961) (-2464.173) -- 0:05:56
Average standard deviation of split frequencies: 0.017362
170500 -- (-2467.433) (-2470.341) (-2488.460) [-2455.499] * (-2476.573) (-2468.332) (-2465.033) [-2458.527] -- 0:05:55
171000 -- (-2458.961) (-2475.394) [-2462.716] (-2459.027) * (-2460.018) (-2460.471) [-2458.139] (-2460.580) -- 0:05:58
171500 -- (-2467.706) (-2468.004) (-2466.373) [-2460.874] * (-2460.633) [-2467.358] (-2466.029) (-2469.519) -- 0:05:57
172000 -- (-2475.652) [-2471.054] (-2464.441) (-2460.938) * (-2467.058) (-2474.645) [-2465.117] (-2468.438) -- 0:05:56
172500 -- (-2468.150) (-2472.875) (-2472.297) [-2462.505] * (-2466.952) (-2469.240) [-2461.053] (-2464.249) -- 0:05:54
173000 -- (-2467.000) (-2458.826) (-2464.357) [-2460.279] * (-2470.631) (-2476.961) (-2469.177) [-2462.305] -- 0:05:53
173500 -- (-2460.674) [-2467.268] (-2465.126) (-2472.633) * (-2467.152) [-2466.295] (-2461.113) (-2467.584) -- 0:05:57
174000 -- (-2463.230) [-2461.976] (-2477.497) (-2459.527) * [-2468.472] (-2469.320) (-2477.257) (-2463.912) -- 0:05:56
174500 -- [-2464.576] (-2466.033) (-2464.657) (-2470.359) * (-2467.013) [-2460.268] (-2465.135) (-2472.060) -- 0:05:54
175000 -- (-2467.653) [-2465.075] (-2458.745) (-2477.747) * [-2468.589] (-2468.347) (-2462.904) (-2458.662) -- 0:05:53
Average standard deviation of split frequencies: 0.017513
175500 -- (-2467.477) (-2466.351) [-2459.506] (-2465.610) * (-2477.010) (-2458.299) [-2469.952] (-2472.253) -- 0:05:57
176000 -- (-2461.790) (-2466.806) [-2463.097] (-2484.638) * (-2480.332) (-2463.288) (-2474.191) [-2467.521] -- 0:05:55
176500 -- (-2466.763) (-2468.304) (-2468.491) [-2467.011] * (-2469.422) [-2465.111] (-2471.965) (-2462.365) -- 0:05:54
177000 -- (-2461.349) [-2464.016] (-2467.341) (-2469.670) * (-2460.215) [-2465.466] (-2467.728) (-2472.856) -- 0:05:53
177500 -- (-2464.123) [-2461.241] (-2461.858) (-2466.923) * (-2461.090) (-2463.653) (-2471.384) [-2472.588] -- 0:05:52
178000 -- (-2460.301) (-2468.820) (-2465.163) [-2463.913] * [-2467.172] (-2461.394) (-2473.976) (-2466.737) -- 0:05:55
178500 -- (-2466.614) [-2460.145] (-2464.453) (-2465.715) * (-2459.003) (-2466.866) [-2477.506] (-2468.662) -- 0:05:54
179000 -- [-2463.933] (-2472.082) (-2467.175) (-2465.241) * (-2461.402) [-2462.280] (-2470.241) (-2463.577) -- 0:05:53
179500 -- (-2467.011) (-2466.592) (-2469.077) [-2469.304] * [-2468.585] (-2470.688) (-2469.025) (-2458.628) -- 0:05:51
180000 -- (-2476.838) [-2471.254] (-2467.458) (-2469.226) * (-2477.259) (-2468.125) (-2464.493) [-2461.760] -- 0:05:50
Average standard deviation of split frequencies: 0.015656
180500 -- (-2466.555) (-2476.888) (-2465.792) [-2468.188] * (-2470.047) (-2476.490) [-2466.543] (-2458.885) -- 0:05:54
181000 -- [-2463.390] (-2485.901) (-2470.119) (-2464.052) * (-2463.688) [-2469.069] (-2478.108) (-2464.543) -- 0:05:52
181500 -- (-2462.131) (-2474.436) (-2475.947) [-2470.037] * (-2467.499) (-2467.582) (-2469.184) [-2466.194] -- 0:05:51
182000 -- [-2464.325] (-2463.554) (-2469.960) (-2466.518) * (-2473.400) (-2466.596) (-2466.592) [-2470.531] -- 0:05:50
182500 -- (-2470.702) (-2466.671) (-2466.170) [-2465.631] * (-2470.247) (-2460.410) [-2466.307] (-2466.384) -- 0:05:53
183000 -- (-2465.265) (-2476.070) [-2460.680] (-2462.746) * (-2465.857) (-2466.562) (-2464.614) [-2467.004] -- 0:05:52
183500 -- (-2466.092) (-2472.776) [-2459.228] (-2463.529) * (-2462.923) [-2471.915] (-2465.872) (-2467.880) -- 0:05:51
184000 -- (-2467.228) (-2473.156) [-2467.126] (-2462.314) * (-2467.382) (-2476.393) [-2471.072] (-2465.396) -- 0:05:50
184500 -- [-2459.198] (-2475.639) (-2480.281) (-2461.585) * [-2461.758] (-2467.675) (-2465.474) (-2465.204) -- 0:05:49
185000 -- (-2459.943) [-2464.905] (-2464.878) (-2465.959) * (-2461.461) (-2463.854) (-2467.823) [-2474.729] -- 0:05:52
Average standard deviation of split frequencies: 0.015597
185500 -- (-2460.554) (-2475.973) [-2465.699] (-2463.498) * (-2472.427) (-2468.133) [-2462.788] (-2480.173) -- 0:05:51
186000 -- [-2464.798] (-2467.946) (-2460.327) (-2463.287) * (-2467.872) (-2471.228) (-2469.489) [-2464.638] -- 0:05:50
186500 -- (-2470.085) [-2460.993] (-2465.114) (-2463.966) * (-2472.245) (-2470.834) (-2467.881) [-2467.824] -- 0:05:48
187000 -- (-2465.910) [-2460.428] (-2458.905) (-2469.410) * [-2467.172] (-2477.696) (-2467.256) (-2467.881) -- 0:05:52
187500 -- (-2461.523) [-2468.503] (-2463.231) (-2460.880) * (-2465.981) (-2485.752) [-2468.310] (-2469.969) -- 0:05:51
188000 -- (-2470.070) (-2461.922) (-2471.692) [-2456.116] * (-2463.445) (-2473.654) (-2463.591) [-2464.707] -- 0:05:49
188500 -- (-2467.282) [-2458.957] (-2466.174) (-2463.331) * [-2468.627] (-2467.919) (-2485.534) (-2468.367) -- 0:05:48
189000 -- [-2459.835] (-2463.848) (-2464.150) (-2476.349) * (-2470.007) (-2468.553) [-2466.527] (-2466.211) -- 0:05:47
189500 -- (-2464.803) (-2470.180) [-2463.847] (-2466.234) * (-2463.650) (-2464.417) (-2465.050) [-2462.570] -- 0:05:50
190000 -- (-2471.497) (-2461.396) [-2468.481] (-2462.522) * (-2460.181) (-2466.126) [-2461.777] (-2465.585) -- 0:05:49
Average standard deviation of split frequencies: 0.015595
190500 -- (-2469.398) [-2462.867] (-2480.126) (-2476.630) * (-2474.011) [-2457.945] (-2462.221) (-2465.528) -- 0:05:48
191000 -- (-2464.800) (-2466.571) (-2461.768) [-2464.304] * [-2461.752] (-2462.702) (-2463.788) (-2466.419) -- 0:05:47
191500 -- (-2469.051) [-2460.061] (-2461.428) (-2464.815) * (-2466.230) (-2464.467) (-2484.658) [-2460.177] -- 0:05:46
192000 -- [-2461.239] (-2469.268) (-2466.502) (-2469.684) * [-2463.231] (-2465.717) (-2466.222) (-2464.416) -- 0:05:49
192500 -- [-2466.577] (-2466.117) (-2471.375) (-2467.112) * (-2471.758) [-2466.027] (-2467.103) (-2466.854) -- 0:05:48
193000 -- [-2458.368] (-2461.989) (-2467.980) (-2469.345) * (-2461.341) [-2467.638] (-2459.200) (-2467.713) -- 0:05:47
193500 -- [-2469.498] (-2476.237) (-2475.886) (-2469.837) * (-2472.940) (-2463.359) (-2465.445) [-2464.360] -- 0:05:45
194000 -- (-2469.945) [-2465.083] (-2464.949) (-2463.868) * (-2463.128) (-2464.368) (-2468.515) [-2467.120] -- 0:05:48
194500 -- (-2472.572) (-2471.721) (-2478.321) [-2467.268] * (-2471.166) (-2459.587) (-2473.299) [-2467.359] -- 0:05:47
195000 -- (-2472.344) [-2456.070] (-2464.963) (-2463.313) * (-2469.320) (-2469.126) [-2464.248] (-2459.988) -- 0:05:46
Average standard deviation of split frequencies: 0.015290
195500 -- (-2463.335) (-2463.295) (-2465.504) [-2469.402] * (-2466.939) (-2472.077) [-2465.010] (-2463.123) -- 0:05:45
196000 -- (-2468.120) [-2460.444] (-2461.313) (-2465.301) * (-2461.558) (-2467.682) [-2462.232] (-2472.227) -- 0:05:44
196500 -- (-2459.296) (-2470.022) [-2460.072] (-2474.605) * (-2469.898) [-2464.768] (-2461.406) (-2471.122) -- 0:05:47
197000 -- [-2462.162] (-2470.094) (-2464.896) (-2466.976) * [-2459.644] (-2478.957) (-2466.811) (-2476.599) -- 0:05:46
197500 -- [-2462.077] (-2473.195) (-2465.229) (-2469.443) * (-2462.192) (-2489.468) [-2467.797] (-2475.632) -- 0:05:45
198000 -- (-2462.748) (-2473.348) [-2461.625] (-2461.507) * [-2466.323] (-2478.728) (-2461.899) (-2464.407) -- 0:05:44
198500 -- (-2462.753) (-2464.253) (-2468.228) [-2466.014] * (-2466.700) (-2466.879) (-2463.511) [-2466.553] -- 0:05:43
199000 -- (-2461.387) [-2464.118] (-2463.535) (-2469.239) * (-2467.562) [-2464.349] (-2469.280) (-2463.756) -- 0:05:46
199500 -- (-2458.409) (-2465.150) [-2457.385] (-2468.271) * (-2465.846) (-2472.851) [-2460.328] (-2460.685) -- 0:05:45
200000 -- [-2459.799] (-2472.889) (-2469.759) (-2472.790) * (-2464.420) [-2458.766] (-2464.114) (-2461.242) -- 0:05:44
Average standard deviation of split frequencies: 0.017167
200500 -- [-2457.166] (-2466.156) (-2468.552) (-2467.618) * (-2464.118) (-2470.924) (-2462.718) [-2457.920] -- 0:05:42
201000 -- [-2459.114] (-2470.904) (-2467.427) (-2467.531) * [-2465.917] (-2477.067) (-2458.297) (-2471.086) -- 0:05:45
201500 -- (-2468.337) (-2466.882) [-2466.221] (-2467.779) * (-2469.598) (-2474.658) (-2469.184) [-2461.301] -- 0:05:44
202000 -- (-2476.693) (-2468.693) (-2463.546) [-2465.601] * (-2461.766) (-2469.237) (-2464.262) [-2462.010] -- 0:05:43
202500 -- (-2463.480) [-2470.402] (-2465.034) (-2465.963) * (-2470.744) (-2465.399) [-2461.136] (-2461.622) -- 0:05:42
203000 -- [-2462.568] (-2471.455) (-2463.588) (-2461.310) * [-2465.126] (-2470.309) (-2467.258) (-2459.344) -- 0:05:41
203500 -- [-2467.819] (-2464.248) (-2465.648) (-2472.838) * [-2464.084] (-2464.607) (-2468.578) (-2462.769) -- 0:05:44
204000 -- (-2471.820) (-2466.382) (-2459.502) [-2461.726] * [-2464.550] (-2463.100) (-2461.021) (-2467.585) -- 0:05:43
204500 -- (-2461.773) (-2468.387) [-2459.911] (-2461.796) * (-2466.058) (-2468.161) [-2468.442] (-2467.192) -- 0:05:42
205000 -- [-2465.027] (-2464.738) (-2469.995) (-2463.792) * (-2471.923) [-2458.874] (-2472.743) (-2475.390) -- 0:05:41
Average standard deviation of split frequencies: 0.016195
205500 -- (-2468.865) (-2465.634) [-2459.750] (-2468.622) * (-2464.838) [-2463.608] (-2472.891) (-2466.591) -- 0:05:40
206000 -- (-2461.786) (-2471.674) [-2461.597] (-2466.610) * [-2469.051] (-2475.382) (-2465.339) (-2460.945) -- 0:05:43
206500 -- [-2459.803] (-2473.826) (-2458.037) (-2472.782) * [-2464.532] (-2470.454) (-2467.174) (-2467.698) -- 0:05:41
207000 -- (-2465.939) (-2471.233) [-2461.400] (-2482.331) * [-2466.199] (-2469.986) (-2471.197) (-2467.910) -- 0:05:40
207500 -- (-2470.456) (-2463.864) [-2457.748] (-2475.303) * [-2466.868] (-2475.351) (-2462.120) (-2465.782) -- 0:05:39
208000 -- [-2472.551] (-2472.296) (-2464.287) (-2469.784) * [-2461.297] (-2471.077) (-2473.545) (-2463.173) -- 0:05:42
208500 -- [-2465.704] (-2472.361) (-2471.210) (-2469.150) * (-2466.228) (-2461.896) (-2476.940) [-2466.891] -- 0:05:41
209000 -- (-2471.771) (-2468.771) (-2473.699) [-2466.267] * (-2474.526) (-2466.022) [-2459.057] (-2467.314) -- 0:05:40
209500 -- (-2480.252) (-2462.892) [-2464.349] (-2477.316) * (-2474.347) [-2467.479] (-2472.211) (-2465.946) -- 0:05:39
210000 -- [-2464.445] (-2470.331) (-2467.654) (-2463.073) * (-2466.568) [-2461.782] (-2474.632) (-2460.288) -- 0:05:38
Average standard deviation of split frequencies: 0.016524
210500 -- (-2469.204) [-2467.118] (-2459.924) (-2466.262) * (-2465.332) [-2466.151] (-2472.867) (-2467.480) -- 0:05:41
211000 -- (-2464.327) (-2472.482) (-2464.558) [-2459.553] * (-2471.344) [-2474.219] (-2468.275) (-2466.851) -- 0:05:40
211500 -- (-2466.627) (-2464.791) [-2462.295] (-2460.996) * (-2460.402) (-2481.277) [-2466.569] (-2465.443) -- 0:05:39
212000 -- (-2470.517) (-2462.110) (-2459.054) [-2462.222] * [-2468.211] (-2468.413) (-2470.239) (-2464.826) -- 0:05:38
212500 -- [-2465.082] (-2464.473) (-2468.622) (-2467.444) * (-2462.644) (-2481.896) (-2470.837) [-2462.882] -- 0:05:37
213000 -- (-2463.392) (-2471.937) [-2462.963] (-2477.774) * (-2460.283) (-2477.710) [-2461.205] (-2468.482) -- 0:05:39
213500 -- [-2470.337] (-2466.076) (-2472.801) (-2483.921) * (-2464.772) (-2475.919) [-2467.063] (-2463.968) -- 0:05:38
214000 -- (-2464.639) [-2476.623] (-2473.596) (-2473.498) * (-2463.832) (-2462.203) (-2468.543) [-2469.829] -- 0:05:37
214500 -- [-2462.011] (-2463.288) (-2471.395) (-2461.318) * (-2464.335) (-2467.022) (-2474.572) [-2467.068] -- 0:05:36
215000 -- (-2468.304) (-2462.012) [-2461.180] (-2468.553) * (-2472.030) (-2469.846) (-2473.580) [-2467.597] -- 0:05:39
Average standard deviation of split frequencies: 0.017963
215500 -- (-2458.126) (-2467.121) [-2468.576] (-2468.201) * [-2461.448] (-2461.429) (-2466.538) (-2467.572) -- 0:05:38
216000 -- (-2460.589) [-2468.562] (-2466.189) (-2466.267) * (-2463.456) (-2469.375) (-2471.815) [-2461.287] -- 0:05:37
216500 -- (-2467.557) (-2463.654) [-2465.107] (-2465.150) * (-2464.409) (-2467.604) [-2475.526] (-2463.943) -- 0:05:36
217000 -- [-2464.244] (-2468.745) (-2464.199) (-2466.730) * (-2472.103) (-2470.607) [-2467.597] (-2463.565) -- 0:05:35
217500 -- (-2466.635) (-2465.515) [-2464.642] (-2463.334) * [-2463.172] (-2461.815) (-2465.081) (-2469.215) -- 0:05:38
218000 -- [-2459.470] (-2466.136) (-2463.924) (-2471.995) * (-2462.437) (-2462.891) (-2474.727) [-2466.395] -- 0:05:37
218500 -- (-2468.052) (-2468.218) [-2467.984] (-2469.054) * [-2460.547] (-2465.530) (-2476.620) (-2462.971) -- 0:05:36
219000 -- [-2465.550] (-2464.153) (-2465.029) (-2464.827) * [-2464.031] (-2457.424) (-2465.008) (-2468.588) -- 0:05:35
219500 -- (-2471.199) (-2463.435) (-2467.267) [-2467.584] * (-2462.374) [-2463.584] (-2472.140) (-2469.703) -- 0:05:34
220000 -- (-2472.687) (-2469.712) (-2463.092) [-2460.616] * (-2464.305) [-2468.576] (-2474.971) (-2462.080) -- 0:05:36
Average standard deviation of split frequencies: 0.015310
220500 -- (-2461.201) (-2473.973) [-2464.701] (-2465.249) * [-2474.984] (-2477.815) (-2469.911) (-2463.914) -- 0:05:35
221000 -- (-2470.356) (-2467.364) [-2461.147] (-2466.063) * [-2464.633] (-2467.727) (-2463.375) (-2474.168) -- 0:05:34
221500 -- [-2463.731] (-2479.527) (-2466.662) (-2466.867) * (-2470.159) (-2464.907) [-2464.490] (-2469.014) -- 0:05:33
222000 -- (-2468.712) (-2472.857) (-2465.712) [-2466.399] * (-2467.332) [-2460.730] (-2481.374) (-2461.454) -- 0:05:36
222500 -- [-2464.128] (-2468.390) (-2475.416) (-2482.318) * (-2461.358) [-2466.601] (-2467.821) (-2466.224) -- 0:05:35
223000 -- (-2476.412) (-2472.304) (-2460.899) [-2465.071] * (-2463.697) [-2462.893] (-2462.532) (-2460.801) -- 0:05:34
223500 -- (-2466.052) (-2463.568) [-2465.083] (-2481.281) * [-2463.496] (-2462.188) (-2477.700) (-2467.302) -- 0:05:33
224000 -- (-2468.686) (-2460.225) [-2461.356] (-2461.280) * (-2461.213) [-2461.965] (-2468.697) (-2471.950) -- 0:05:32
224500 -- [-2461.482] (-2457.637) (-2469.691) (-2466.990) * [-2468.543] (-2460.506) (-2463.269) (-2469.780) -- 0:05:35
225000 -- (-2475.154) [-2461.292] (-2470.330) (-2462.899) * [-2462.406] (-2469.144) (-2472.951) (-2470.772) -- 0:05:34
Average standard deviation of split frequencies: 0.014601
225500 -- (-2471.673) [-2459.763] (-2470.206) (-2468.989) * (-2458.888) (-2457.108) [-2467.596] (-2466.938) -- 0:05:33
226000 -- [-2460.570] (-2470.070) (-2464.512) (-2458.459) * (-2463.170) (-2464.097) (-2471.461) [-2463.372] -- 0:05:32
226500 -- (-2459.488) (-2468.000) [-2461.271] (-2466.228) * (-2465.039) (-2469.565) [-2477.696] (-2471.980) -- 0:05:31
227000 -- (-2462.487) (-2471.192) (-2461.314) [-2468.773] * (-2468.733) (-2467.603) (-2465.962) [-2463.773] -- 0:05:33
227500 -- (-2471.750) (-2467.487) [-2463.132] (-2459.600) * [-2459.877] (-2468.168) (-2469.322) (-2465.600) -- 0:05:32
228000 -- [-2463.212] (-2469.727) (-2468.698) (-2477.034) * [-2461.251] (-2461.016) (-2472.725) (-2469.697) -- 0:05:31
228500 -- (-2461.876) [-2461.986] (-2476.894) (-2466.094) * (-2460.087) [-2461.441] (-2475.621) (-2480.396) -- 0:05:30
229000 -- (-2470.089) (-2464.160) [-2463.578] (-2466.081) * (-2464.871) (-2468.544) [-2471.242] (-2468.660) -- 0:05:33
229500 -- (-2459.120) (-2455.564) [-2466.385] (-2462.155) * (-2463.887) (-2466.967) (-2476.478) [-2464.837] -- 0:05:32
230000 -- (-2469.467) (-2475.982) [-2459.448] (-2466.040) * [-2459.564] (-2464.412) (-2468.176) (-2463.792) -- 0:05:31
Average standard deviation of split frequencies: 0.011751
230500 -- [-2462.473] (-2477.540) (-2466.094) (-2466.938) * [-2470.361] (-2469.944) (-2468.096) (-2468.063) -- 0:05:30
231000 -- (-2462.931) (-2483.763) [-2467.177] (-2466.188) * [-2469.819] (-2468.553) (-2475.111) (-2461.220) -- 0:05:29
231500 -- (-2469.683) (-2460.186) [-2471.137] (-2459.162) * (-2469.757) (-2463.477) [-2465.991] (-2459.060) -- 0:05:31
232000 -- (-2474.920) [-2457.857] (-2477.375) (-2467.751) * (-2477.949) [-2465.875] (-2466.200) (-2460.691) -- 0:05:31
232500 -- (-2462.710) [-2460.387] (-2469.088) (-2467.386) * [-2473.589] (-2463.595) (-2471.564) (-2463.026) -- 0:05:30
233000 -- (-2468.001) (-2460.963) [-2461.528] (-2468.939) * (-2466.653) (-2464.442) [-2471.828] (-2462.912) -- 0:05:29
233500 -- (-2467.223) (-2463.036) [-2468.864] (-2471.218) * (-2463.613) (-2468.454) [-2472.996] (-2470.731) -- 0:05:28
234000 -- (-2464.321) [-2465.073] (-2465.984) (-2467.389) * [-2460.038] (-2473.120) (-2473.221) (-2475.666) -- 0:05:30
234500 -- (-2469.369) (-2468.052) (-2464.442) [-2462.570] * [-2460.189] (-2468.595) (-2465.668) (-2483.191) -- 0:05:29
235000 -- (-2473.727) [-2467.350] (-2465.353) (-2470.212) * [-2468.090] (-2470.713) (-2468.141) (-2471.152) -- 0:05:28
Average standard deviation of split frequencies: 0.010154
235500 -- (-2468.956) (-2468.271) (-2461.032) [-2465.221] * [-2463.777] (-2462.705) (-2483.556) (-2473.528) -- 0:05:27
236000 -- (-2459.637) (-2466.545) (-2478.926) [-2467.006] * (-2467.173) [-2466.562] (-2481.525) (-2469.575) -- 0:05:30
236500 -- (-2457.160) (-2468.923) (-2463.339) [-2459.520] * (-2468.618) [-2462.837] (-2469.716) (-2465.345) -- 0:05:29
237000 -- (-2457.869) (-2468.102) (-2466.517) [-2467.713] * (-2459.615) (-2466.981) (-2472.151) [-2469.911] -- 0:05:28
237500 -- (-2473.895) [-2463.342] (-2464.041) (-2468.228) * [-2461.944] (-2458.229) (-2473.421) (-2467.019) -- 0:05:27
238000 -- (-2464.129) (-2464.637) (-2454.556) [-2459.823] * (-2459.127) (-2466.503) [-2466.433] (-2473.860) -- 0:05:26
238500 -- (-2460.415) (-2466.264) [-2461.351] (-2469.117) * (-2469.742) [-2466.624] (-2467.334) (-2475.641) -- 0:05:28
239000 -- (-2460.330) (-2461.163) (-2466.568) [-2474.148] * (-2463.896) (-2462.251) (-2472.768) [-2459.135] -- 0:05:27
239500 -- (-2467.308) (-2467.123) (-2467.184) [-2462.527] * (-2468.241) (-2462.474) (-2473.828) [-2464.257] -- 0:05:27
240000 -- (-2461.594) (-2465.096) (-2474.862) [-2464.184] * [-2469.117] (-2469.966) (-2471.845) (-2465.788) -- 0:05:26
Average standard deviation of split frequencies: 0.010447
240500 -- [-2464.661] (-2468.863) (-2464.182) (-2463.911) * (-2489.622) [-2463.104] (-2470.144) (-2469.367) -- 0:05:25
241000 -- (-2464.514) (-2470.757) (-2472.604) [-2468.733] * (-2479.857) (-2462.512) [-2467.929] (-2483.600) -- 0:05:27
241500 -- (-2471.396) (-2467.772) (-2467.096) [-2459.703] * (-2472.764) [-2463.937] (-2468.314) (-2476.831) -- 0:05:26
242000 -- (-2465.115) (-2467.783) (-2468.947) [-2465.118] * (-2466.972) [-2463.332] (-2463.411) (-2480.933) -- 0:05:25
242500 -- [-2459.755] (-2469.061) (-2470.823) (-2475.300) * (-2475.113) (-2469.479) (-2466.486) [-2472.676] -- 0:05:24
243000 -- (-2473.133) (-2470.412) [-2461.003] (-2467.676) * (-2472.334) [-2464.150] (-2467.630) (-2476.981) -- 0:05:27
243500 -- [-2462.665] (-2471.361) (-2471.964) (-2471.936) * (-2469.660) (-2468.623) (-2464.996) [-2474.438] -- 0:05:26
244000 -- (-2463.112) (-2482.615) (-2460.288) [-2464.059] * (-2460.708) (-2470.830) (-2465.282) [-2466.977] -- 0:05:25
244500 -- (-2463.012) (-2474.585) (-2469.976) [-2460.118] * (-2464.590) (-2466.979) [-2467.378] (-2464.769) -- 0:05:24
245000 -- (-2470.888) (-2462.818) [-2463.996] (-2469.176) * [-2466.718] (-2463.424) (-2461.307) (-2471.205) -- 0:05:23
Average standard deviation of split frequencies: 0.010699
245500 -- (-2465.873) [-2468.991] (-2480.666) (-2464.799) * [-2463.674] (-2462.167) (-2463.443) (-2478.595) -- 0:05:25
246000 -- [-2466.723] (-2467.653) (-2465.108) (-2465.116) * (-2470.124) (-2470.653) (-2473.978) [-2469.088] -- 0:05:24
246500 -- (-2466.594) (-2468.069) [-2461.096] (-2461.697) * (-2465.989) (-2469.222) [-2464.186] (-2471.149) -- 0:05:24
247000 -- (-2472.537) (-2458.165) [-2464.828] (-2458.369) * [-2467.354] (-2467.998) (-2474.273) (-2467.995) -- 0:05:23
247500 -- [-2462.313] (-2461.594) (-2467.513) (-2459.426) * [-2461.148] (-2462.919) (-2472.923) (-2470.191) -- 0:05:22
248000 -- (-2465.680) [-2459.539] (-2468.654) (-2468.497) * (-2466.210) [-2466.460] (-2458.957) (-2464.636) -- 0:05:24
248500 -- (-2478.051) [-2469.143] (-2472.856) (-2465.380) * (-2472.721) (-2470.855) (-2479.591) [-2461.083] -- 0:05:23
249000 -- (-2468.113) (-2462.890) (-2470.279) [-2460.236] * [-2463.610] (-2467.343) (-2465.078) (-2471.872) -- 0:05:22
249500 -- (-2463.151) [-2459.808] (-2473.017) (-2465.777) * (-2462.811) [-2464.407] (-2463.379) (-2466.790) -- 0:05:21
250000 -- (-2473.501) [-2466.238] (-2474.359) (-2460.623) * (-2478.035) [-2466.198] (-2479.028) (-2473.551) -- 0:05:24
Average standard deviation of split frequencies: 0.011127
250500 -- (-2468.204) [-2466.529] (-2462.589) (-2470.387) * (-2465.899) [-2460.111] (-2470.685) (-2462.427) -- 0:05:23
251000 -- (-2472.229) (-2470.706) [-2467.505] (-2470.912) * (-2472.683) (-2461.427) (-2472.188) [-2463.295] -- 0:05:22
251500 -- (-2468.057) (-2469.067) [-2465.205] (-2466.026) * (-2470.024) (-2462.518) (-2468.878) [-2466.295] -- 0:05:21
252000 -- (-2473.284) (-2468.003) (-2477.396) [-2464.897] * (-2465.704) (-2472.675) (-2470.197) [-2469.072] -- 0:05:20
252500 -- (-2468.752) [-2464.121] (-2470.284) (-2465.762) * (-2468.092) (-2470.015) [-2464.561] (-2463.985) -- 0:05:22
253000 -- (-2468.992) (-2464.535) (-2477.868) [-2460.134] * (-2463.669) (-2475.585) (-2474.688) [-2462.776] -- 0:05:21
253500 -- (-2467.529) (-2465.441) (-2465.517) [-2463.234] * [-2465.805] (-2467.053) (-2472.697) (-2467.731) -- 0:05:20
254000 -- [-2465.281] (-2464.489) (-2473.666) (-2460.400) * (-2466.430) [-2467.227] (-2470.405) (-2468.076) -- 0:05:20
254500 -- [-2464.531] (-2464.422) (-2467.590) (-2469.561) * (-2460.433) (-2479.847) (-2470.887) [-2459.625] -- 0:05:22
255000 -- [-2465.767] (-2468.919) (-2464.100) (-2471.599) * [-2461.054] (-2478.489) (-2468.685) (-2461.948) -- 0:05:21
Average standard deviation of split frequencies: 0.010588
255500 -- [-2469.128] (-2462.603) (-2470.082) (-2466.153) * [-2462.836] (-2471.507) (-2469.608) (-2474.239) -- 0:05:20
256000 -- (-2470.164) [-2466.604] (-2458.390) (-2468.938) * (-2464.535) (-2461.887) [-2460.497] (-2469.890) -- 0:05:19
256500 -- [-2468.622] (-2472.530) (-2462.150) (-2475.093) * (-2462.724) (-2467.956) (-2470.052) [-2464.528] -- 0:05:18
257000 -- (-2463.455) [-2460.758] (-2465.609) (-2464.500) * (-2457.829) (-2468.416) [-2467.073] (-2473.110) -- 0:05:20
257500 -- (-2469.942) [-2469.252] (-2463.355) (-2469.600) * (-2463.903) (-2464.245) (-2474.087) [-2462.962] -- 0:05:20
258000 -- (-2467.796) (-2467.072) (-2465.933) [-2467.330] * [-2464.087] (-2466.777) (-2457.663) (-2462.185) -- 0:05:19
258500 -- (-2467.243) (-2464.720) (-2469.237) [-2465.048] * (-2474.017) (-2467.025) [-2460.129] (-2466.335) -- 0:05:18
259000 -- (-2466.149) (-2470.152) [-2465.284] (-2470.268) * (-2466.264) (-2460.205) (-2469.907) [-2468.926] -- 0:05:17
259500 -- (-2472.686) [-2467.773] (-2465.484) (-2471.192) * [-2464.285] (-2468.868) (-2477.132) (-2466.134) -- 0:05:19
260000 -- (-2478.095) [-2472.329] (-2479.687) (-2469.236) * (-2463.814) (-2467.924) [-2473.954] (-2467.984) -- 0:05:18
Average standard deviation of split frequencies: 0.011604
260500 -- [-2468.835] (-2468.894) (-2479.875) (-2470.549) * (-2477.930) (-2463.363) (-2477.721) [-2466.092] -- 0:05:17
261000 -- [-2465.680] (-2464.814) (-2468.463) (-2477.754) * (-2472.186) (-2475.052) [-2459.795] (-2468.787) -- 0:05:17
261500 -- [-2463.728] (-2473.370) (-2479.560) (-2480.729) * (-2468.315) [-2464.570] (-2469.057) (-2467.864) -- 0:05:19
262000 -- (-2466.668) [-2461.171] (-2464.638) (-2463.316) * [-2457.164] (-2459.775) (-2467.761) (-2469.161) -- 0:05:18
262500 -- (-2463.412) (-2472.496) [-2463.228] (-2469.162) * [-2463.017] (-2461.349) (-2463.676) (-2474.318) -- 0:05:17
263000 -- (-2470.247) [-2463.472] (-2461.205) (-2466.753) * [-2465.182] (-2471.126) (-2465.799) (-2472.514) -- 0:05:16
263500 -- (-2460.228) [-2459.191] (-2460.852) (-2470.716) * (-2462.692) [-2465.909] (-2459.279) (-2472.306) -- 0:05:15
264000 -- (-2461.787) (-2469.558) (-2465.899) [-2466.937] * (-2464.328) (-2475.591) [-2465.913] (-2466.313) -- 0:05:17
264500 -- [-2460.510] (-2468.027) (-2464.290) (-2464.964) * (-2477.320) (-2466.976) [-2461.080] (-2468.423) -- 0:05:17
265000 -- [-2463.517] (-2464.944) (-2461.965) (-2472.953) * (-2474.865) [-2465.563] (-2470.750) (-2461.008) -- 0:05:16
Average standard deviation of split frequencies: 0.011519
265500 -- (-2472.548) [-2459.485] (-2465.480) (-2468.570) * (-2464.884) [-2461.565] (-2467.860) (-2467.800) -- 0:05:15
266000 -- (-2466.789) (-2461.933) [-2471.958] (-2468.199) * [-2465.856] (-2475.264) (-2464.866) (-2473.404) -- 0:05:14
266500 -- (-2457.944) [-2462.598] (-2466.010) (-2469.265) * (-2477.300) [-2465.379] (-2458.285) (-2466.336) -- 0:05:16
267000 -- (-2463.735) (-2462.032) (-2468.686) [-2471.732] * (-2461.020) (-2465.681) [-2467.577] (-2460.498) -- 0:05:15
267500 -- (-2466.243) [-2462.850] (-2462.804) (-2463.868) * (-2463.278) [-2465.123] (-2460.233) (-2464.274) -- 0:05:14
268000 -- (-2469.765) [-2463.416] (-2476.594) (-2467.172) * (-2466.299) (-2464.734) (-2473.472) [-2475.760] -- 0:05:14
268500 -- (-2460.897) (-2468.863) (-2473.928) [-2459.063] * (-2466.554) (-2468.979) [-2469.616] (-2466.479) -- 0:05:16
269000 -- [-2463.757] (-2473.920) (-2463.712) (-2467.552) * (-2463.040) (-2467.694) (-2468.454) [-2475.208] -- 0:05:15
269500 -- (-2469.485) [-2462.301] (-2476.421) (-2464.769) * (-2469.671) [-2458.582] (-2466.749) (-2465.426) -- 0:05:14
270000 -- (-2469.096) (-2465.814) (-2468.652) [-2462.106] * (-2478.118) [-2461.960] (-2471.725) (-2460.183) -- 0:05:13
Average standard deviation of split frequencies: 0.010740
270500 -- (-2473.974) (-2475.273) [-2461.640] (-2460.280) * (-2470.984) (-2465.130) (-2466.023) [-2467.271] -- 0:05:12
271000 -- (-2465.402) (-2467.822) [-2457.994] (-2468.736) * (-2461.476) (-2471.969) [-2464.361] (-2470.579) -- 0:05:14
271500 -- (-2457.937) (-2467.229) [-2462.238] (-2468.980) * (-2466.770) (-2461.518) (-2474.858) [-2471.539] -- 0:05:13
272000 -- (-2460.873) (-2464.336) (-2463.623) [-2466.559] * [-2464.987] (-2463.312) (-2471.966) (-2462.846) -- 0:05:13
272500 -- [-2460.412] (-2465.886) (-2471.127) (-2468.180) * (-2471.510) (-2461.825) [-2464.387] (-2466.899) -- 0:05:12
273000 -- (-2459.633) [-2465.252] (-2463.992) (-2476.717) * [-2466.232] (-2460.195) (-2476.194) (-2468.531) -- 0:05:11
273500 -- (-2465.824) (-2468.163) (-2469.986) [-2470.979] * (-2467.831) (-2462.686) (-2464.755) [-2463.146] -- 0:05:13
274000 -- (-2464.378) (-2469.158) (-2476.718) [-2459.573] * (-2471.828) [-2467.467] (-2468.225) (-2464.064) -- 0:05:12
274500 -- (-2457.467) [-2461.941] (-2474.716) (-2472.981) * [-2465.566] (-2475.467) (-2463.617) (-2462.300) -- 0:05:11
275000 -- (-2464.524) (-2471.543) (-2470.680) [-2462.361] * (-2472.515) [-2462.748] (-2468.039) (-2470.012) -- 0:05:11
Average standard deviation of split frequencies: 0.010960
275500 -- (-2470.352) (-2471.014) (-2467.676) [-2460.831] * (-2465.213) [-2461.957] (-2462.292) (-2463.504) -- 0:05:12
276000 -- (-2467.096) (-2469.638) [-2470.036] (-2460.907) * (-2464.904) (-2463.912) [-2462.086] (-2470.871) -- 0:05:12
276500 -- (-2466.305) (-2466.313) (-2467.910) [-2462.320] * (-2469.812) (-2469.888) (-2460.716) [-2463.152] -- 0:05:11
277000 -- (-2470.268) (-2465.591) (-2463.980) [-2458.048] * (-2469.781) [-2470.383] (-2473.489) (-2464.422) -- 0:05:10
277500 -- (-2460.485) (-2463.279) (-2470.651) [-2458.611] * (-2466.356) (-2469.114) (-2477.438) [-2463.567] -- 0:05:12
278000 -- (-2464.060) [-2461.401] (-2470.894) (-2461.240) * [-2459.605] (-2470.342) (-2477.556) (-2469.217) -- 0:05:11
278500 -- (-2469.396) (-2463.987) (-2467.403) [-2465.824] * (-2472.010) [-2465.035] (-2471.344) (-2477.261) -- 0:05:10
279000 -- (-2462.561) [-2462.835] (-2462.291) (-2476.183) * (-2472.837) [-2462.076] (-2460.414) (-2464.707) -- 0:05:10
279500 -- (-2458.693) (-2465.511) [-2466.847] (-2482.939) * (-2468.032) (-2462.988) (-2464.276) [-2466.326] -- 0:05:09
280000 -- [-2455.685] (-2482.370) (-2463.298) (-2478.832) * (-2465.445) [-2463.331] (-2468.818) (-2466.889) -- 0:05:11
Average standard deviation of split frequencies: 0.012317
280500 -- (-2467.959) [-2463.391] (-2464.609) (-2469.364) * (-2469.544) [-2467.265] (-2473.696) (-2469.261) -- 0:05:10
281000 -- [-2464.614] (-2469.080) (-2465.765) (-2467.750) * (-2462.338) (-2459.585) [-2463.278] (-2463.822) -- 0:05:09
281500 -- (-2458.786) (-2469.672) (-2467.615) [-2462.692] * [-2464.353] (-2468.881) (-2462.493) (-2467.112) -- 0:05:08
282000 -- (-2463.214) (-2459.908) [-2461.884] (-2467.195) * (-2469.496) [-2466.277] (-2474.387) (-2461.678) -- 0:05:08
282500 -- (-2461.422) (-2465.994) (-2460.434) [-2460.060] * (-2464.817) (-2462.161) [-2465.053] (-2463.175) -- 0:05:09
283000 -- [-2460.734] (-2475.490) (-2459.562) (-2469.869) * (-2465.199) [-2470.986] (-2462.617) (-2472.340) -- 0:05:09
283500 -- (-2461.277) (-2467.462) [-2461.341] (-2457.690) * (-2468.124) (-2473.795) [-2465.710] (-2468.919) -- 0:05:08
284000 -- (-2468.427) (-2474.025) [-2464.182] (-2458.394) * [-2463.677] (-2470.980) (-2461.978) (-2465.415) -- 0:05:07
284500 -- [-2464.610] (-2465.856) (-2464.226) (-2463.035) * (-2469.689) (-2475.210) [-2461.865] (-2467.806) -- 0:05:09
285000 -- (-2461.883) (-2468.723) (-2465.341) [-2462.185] * [-2468.497] (-2464.642) (-2467.703) (-2474.493) -- 0:05:08
Average standard deviation of split frequencies: 0.012225
285500 -- (-2469.682) (-2472.766) (-2468.132) [-2464.769] * (-2461.987) (-2463.303) (-2462.413) [-2457.722] -- 0:05:07
286000 -- [-2463.052] (-2475.576) (-2465.507) (-2463.003) * (-2463.450) [-2465.361] (-2459.367) (-2468.055) -- 0:05:07
286500 -- [-2466.569] (-2467.673) (-2455.066) (-2463.617) * [-2463.155] (-2469.961) (-2465.155) (-2465.578) -- 0:05:06
287000 -- (-2479.991) [-2461.132] (-2464.937) (-2460.810) * [-2466.942] (-2464.121) (-2473.719) (-2467.258) -- 0:05:08
287500 -- (-2469.224) (-2477.584) [-2456.489] (-2463.455) * (-2470.815) [-2472.595] (-2461.569) (-2470.627) -- 0:05:07
288000 -- (-2472.786) (-2466.236) (-2462.009) [-2463.761] * (-2463.172) (-2470.071) [-2463.345] (-2465.476) -- 0:05:06
288500 -- (-2473.905) (-2466.646) [-2462.806] (-2462.727) * [-2467.931] (-2473.752) (-2461.746) (-2462.426) -- 0:05:05
289000 -- [-2470.474] (-2468.688) (-2462.321) (-2465.411) * (-2470.262) (-2476.428) (-2465.690) [-2461.689] -- 0:05:05
289500 -- (-2467.507) (-2471.879) (-2462.352) [-2468.120] * (-2466.904) [-2460.120] (-2465.873) (-2467.720) -- 0:05:06
290000 -- (-2461.898) [-2460.908] (-2473.859) (-2473.075) * [-2464.353] (-2466.852) (-2470.122) (-2461.962) -- 0:05:06
Average standard deviation of split frequencies: 0.012569
290500 -- (-2464.997) (-2466.613) (-2472.485) [-2467.915] * (-2464.801) [-2464.939] (-2456.670) (-2467.243) -- 0:05:05
291000 -- (-2468.238) (-2465.746) (-2468.946) [-2466.225] * (-2460.938) (-2469.551) (-2467.558) [-2463.686] -- 0:05:04
291500 -- (-2469.600) (-2469.690) (-2461.503) [-2465.350] * (-2465.615) (-2458.833) (-2470.170) [-2458.956] -- 0:05:06
292000 -- (-2462.738) [-2461.928] (-2469.984) (-2469.427) * [-2469.890] (-2465.343) (-2461.283) (-2462.134) -- 0:05:05
292500 -- (-2463.548) (-2466.948) (-2471.071) [-2461.955] * [-2461.814] (-2469.699) (-2468.661) (-2460.400) -- 0:05:04
293000 -- (-2466.144) (-2467.980) (-2474.211) [-2462.882] * (-2470.723) (-2471.622) [-2456.322] (-2467.021) -- 0:05:04
293500 -- [-2460.082] (-2473.919) (-2471.891) (-2459.580) * (-2465.818) [-2461.301] (-2472.149) (-2463.296) -- 0:05:03
294000 -- [-2459.041] (-2470.913) (-2464.591) (-2459.263) * [-2466.314] (-2460.430) (-2468.676) (-2461.423) -- 0:05:04
294500 -- (-2462.074) [-2465.510] (-2476.310) (-2468.060) * (-2468.845) (-2468.457) (-2475.833) [-2468.605] -- 0:05:04
295000 -- (-2460.919) (-2460.131) (-2481.483) [-2461.974] * [-2460.307] (-2464.353) (-2465.814) (-2471.942) -- 0:05:03
Average standard deviation of split frequencies: 0.012077
295500 -- [-2463.695] (-2461.259) (-2472.567) (-2466.623) * (-2467.175) (-2463.328) (-2468.978) [-2467.883] -- 0:05:02
296000 -- (-2472.969) [-2462.747] (-2460.398) (-2463.255) * (-2460.367) (-2458.015) (-2465.074) [-2461.478] -- 0:05:02
296500 -- (-2465.770) [-2460.475] (-2471.833) (-2459.263) * (-2462.807) (-2466.302) (-2466.562) [-2471.965] -- 0:05:03
297000 -- [-2472.498] (-2459.553) (-2464.974) (-2465.540) * [-2462.937] (-2462.881) (-2468.246) (-2472.868) -- 0:05:02
297500 -- (-2470.160) (-2461.896) [-2462.798] (-2465.801) * [-2465.370] (-2464.226) (-2471.343) (-2465.693) -- 0:05:02
298000 -- (-2478.329) [-2461.392] (-2464.721) (-2464.764) * (-2466.579) [-2460.794] (-2463.089) (-2476.045) -- 0:05:01
298500 -- (-2473.363) (-2462.184) (-2473.084) [-2458.074] * (-2470.098) [-2462.027] (-2468.879) (-2475.428) -- 0:05:03
299000 -- (-2469.591) (-2465.826) (-2462.565) [-2462.032] * (-2468.696) (-2464.078) [-2464.316] (-2463.358) -- 0:05:02
299500 -- (-2470.255) (-2466.087) (-2465.760) [-2459.475] * [-2468.041] (-2463.245) (-2466.420) (-2464.283) -- 0:05:01
300000 -- (-2474.877) [-2463.989] (-2463.247) (-2465.112) * (-2458.716) [-2459.641] (-2465.090) (-2459.800) -- 0:05:01
Average standard deviation of split frequencies: 0.010975
300500 -- [-2464.858] (-2463.725) (-2462.967) (-2460.058) * (-2462.316) (-2461.526) (-2468.675) [-2464.615] -- 0:05:00
301000 -- [-2461.870] (-2464.565) (-2467.506) (-2472.162) * (-2463.595) [-2458.448] (-2463.537) (-2460.676) -- 0:05:01
301500 -- [-2462.938] (-2462.599) (-2471.850) (-2474.409) * (-2468.215) (-2461.106) (-2467.494) [-2464.561] -- 0:05:01
302000 -- [-2467.796] (-2462.464) (-2467.186) (-2467.535) * (-2466.622) (-2465.991) (-2465.837) [-2465.020] -- 0:05:00
302500 -- (-2470.722) [-2461.082] (-2477.622) (-2470.895) * [-2459.795] (-2466.401) (-2458.302) (-2471.569) -- 0:04:59
303000 -- (-2471.773) (-2462.780) [-2461.394] (-2476.653) * (-2467.530) (-2465.273) [-2462.591] (-2469.649) -- 0:04:59
303500 -- (-2461.370) [-2462.256] (-2466.954) (-2474.491) * (-2467.958) (-2469.316) (-2468.712) [-2470.953] -- 0:05:00
304000 -- (-2471.247) (-2470.478) [-2460.385] (-2471.331) * (-2475.621) (-2469.147) (-2471.555) [-2462.722] -- 0:04:59
304500 -- (-2468.101) [-2465.773] (-2468.189) (-2468.578) * (-2465.827) (-2463.146) (-2478.605) [-2461.783] -- 0:04:59
305000 -- [-2466.109] (-2465.680) (-2468.003) (-2461.896) * (-2459.751) (-2466.452) (-2470.806) [-2469.635] -- 0:04:58
Average standard deviation of split frequencies: 0.010912
305500 -- (-2471.916) (-2465.601) [-2461.910] (-2461.493) * (-2475.477) (-2460.569) [-2472.718] (-2467.476) -- 0:05:00
306000 -- (-2470.467) [-2469.186] (-2463.394) (-2466.315) * (-2471.894) (-2469.976) (-2466.837) [-2460.341] -- 0:04:59
306500 -- (-2465.035) (-2463.897) (-2471.811) [-2458.264] * (-2472.785) [-2460.933] (-2471.474) (-2468.936) -- 0:04:58
307000 -- (-2466.509) [-2463.521] (-2464.378) (-2468.496) * [-2471.398] (-2461.737) (-2472.160) (-2463.535) -- 0:04:57
307500 -- (-2463.082) [-2470.330] (-2465.312) (-2462.887) * [-2468.567] (-2469.732) (-2464.519) (-2468.156) -- 0:04:57
308000 -- (-2459.874) [-2461.187] (-2459.731) (-2467.113) * (-2468.287) [-2460.033] (-2465.438) (-2475.661) -- 0:04:58
308500 -- (-2464.379) (-2469.681) [-2458.253] (-2463.915) * (-2475.664) [-2463.405] (-2477.649) (-2466.195) -- 0:04:58
309000 -- (-2463.458) [-2466.589] (-2459.944) (-2459.663) * (-2479.123) [-2467.212] (-2468.781) (-2472.125) -- 0:04:57
309500 -- (-2467.798) (-2477.304) (-2467.797) [-2461.574] * [-2464.076] (-2463.705) (-2469.188) (-2476.578) -- 0:04:56
310000 -- (-2470.417) (-2472.224) (-2462.204) [-2460.594] * (-2463.643) [-2466.083] (-2463.111) (-2473.061) -- 0:04:56
Average standard deviation of split frequencies: 0.011001
310500 -- [-2460.912] (-2474.069) (-2462.874) (-2466.883) * (-2471.051) (-2472.576) [-2462.024] (-2477.484) -- 0:04:57
311000 -- (-2469.578) [-2464.228] (-2464.365) (-2472.591) * [-2466.138] (-2468.481) (-2471.232) (-2468.051) -- 0:04:56
311500 -- [-2459.664] (-2473.187) (-2467.181) (-2468.225) * (-2465.767) (-2471.902) (-2459.031) [-2460.557] -- 0:04:56
312000 -- [-2464.199] (-2468.112) (-2476.367) (-2468.413) * [-2465.536] (-2461.220) (-2465.638) (-2468.303) -- 0:04:55
312500 -- [-2459.858] (-2470.263) (-2471.718) (-2477.885) * (-2473.528) (-2462.784) (-2466.886) [-2470.446] -- 0:04:57
313000 -- (-2472.254) (-2468.159) [-2464.170] (-2476.357) * (-2466.847) (-2465.480) (-2458.588) [-2465.452] -- 0:04:56
313500 -- (-2465.696) (-2466.830) [-2466.665] (-2476.110) * [-2460.247] (-2463.468) (-2460.102) (-2470.709) -- 0:04:55
314000 -- (-2470.777) [-2459.070] (-2462.695) (-2462.359) * (-2459.953) (-2464.630) (-2461.488) [-2462.481] -- 0:04:54
314500 -- (-2473.525) (-2469.673) (-2461.716) [-2462.757] * (-2464.775) [-2461.613] (-2473.035) (-2468.043) -- 0:04:54
315000 -- (-2476.343) (-2463.118) [-2458.131] (-2467.245) * (-2472.186) (-2468.682) [-2463.774] (-2463.180) -- 0:04:55
Average standard deviation of split frequencies: 0.009572
315500 -- (-2467.745) [-2468.838] (-2462.153) (-2469.890) * (-2467.202) (-2463.910) [-2464.276] (-2465.533) -- 0:04:55
316000 -- [-2471.381] (-2464.974) (-2470.905) (-2482.034) * (-2460.524) [-2460.807] (-2466.880) (-2470.455) -- 0:04:54
316500 -- [-2471.044] (-2467.667) (-2467.181) (-2477.065) * (-2465.836) [-2459.819] (-2464.773) (-2464.867) -- 0:04:53
317000 -- (-2473.086) (-2472.595) [-2470.198] (-2467.779) * (-2471.301) (-2472.067) [-2466.942] (-2475.466) -- 0:04:53
317500 -- (-2468.981) [-2463.095] (-2467.513) (-2470.395) * (-2469.212) (-2469.085) [-2462.656] (-2469.477) -- 0:04:54
318000 -- (-2469.404) [-2464.810] (-2460.095) (-2477.253) * [-2467.033] (-2471.681) (-2468.446) (-2480.755) -- 0:04:53
318500 -- (-2464.614) [-2467.424] (-2465.401) (-2469.988) * (-2468.828) (-2470.145) [-2464.352] (-2468.925) -- 0:04:53
319000 -- (-2461.961) (-2462.435) (-2461.821) [-2471.737] * [-2462.084] (-2477.801) (-2464.753) (-2462.996) -- 0:04:52
319500 -- (-2476.969) [-2458.505] (-2462.825) (-2473.361) * (-2466.813) [-2464.862] (-2471.048) (-2465.329) -- 0:04:53
320000 -- (-2470.885) (-2465.457) [-2465.014] (-2471.574) * (-2469.391) [-2459.092] (-2463.853) (-2464.154) -- 0:04:53
Average standard deviation of split frequencies: 0.009065
320500 -- [-2463.004] (-2463.887) (-2467.483) (-2470.269) * (-2472.061) (-2463.307) (-2472.376) [-2460.319] -- 0:04:52
321000 -- (-2467.846) [-2460.004] (-2461.743) (-2468.644) * (-2470.454) (-2466.066) (-2467.646) [-2463.081] -- 0:04:51
321500 -- (-2474.172) (-2464.195) (-2461.700) [-2462.789] * (-2479.265) (-2466.080) (-2471.372) [-2469.003] -- 0:04:51
322000 -- (-2469.219) (-2470.057) (-2466.503) [-2466.611] * (-2471.896) (-2460.498) (-2475.516) [-2461.704] -- 0:04:52
322500 -- (-2473.021) (-2467.980) (-2468.953) [-2460.837] * (-2476.126) [-2455.665] (-2472.942) (-2467.118) -- 0:04:52
323000 -- (-2465.715) (-2468.905) [-2460.662] (-2463.914) * (-2471.373) (-2467.639) [-2469.586] (-2459.552) -- 0:04:51
323500 -- [-2467.173] (-2473.182) (-2467.957) (-2470.089) * [-2463.049] (-2473.461) (-2462.963) (-2462.052) -- 0:04:50
324000 -- (-2471.756) [-2471.176] (-2466.978) (-2467.658) * [-2470.349] (-2462.452) (-2469.171) (-2462.849) -- 0:04:52
324500 -- (-2473.308) (-2472.906) (-2469.409) [-2465.214] * [-2465.996] (-2473.002) (-2474.349) (-2468.056) -- 0:04:51
325000 -- (-2468.763) (-2468.619) (-2468.962) [-2460.133] * (-2462.427) [-2466.941] (-2473.821) (-2473.306) -- 0:04:50
Average standard deviation of split frequencies: 0.009158
325500 -- (-2468.066) (-2464.563) (-2459.539) [-2465.894] * (-2469.593) [-2470.518] (-2468.822) (-2470.527) -- 0:04:50
326000 -- [-2457.630] (-2473.326) (-2461.463) (-2467.270) * (-2468.431) (-2465.261) (-2461.024) [-2474.251] -- 0:04:49
326500 -- (-2466.998) [-2462.042] (-2463.333) (-2464.436) * (-2466.343) (-2469.492) (-2469.187) [-2466.118] -- 0:04:50
327000 -- (-2473.312) [-2464.426] (-2466.229) (-2475.038) * (-2463.558) (-2462.815) (-2466.353) [-2462.859] -- 0:04:50
327500 -- (-2468.215) (-2461.008) [-2465.691] (-2471.415) * (-2467.913) (-2458.617) (-2466.556) [-2459.992] -- 0:04:49
328000 -- (-2467.813) (-2465.893) (-2464.165) [-2466.833] * (-2462.004) [-2459.838] (-2471.898) (-2455.588) -- 0:04:48
328500 -- [-2467.893] (-2462.934) (-2467.882) (-2467.372) * (-2473.889) (-2463.126) [-2470.933] (-2467.264) -- 0:04:48
329000 -- (-2476.087) (-2472.592) [-2458.312] (-2472.350) * [-2467.935] (-2476.770) (-2468.855) (-2464.055) -- 0:04:49
329500 -- [-2465.874] (-2465.179) (-2468.002) (-2472.541) * (-2471.379) (-2471.503) (-2468.740) [-2467.045] -- 0:04:48
330000 -- (-2473.942) (-2464.242) [-2465.532] (-2473.649) * [-2462.657] (-2463.313) (-2471.992) (-2475.659) -- 0:04:48
Average standard deviation of split frequencies: 0.009029
330500 -- (-2474.123) [-2469.675] (-2470.034) (-2471.113) * [-2464.453] (-2470.776) (-2470.878) (-2465.880) -- 0:04:47
331000 -- (-2472.718) (-2462.066) (-2470.951) [-2472.254] * (-2467.825) [-2468.693] (-2466.880) (-2465.462) -- 0:04:49
331500 -- (-2472.180) (-2466.389) [-2465.529] (-2463.464) * [-2458.569] (-2461.441) (-2471.167) (-2470.437) -- 0:04:48
332000 -- (-2467.920) [-2462.617] (-2466.695) (-2461.520) * (-2462.320) (-2466.154) [-2458.126] (-2464.185) -- 0:04:47
332500 -- (-2468.333) (-2468.468) (-2467.808) [-2459.611] * (-2459.283) (-2466.773) (-2464.649) [-2464.998] -- 0:04:47
333000 -- (-2464.895) (-2456.947) [-2460.312] (-2459.672) * [-2462.867] (-2462.146) (-2469.550) (-2465.792) -- 0:04:46
333500 -- (-2460.083) [-2464.433] (-2465.105) (-2467.479) * [-2465.199] (-2469.560) (-2467.272) (-2467.934) -- 0:04:47
334000 -- (-2463.837) (-2467.966) [-2468.133] (-2465.380) * (-2467.072) [-2463.496] (-2472.852) (-2466.744) -- 0:04:47
334500 -- (-2464.626) [-2461.339] (-2471.383) (-2459.289) * [-2463.586] (-2468.709) (-2463.170) (-2470.198) -- 0:04:46
335000 -- (-2462.274) (-2456.836) (-2469.213) [-2465.524] * [-2460.178] (-2462.883) (-2472.895) (-2473.214) -- 0:04:45
Average standard deviation of split frequencies: 0.007950
335500 -- (-2470.238) [-2466.516] (-2469.127) (-2477.566) * (-2456.306) [-2457.948] (-2464.930) (-2457.974) -- 0:04:45
336000 -- (-2462.698) (-2463.876) [-2461.922] (-2469.645) * (-2463.312) [-2462.042] (-2475.499) (-2464.067) -- 0:04:46
336500 -- (-2468.755) (-2465.199) [-2463.316] (-2466.399) * (-2471.124) [-2462.511] (-2477.015) (-2472.293) -- 0:04:45
337000 -- (-2464.927) (-2466.928) [-2467.985] (-2470.737) * (-2473.796) [-2462.719] (-2470.791) (-2475.785) -- 0:04:45
337500 -- (-2465.255) (-2471.250) (-2460.243) [-2463.617] * (-2478.640) (-2467.209) [-2456.435] (-2473.820) -- 0:04:44
338000 -- [-2464.709] (-2470.247) (-2458.827) (-2468.513) * (-2465.638) (-2464.287) (-2465.369) [-2465.917] -- 0:04:45
338500 -- [-2467.143] (-2467.303) (-2465.094) (-2469.044) * (-2459.879) (-2465.778) (-2470.631) [-2465.722] -- 0:04:45
339000 -- (-2473.701) (-2467.443) (-2469.665) [-2463.579] * [-2457.201] (-2455.077) (-2471.855) (-2456.045) -- 0:04:44
339500 -- [-2464.452] (-2469.370) (-2465.093) (-2463.388) * (-2461.910) (-2463.074) [-2469.163] (-2460.862) -- 0:04:44
340000 -- (-2466.535) (-2474.012) [-2465.990] (-2468.422) * (-2456.960) (-2466.798) (-2461.502) [-2466.607] -- 0:04:43
Average standard deviation of split frequencies: 0.008187
340500 -- (-2467.692) [-2463.083] (-2462.377) (-2466.527) * [-2463.072] (-2461.797) (-2476.558) (-2475.285) -- 0:04:44
341000 -- (-2464.370) [-2461.922] (-2462.701) (-2467.801) * (-2464.467) [-2468.315] (-2463.681) (-2466.265) -- 0:04:44
341500 -- (-2471.349) (-2465.797) (-2461.716) [-2463.485] * (-2468.502) (-2465.444) (-2464.026) [-2463.779] -- 0:04:43
342000 -- [-2468.203] (-2467.368) (-2473.730) (-2465.362) * (-2461.988) (-2481.481) (-2467.243) [-2471.652] -- 0:04:42
342500 -- (-2464.283) [-2464.639] (-2468.598) (-2474.128) * [-2465.144] (-2468.785) (-2469.199) (-2466.651) -- 0:04:42
343000 -- (-2469.488) (-2469.709) (-2458.017) [-2469.706] * (-2467.898) (-2461.689) (-2463.395) [-2465.293] -- 0:04:43
343500 -- (-2465.886) [-2468.552] (-2462.305) (-2470.542) * [-2458.692] (-2465.464) (-2470.945) (-2462.441) -- 0:04:42
344000 -- (-2471.821) [-2470.663] (-2458.252) (-2463.064) * (-2463.274) (-2459.718) [-2459.503] (-2461.955) -- 0:04:42
344500 -- (-2470.374) (-2470.406) (-2465.601) [-2463.326] * (-2470.013) (-2463.681) [-2463.322] (-2464.642) -- 0:04:41
345000 -- (-2466.691) (-2472.197) (-2459.907) [-2464.713] * (-2461.230) (-2470.084) (-2466.065) [-2466.951] -- 0:04:42
Average standard deviation of split frequencies: 0.008402
345500 -- (-2466.948) (-2471.468) (-2468.107) [-2467.837] * (-2462.586) (-2463.276) [-2467.836] (-2463.937) -- 0:04:42
346000 -- (-2463.004) (-2462.167) [-2464.259] (-2470.636) * [-2471.770] (-2465.649) (-2469.364) (-2481.094) -- 0:04:41
346500 -- [-2460.977] (-2457.775) (-2465.042) (-2466.662) * (-2466.509) [-2463.624] (-2475.435) (-2469.678) -- 0:04:41
347000 -- (-2459.446) [-2463.497] (-2462.551) (-2465.321) * (-2468.707) [-2462.649] (-2468.984) (-2468.601) -- 0:04:40
347500 -- (-2473.062) [-2461.882] (-2461.438) (-2471.150) * (-2463.940) [-2466.479] (-2469.113) (-2466.001) -- 0:04:41
348000 -- (-2472.887) [-2460.204] (-2466.427) (-2472.574) * (-2464.817) [-2460.389] (-2465.054) (-2463.408) -- 0:04:41
348500 -- [-2468.913] (-2473.211) (-2470.504) (-2462.454) * (-2467.053) [-2463.981] (-2468.432) (-2478.265) -- 0:04:40
349000 -- (-2467.955) (-2474.421) [-2468.183] (-2462.459) * (-2472.879) [-2460.442] (-2468.981) (-2467.034) -- 0:04:39
349500 -- (-2473.067) (-2464.865) (-2468.741) [-2463.441] * (-2463.664) (-2461.026) (-2469.025) [-2459.860] -- 0:04:39
350000 -- (-2466.147) (-2464.824) [-2465.481] (-2462.582) * (-2462.258) [-2464.385] (-2468.998) (-2465.245) -- 0:04:40
Average standard deviation of split frequencies: 0.009074
350500 -- [-2466.167] (-2476.380) (-2482.896) (-2463.132) * (-2470.574) (-2468.842) (-2466.268) [-2461.656] -- 0:04:39
351000 -- [-2465.284] (-2468.295) (-2474.376) (-2475.067) * (-2472.571) (-2472.447) [-2462.641] (-2467.978) -- 0:04:39
351500 -- (-2476.548) [-2457.608] (-2464.866) (-2466.699) * (-2470.849) (-2468.043) (-2461.473) [-2471.394] -- 0:04:38
352000 -- [-2458.795] (-2459.181) (-2463.474) (-2462.937) * (-2471.036) (-2467.563) (-2466.833) [-2466.257] -- 0:04:39
352500 -- (-2467.161) [-2467.462] (-2469.650) (-2463.474) * (-2463.514) (-2460.932) [-2475.587] (-2469.833) -- 0:04:39
353000 -- (-2465.614) [-2460.739] (-2463.128) (-2473.879) * (-2472.797) (-2469.761) (-2468.158) [-2467.565] -- 0:04:38
353500 -- [-2460.316] (-2466.872) (-2469.830) (-2469.254) * (-2468.282) (-2465.129) (-2471.226) [-2461.004] -- 0:04:37
354000 -- (-2463.784) (-2462.735) [-2467.771] (-2469.489) * [-2467.393] (-2464.717) (-2470.784) (-2476.189) -- 0:04:37
354500 -- [-2468.349] (-2462.902) (-2462.037) (-2472.764) * (-2474.968) (-2463.854) [-2478.273] (-2466.757) -- 0:04:38
355000 -- (-2475.866) [-2463.124] (-2464.301) (-2458.348) * [-2461.279] (-2468.343) (-2462.674) (-2462.244) -- 0:04:37
Average standard deviation of split frequencies: 0.007945
355500 -- [-2466.346] (-2459.999) (-2467.054) (-2458.533) * (-2467.343) [-2467.151] (-2461.357) (-2472.127) -- 0:04:37
356000 -- [-2460.687] (-2474.312) (-2467.408) (-2469.502) * [-2463.802] (-2468.050) (-2474.874) (-2484.637) -- 0:04:36
356500 -- (-2466.646) [-2460.259] (-2468.857) (-2470.335) * [-2461.063] (-2473.200) (-2463.055) (-2467.272) -- 0:04:36
357000 -- (-2467.529) [-2469.673] (-2466.129) (-2473.580) * [-2466.472] (-2466.149) (-2466.964) (-2473.540) -- 0:04:37
357500 -- (-2465.463) (-2467.288) (-2462.400) [-2464.324] * (-2470.591) [-2465.194] (-2460.377) (-2485.410) -- 0:04:36
358000 -- (-2475.698) (-2463.202) (-2468.634) [-2461.516] * (-2463.495) (-2471.251) [-2461.480] (-2470.605) -- 0:04:36
358500 -- (-2472.628) (-2469.245) [-2464.505] (-2466.601) * (-2461.434) (-2465.695) [-2457.719] (-2462.870) -- 0:04:35
359000 -- (-2468.008) [-2467.849] (-2466.614) (-2469.580) * (-2476.166) [-2461.803] (-2464.923) (-2466.830) -- 0:04:36
359500 -- (-2467.785) [-2468.738] (-2469.176) (-2467.934) * (-2472.319) [-2475.240] (-2470.056) (-2461.651) -- 0:04:36
360000 -- (-2465.229) [-2465.394] (-2470.873) (-2467.758) * [-2463.909] (-2465.947) (-2459.391) (-2468.481) -- 0:04:35
Average standard deviation of split frequencies: 0.009258
360500 -- [-2461.451] (-2464.536) (-2462.204) (-2459.741) * (-2461.662) (-2461.673) [-2459.400] (-2468.032) -- 0:04:34
361000 -- [-2467.834] (-2467.364) (-2467.167) (-2464.649) * (-2462.738) (-2469.660) (-2461.149) [-2465.968] -- 0:04:34
361500 -- (-2470.395) [-2464.830] (-2465.789) (-2480.875) * [-2458.572] (-2472.637) (-2463.170) (-2469.371) -- 0:04:35
362000 -- (-2458.789) (-2463.613) [-2473.231] (-2472.895) * [-2460.903] (-2471.678) (-2462.571) (-2475.131) -- 0:04:34
362500 -- (-2465.347) (-2463.277) (-2472.854) [-2466.018] * (-2464.446) (-2464.985) [-2467.129] (-2461.638) -- 0:04:34
363000 -- (-2468.312) [-2461.867] (-2465.285) (-2464.904) * (-2469.074) (-2464.131) (-2458.953) [-2456.762] -- 0:04:33
363500 -- (-2470.379) (-2467.844) (-2466.612) [-2473.624] * [-2467.138] (-2467.745) (-2460.747) (-2466.394) -- 0:04:33
364000 -- (-2472.038) (-2459.388) [-2462.311] (-2466.419) * [-2459.827] (-2467.829) (-2466.894) (-2461.597) -- 0:04:34
364500 -- [-2468.367] (-2469.835) (-2462.272) (-2465.166) * (-2467.340) (-2478.155) (-2464.733) [-2466.182] -- 0:04:33
365000 -- (-2465.207) (-2468.084) [-2468.482] (-2471.769) * (-2473.392) (-2459.677) (-2462.302) [-2467.438] -- 0:04:33
Average standard deviation of split frequencies: 0.008917
365500 -- (-2474.594) [-2468.677] (-2473.452) (-2468.889) * (-2464.836) (-2464.051) (-2464.558) [-2466.522] -- 0:04:32
366000 -- (-2478.535) [-2463.715] (-2476.852) (-2480.787) * (-2467.604) [-2467.269] (-2462.987) (-2464.890) -- 0:04:33
366500 -- (-2469.973) (-2462.233) [-2468.104] (-2458.390) * (-2465.107) (-2467.077) [-2462.720] (-2460.727) -- 0:04:33
367000 -- (-2465.098) (-2466.611) [-2466.167] (-2470.653) * [-2461.496] (-2462.431) (-2469.164) (-2474.914) -- 0:04:32
367500 -- (-2473.932) (-2471.275) [-2466.739] (-2467.503) * (-2466.207) [-2461.382] (-2464.701) (-2465.820) -- 0:04:31
368000 -- (-2474.526) [-2459.956] (-2464.405) (-2467.070) * (-2470.393) [-2460.642] (-2466.461) (-2466.118) -- 0:04:31
368500 -- (-2480.927) [-2463.640] (-2464.456) (-2460.303) * (-2467.532) (-2463.246) (-2465.757) [-2458.891] -- 0:04:32
369000 -- (-2470.496) (-2464.582) [-2461.320] (-2463.687) * (-2463.750) (-2467.234) (-2479.621) [-2471.642] -- 0:04:31
369500 -- (-2468.525) (-2461.585) [-2464.001] (-2477.394) * [-2467.709] (-2462.465) (-2462.040) (-2459.689) -- 0:04:31
370000 -- [-2459.997] (-2464.891) (-2463.563) (-2462.661) * (-2466.201) [-2473.512] (-2473.524) (-2468.605) -- 0:04:30
Average standard deviation of split frequencies: 0.009000
370500 -- (-2475.487) [-2461.640] (-2462.526) (-2462.478) * [-2460.355] (-2475.603) (-2467.384) (-2466.899) -- 0:04:30
371000 -- (-2467.314) (-2463.091) [-2462.383] (-2479.680) * (-2458.206) (-2465.829) (-2463.283) [-2468.995] -- 0:04:31
371500 -- (-2473.815) (-2466.980) (-2473.450) [-2462.383] * (-2464.039) (-2474.759) [-2458.503] (-2461.498) -- 0:04:30
372000 -- (-2464.582) [-2457.191] (-2461.984) (-2462.915) * (-2465.782) (-2466.735) [-2477.413] (-2467.555) -- 0:04:30
372500 -- (-2464.480) (-2464.269) (-2460.462) [-2469.580] * (-2471.943) (-2462.358) (-2465.732) [-2460.855] -- 0:04:29
373000 -- (-2477.845) (-2456.755) (-2468.799) [-2465.068] * (-2482.102) [-2463.971] (-2473.265) (-2457.542) -- 0:04:30
373500 -- (-2481.181) (-2460.955) [-2459.754] (-2459.049) * (-2462.734) (-2464.948) [-2461.761] (-2469.414) -- 0:04:30
374000 -- (-2464.385) (-2472.101) [-2470.743] (-2473.339) * [-2462.955] (-2463.278) (-2464.409) (-2469.324) -- 0:04:29
374500 -- [-2461.997] (-2473.043) (-2459.213) (-2465.729) * (-2468.728) [-2461.221] (-2475.864) (-2469.532) -- 0:04:28
375000 -- (-2468.002) (-2469.660) [-2458.558] (-2468.794) * (-2468.531) (-2467.230) [-2464.942] (-2466.792) -- 0:04:28
Average standard deviation of split frequencies: 0.007426
375500 -- (-2461.873) [-2466.300] (-2460.643) (-2462.228) * (-2468.434) (-2467.188) [-2462.540] (-2468.378) -- 0:04:29
376000 -- (-2470.640) (-2465.466) [-2455.317] (-2471.333) * (-2468.941) (-2468.881) (-2466.670) [-2464.687] -- 0:04:28
376500 -- (-2472.486) (-2460.437) [-2459.384] (-2469.567) * (-2466.721) (-2475.464) (-2466.119) [-2464.376] -- 0:04:28
377000 -- (-2471.590) [-2463.986] (-2464.253) (-2471.982) * [-2459.540] (-2468.061) (-2459.508) (-2466.434) -- 0:04:27
377500 -- (-2468.926) (-2466.666) (-2465.772) [-2472.189] * (-2464.426) [-2470.453] (-2465.213) (-2473.331) -- 0:04:28
378000 -- [-2468.299] (-2464.842) (-2463.562) (-2463.549) * (-2478.008) [-2460.287] (-2464.165) (-2460.453) -- 0:04:28
378500 -- (-2471.783) (-2464.160) [-2458.648] (-2462.406) * (-2469.866) (-2465.035) [-2461.388] (-2467.345) -- 0:04:27
379000 -- (-2474.992) (-2462.344) (-2465.021) [-2461.889] * (-2466.812) (-2464.599) [-2457.495] (-2468.390) -- 0:04:27
379500 -- (-2471.910) (-2467.470) (-2475.739) [-2467.151] * (-2466.949) (-2463.877) [-2461.509] (-2473.432) -- 0:04:26
380000 -- [-2471.443] (-2459.817) (-2466.577) (-2470.084) * [-2460.847] (-2465.847) (-2466.057) (-2466.083) -- 0:04:27
Average standard deviation of split frequencies: 0.008097
380500 -- (-2465.143) [-2464.167] (-2458.614) (-2474.804) * (-2465.897) [-2469.767] (-2466.304) (-2464.728) -- 0:04:27
381000 -- (-2468.072) (-2472.284) (-2462.167) [-2468.486] * (-2457.672) (-2464.699) (-2463.689) [-2469.891] -- 0:04:26
381500 -- (-2470.360) [-2465.608] (-2464.410) (-2466.291) * (-2461.539) (-2461.839) [-2470.799] (-2476.787) -- 0:04:25
382000 -- (-2463.369) (-2463.575) [-2455.409] (-2470.778) * (-2462.286) (-2461.426) (-2471.030) [-2470.805] -- 0:04:25
382500 -- (-2465.279) (-2468.289) [-2458.912] (-2466.811) * (-2460.113) [-2477.537] (-2466.993) (-2463.715) -- 0:04:26
383000 -- [-2455.415] (-2481.821) (-2473.979) (-2459.072) * (-2465.335) (-2462.118) [-2464.488] (-2466.030) -- 0:04:25
383500 -- [-2463.852] (-2470.696) (-2464.340) (-2461.970) * (-2463.242) (-2461.950) [-2469.246] (-2464.453) -- 0:04:25
384000 -- (-2465.379) (-2462.064) (-2468.151) [-2459.638] * (-2471.946) [-2461.802] (-2467.950) (-2479.820) -- 0:04:24
384500 -- (-2467.692) (-2473.828) (-2464.782) [-2463.409] * (-2463.394) (-2460.159) [-2458.749] (-2468.666) -- 0:04:24
385000 -- (-2472.801) (-2463.829) (-2461.331) [-2464.792] * (-2468.041) (-2468.157) [-2463.839] (-2470.397) -- 0:04:25
Average standard deviation of split frequencies: 0.008173
385500 -- (-2467.435) (-2471.483) [-2463.452] (-2472.740) * (-2472.243) (-2468.538) (-2459.767) [-2461.654] -- 0:04:24
386000 -- (-2459.531) [-2465.942] (-2465.049) (-2472.103) * (-2474.898) [-2462.590] (-2461.668) (-2460.509) -- 0:04:24
386500 -- (-2477.910) (-2461.273) (-2466.251) [-2466.035] * (-2469.673) (-2459.163) [-2466.071] (-2465.397) -- 0:04:23
387000 -- (-2466.057) (-2459.177) (-2464.368) [-2463.033] * (-2469.035) (-2469.827) (-2468.425) [-2460.119] -- 0:04:24
387500 -- (-2464.522) (-2474.683) (-2468.391) [-2466.323] * (-2481.870) (-2468.668) (-2464.173) [-2458.956] -- 0:04:23
388000 -- (-2468.408) [-2470.215] (-2468.575) (-2461.249) * (-2461.726) [-2465.429] (-2465.038) (-2470.724) -- 0:04:23
388500 -- (-2461.356) (-2464.757) [-2472.777] (-2466.632) * [-2464.315] (-2462.361) (-2470.651) (-2484.523) -- 0:04:22
389000 -- (-2468.134) (-2466.275) (-2479.569) [-2466.040] * (-2466.754) (-2462.566) (-2466.644) [-2464.246] -- 0:04:22
389500 -- (-2464.478) (-2480.340) (-2469.122) [-2465.292] * (-2470.438) [-2464.832] (-2466.390) (-2467.785) -- 0:04:23
390000 -- (-2465.808) (-2476.151) (-2468.489) [-2465.295] * (-2464.303) (-2460.940) [-2458.536] (-2461.448) -- 0:04:22
Average standard deviation of split frequencies: 0.008447
390500 -- (-2462.107) (-2472.750) (-2461.844) [-2467.862] * (-2464.275) (-2460.391) (-2469.768) [-2464.908] -- 0:04:22
391000 -- (-2463.860) (-2469.657) (-2469.581) [-2464.511] * [-2469.496] (-2467.562) (-2465.943) (-2470.564) -- 0:04:21
391500 -- (-2466.754) (-2470.178) (-2468.832) [-2455.988] * (-2466.345) [-2465.373] (-2468.203) (-2468.237) -- 0:04:22
392000 -- (-2465.620) (-2469.351) [-2463.543] (-2474.275) * [-2464.809] (-2464.242) (-2471.901) (-2465.171) -- 0:04:22
392500 -- (-2465.838) [-2467.137] (-2475.780) (-2465.283) * (-2458.845) (-2462.917) [-2464.111] (-2476.423) -- 0:04:21
393000 -- (-2463.573) (-2469.687) [-2464.677] (-2466.771) * (-2476.167) (-2462.695) (-2473.200) [-2468.208] -- 0:04:21
393500 -- (-2481.012) (-2477.638) [-2461.654] (-2478.534) * (-2474.927) [-2463.344] (-2473.069) (-2467.512) -- 0:04:20
394000 -- (-2478.935) (-2469.283) (-2475.948) [-2462.554] * [-2464.630] (-2466.022) (-2466.689) (-2467.621) -- 0:04:21
394500 -- (-2475.648) (-2467.169) (-2467.527) [-2462.213] * (-2461.835) [-2466.409] (-2470.392) (-2460.978) -- 0:04:20
395000 -- [-2460.480] (-2462.303) (-2460.946) (-2470.532) * (-2468.907) (-2468.105) (-2471.554) [-2462.923] -- 0:04:20
Average standard deviation of split frequencies: 0.008608
395500 -- (-2464.825) (-2462.820) (-2464.332) [-2460.418] * (-2465.974) [-2455.901] (-2472.902) (-2466.435) -- 0:04:19
396000 -- (-2466.234) [-2463.208] (-2470.750) (-2467.183) * [-2463.591] (-2464.152) (-2466.713) (-2466.417) -- 0:04:19
396500 -- (-2464.270) (-2461.593) (-2468.679) [-2469.573] * (-2476.730) [-2467.531] (-2465.504) (-2463.060) -- 0:04:20
397000 -- (-2470.745) (-2468.316) (-2464.791) [-2459.961] * (-2462.693) (-2464.556) [-2469.608] (-2464.296) -- 0:04:19
397500 -- (-2464.824) (-2471.168) (-2461.759) [-2462.082] * [-2462.321] (-2469.256) (-2467.228) (-2460.274) -- 0:04:19
398000 -- [-2461.672] (-2474.083) (-2460.871) (-2472.842) * [-2466.013] (-2462.903) (-2469.192) (-2471.349) -- 0:04:18
398500 -- [-2462.261] (-2463.417) (-2462.916) (-2463.781) * [-2462.265] (-2472.297) (-2467.045) (-2462.513) -- 0:04:19
399000 -- (-2464.043) (-2471.693) (-2473.502) [-2460.026] * (-2461.003) (-2462.819) [-2459.141] (-2465.784) -- 0:04:19
399500 -- (-2467.865) (-2461.938) (-2468.496) [-2463.457] * (-2461.983) [-2465.599] (-2479.163) (-2471.837) -- 0:04:18
400000 -- (-2469.358) (-2460.607) (-2467.706) [-2455.566] * (-2464.120) (-2464.244) (-2459.408) [-2460.660] -- 0:04:18
Average standard deviation of split frequencies: 0.007874
400500 -- (-2472.564) (-2469.015) (-2464.034) [-2465.036] * (-2465.619) [-2469.684] (-2459.493) (-2471.644) -- 0:04:17
401000 -- [-2460.182] (-2467.755) (-2463.950) (-2457.663) * (-2468.958) (-2469.281) (-2468.085) [-2469.789] -- 0:04:18
401500 -- (-2463.899) (-2471.098) (-2476.597) [-2464.138] * (-2467.252) (-2471.341) (-2479.056) [-2464.957] -- 0:04:17
402000 -- (-2467.893) (-2464.738) (-2472.686) [-2465.051] * (-2460.534) [-2468.117] (-2471.082) (-2462.166) -- 0:04:17
402500 -- (-2472.013) (-2476.643) (-2472.929) [-2463.783] * (-2471.257) [-2463.660] (-2472.494) (-2464.915) -- 0:04:16
403000 -- (-2466.665) (-2460.485) (-2473.782) [-2463.736] * (-2465.871) (-2468.393) [-2459.702] (-2467.053) -- 0:04:16
403500 -- [-2465.003] (-2466.903) (-2468.809) (-2464.766) * (-2479.374) (-2466.410) [-2458.316] (-2461.316) -- 0:04:17
404000 -- (-2464.221) (-2477.525) [-2466.876] (-2472.591) * (-2474.487) (-2467.278) [-2464.009] (-2466.786) -- 0:04:16
404500 -- [-2466.493] (-2469.090) (-2462.179) (-2468.278) * (-2475.239) (-2462.758) (-2474.796) [-2456.949] -- 0:04:16
405000 -- [-2465.465] (-2469.216) (-2464.717) (-2471.459) * (-2471.843) (-2463.393) (-2464.030) [-2463.271] -- 0:04:15
Average standard deviation of split frequencies: 0.008664
405500 -- (-2470.017) [-2462.500] (-2464.757) (-2471.228) * (-2475.190) (-2464.214) [-2464.707] (-2463.122) -- 0:04:16
406000 -- (-2473.593) [-2465.811] (-2471.949) (-2465.695) * [-2467.920] (-2474.118) (-2467.269) (-2468.754) -- 0:04:16
406500 -- (-2464.996) (-2471.720) (-2461.070) [-2461.364] * (-2459.207) (-2467.544) (-2462.394) [-2458.412] -- 0:04:15
407000 -- (-2474.655) (-2466.458) [-2460.654] (-2467.722) * (-2462.362) (-2464.308) (-2463.147) [-2465.241] -- 0:04:14
407500 -- (-2465.281) (-2464.753) (-2463.544) [-2463.577] * (-2464.122) (-2462.788) [-2462.624] (-2471.571) -- 0:04:14
408000 -- [-2460.755] (-2468.301) (-2467.101) (-2471.174) * (-2462.238) (-2462.098) [-2461.986] (-2469.444) -- 0:04:15
408500 -- (-2457.682) (-2466.932) [-2458.690] (-2461.638) * (-2460.838) (-2469.577) [-2465.323] (-2461.064) -- 0:04:14
409000 -- (-2461.717) (-2465.720) [-2468.356] (-2473.008) * [-2465.609] (-2462.394) (-2471.769) (-2456.979) -- 0:04:14
409500 -- (-2469.725) (-2468.071) [-2467.610] (-2468.941) * (-2470.348) (-2467.149) [-2459.569] (-2460.562) -- 0:04:13
410000 -- [-2458.831] (-2473.738) (-2465.893) (-2464.269) * (-2472.361) [-2463.833] (-2468.160) (-2468.257) -- 0:04:13
Average standard deviation of split frequencies: 0.009978
410500 -- (-2471.603) (-2465.287) (-2466.135) [-2471.777] * (-2473.809) [-2464.031] (-2475.577) (-2465.998) -- 0:04:14
411000 -- (-2466.766) [-2469.901] (-2473.642) (-2463.306) * [-2462.938] (-2465.319) (-2470.358) (-2466.665) -- 0:04:13
411500 -- [-2464.142] (-2466.868) (-2466.676) (-2464.068) * [-2466.957] (-2467.363) (-2471.029) (-2468.681) -- 0:04:13
412000 -- (-2472.328) (-2462.864) [-2470.529] (-2462.698) * (-2468.740) (-2466.899) (-2469.218) [-2458.052] -- 0:04:12
412500 -- (-2461.187) [-2463.660] (-2464.580) (-2462.225) * (-2462.987) (-2460.623) [-2462.647] (-2467.823) -- 0:04:13
413000 -- [-2460.595] (-2461.070) (-2460.931) (-2466.030) * (-2475.611) (-2471.932) (-2473.604) [-2462.631] -- 0:04:12
413500 -- [-2466.802] (-2471.547) (-2469.961) (-2464.472) * (-2471.079) (-2479.762) [-2464.915] (-2468.932) -- 0:04:12
414000 -- (-2465.933) [-2466.086] (-2467.924) (-2466.173) * [-2465.627] (-2465.168) (-2476.654) (-2471.512) -- 0:04:11
414500 -- (-2460.841) (-2465.004) (-2474.227) [-2469.367] * [-2463.319] (-2462.858) (-2470.520) (-2469.558) -- 0:04:11
415000 -- [-2464.023] (-2466.498) (-2461.634) (-2470.002) * (-2461.220) [-2459.660] (-2464.127) (-2466.366) -- 0:04:12
Average standard deviation of split frequencies: 0.009240
415500 -- (-2466.701) (-2464.200) (-2466.679) [-2466.651] * [-2463.700] (-2465.282) (-2466.661) (-2466.388) -- 0:04:11
416000 -- (-2460.898) (-2465.811) (-2472.495) [-2464.275] * (-2471.405) (-2471.826) (-2458.380) [-2470.754] -- 0:04:11
416500 -- [-2463.523] (-2461.911) (-2475.697) (-2464.944) * (-2466.523) [-2470.504] (-2466.037) (-2471.969) -- 0:04:10
417000 -- (-2456.253) (-2466.393) [-2461.720] (-2468.906) * [-2466.465] (-2473.441) (-2473.050) (-2457.912) -- 0:04:11
417500 -- [-2462.587] (-2470.653) (-2468.618) (-2464.207) * (-2463.147) (-2467.410) (-2471.627) [-2463.876] -- 0:04:11
418000 -- (-2474.174) (-2469.917) [-2466.445] (-2468.675) * (-2465.985) (-2468.275) [-2464.344] (-2463.187) -- 0:04:10
418500 -- (-2474.798) (-2465.804) [-2479.085] (-2469.698) * (-2475.383) (-2468.027) [-2464.441] (-2474.508) -- 0:04:10
419000 -- (-2473.029) (-2473.466) [-2460.724] (-2460.034) * (-2463.075) [-2464.974] (-2465.735) (-2478.868) -- 0:04:09
419500 -- (-2463.868) (-2469.354) [-2464.221] (-2465.933) * [-2463.251] (-2469.277) (-2470.527) (-2463.768) -- 0:04:10
420000 -- (-2471.127) (-2465.528) [-2461.496] (-2468.994) * (-2467.707) (-2473.367) [-2467.923] (-2466.786) -- 0:04:09
Average standard deviation of split frequencies: 0.008965
420500 -- [-2470.130] (-2462.242) (-2469.279) (-2471.294) * (-2462.863) (-2471.745) [-2466.003] (-2462.028) -- 0:04:09
421000 -- (-2473.739) (-2465.595) [-2466.369] (-2468.290) * (-2469.550) [-2471.518] (-2473.559) (-2462.655) -- 0:04:08
421500 -- (-2464.990) (-2462.158) [-2463.074] (-2474.647) * (-2472.842) [-2469.471] (-2472.707) (-2461.097) -- 0:04:08
422000 -- [-2468.411] (-2467.032) (-2466.453) (-2461.874) * (-2468.665) [-2463.796] (-2470.901) (-2468.064) -- 0:04:09
422500 -- (-2466.848) (-2471.244) [-2464.916] (-2464.437) * (-2467.906) (-2467.205) (-2470.850) [-2460.188] -- 0:04:08
423000 -- (-2465.498) (-2469.428) [-2467.423] (-2467.135) * (-2479.101) (-2462.967) [-2464.172] (-2475.059) -- 0:04:08
423500 -- (-2468.795) [-2468.380] (-2465.989) (-2468.763) * (-2465.859) (-2463.903) [-2471.429] (-2468.910) -- 0:04:07
424000 -- (-2473.240) (-2471.184) (-2472.978) [-2468.747] * [-2457.372] (-2477.394) (-2460.709) (-2477.452) -- 0:04:08
424500 -- (-2478.011) [-2468.702] (-2465.693) (-2487.014) * [-2469.284] (-2468.458) (-2462.325) (-2476.107) -- 0:04:08
425000 -- (-2472.087) [-2462.981] (-2464.509) (-2464.093) * (-2466.567) (-2475.084) [-2465.831] (-2466.688) -- 0:04:07
Average standard deviation of split frequencies: 0.009278
425500 -- (-2469.921) [-2463.041] (-2467.619) (-2470.983) * (-2464.247) (-2472.137) (-2460.071) [-2466.024] -- 0:04:07
426000 -- (-2465.469) (-2463.687) (-2464.304) [-2458.144] * (-2469.408) (-2470.035) [-2466.506] (-2462.256) -- 0:04:06
426500 -- (-2477.119) [-2458.254] (-2464.118) (-2471.755) * [-2475.836] (-2474.040) (-2462.067) (-2462.427) -- 0:04:07
427000 -- (-2466.615) [-2466.121] (-2467.248) (-2460.417) * (-2473.635) [-2461.001] (-2466.929) (-2462.893) -- 0:04:06
427500 -- [-2466.802] (-2465.638) (-2465.257) (-2469.512) * (-2462.421) [-2472.900] (-2465.184) (-2471.657) -- 0:04:06
428000 -- (-2465.367) (-2473.564) [-2462.531] (-2466.231) * (-2466.074) (-2463.416) [-2463.407] (-2459.593) -- 0:04:05
428500 -- (-2465.810) (-2465.318) [-2469.545] (-2464.184) * (-2465.140) [-2469.597] (-2467.113) (-2465.508) -- 0:04:05
429000 -- (-2468.174) (-2461.435) [-2473.130] (-2466.634) * [-2472.166] (-2461.239) (-2467.509) (-2467.675) -- 0:04:06
429500 -- [-2463.004] (-2459.598) (-2463.371) (-2464.580) * (-2472.062) [-2464.170] (-2472.244) (-2470.982) -- 0:04:05
430000 -- [-2458.519] (-2471.201) (-2461.380) (-2461.739) * [-2464.836] (-2469.295) (-2466.893) (-2463.039) -- 0:04:05
Average standard deviation of split frequencies: 0.008167
430500 -- (-2470.313) (-2468.098) [-2463.984] (-2464.656) * (-2462.674) (-2462.398) [-2463.558] (-2461.668) -- 0:04:04
431000 -- (-2467.697) [-2473.349] (-2478.593) (-2464.241) * (-2464.508) (-2469.207) [-2464.364] (-2458.125) -- 0:04:05
431500 -- (-2462.169) (-2463.653) [-2462.494] (-2464.803) * (-2477.113) (-2458.977) (-2463.357) [-2458.665] -- 0:04:05
432000 -- [-2461.034] (-2470.868) (-2464.137) (-2461.627) * (-2476.821) (-2461.053) (-2466.700) [-2460.827] -- 0:04:04
432500 -- (-2462.784) (-2463.007) [-2462.205] (-2469.409) * (-2480.883) (-2466.066) (-2470.420) [-2465.434] -- 0:04:04
433000 -- (-2469.267) (-2472.695) (-2466.677) [-2463.408] * [-2469.212] (-2463.486) (-2478.334) (-2477.713) -- 0:04:03
433500 -- (-2469.742) [-2468.188] (-2465.915) (-2459.712) * (-2463.014) [-2468.842] (-2467.011) (-2472.930) -- 0:04:04
434000 -- (-2467.121) (-2474.648) [-2460.211] (-2464.302) * (-2464.725) (-2471.109) [-2470.719] (-2460.586) -- 0:04:03
434500 -- [-2461.240] (-2471.944) (-2468.738) (-2463.304) * (-2470.381) (-2465.220) [-2473.347] (-2468.333) -- 0:04:03
435000 -- (-2467.335) (-2463.236) (-2480.818) [-2462.020] * (-2467.479) [-2468.288] (-2465.370) (-2461.344) -- 0:04:02
Average standard deviation of split frequencies: 0.008234
435500 -- (-2470.468) [-2461.255] (-2476.117) (-2461.557) * [-2463.242] (-2471.186) (-2472.978) (-2463.184) -- 0:04:02
436000 -- (-2468.785) (-2463.222) (-2469.015) [-2462.578] * (-2463.546) [-2465.775] (-2486.657) (-2461.752) -- 0:04:03
436500 -- [-2466.440] (-2465.730) (-2461.004) (-2465.377) * (-2466.771) (-2468.087) [-2466.145] (-2467.824) -- 0:04:02
437000 -- [-2466.142] (-2462.731) (-2469.576) (-2464.497) * [-2462.493] (-2466.589) (-2467.825) (-2465.932) -- 0:04:02
437500 -- [-2467.338] (-2462.602) (-2459.534) (-2470.894) * (-2465.757) (-2465.625) (-2471.808) [-2462.914] -- 0:04:01
438000 -- [-2464.446] (-2462.601) (-2475.259) (-2474.572) * (-2465.592) (-2468.507) [-2458.687] (-2463.437) -- 0:04:02
438500 -- (-2484.811) [-2462.775] (-2462.839) (-2469.082) * (-2471.375) [-2469.694] (-2463.581) (-2464.245) -- 0:04:02
439000 -- [-2463.491] (-2465.295) (-2466.336) (-2472.352) * [-2464.657] (-2462.552) (-2468.857) (-2469.031) -- 0:04:01
439500 -- (-2461.883) (-2470.723) (-2470.826) [-2462.069] * (-2474.274) [-2467.894] (-2468.031) (-2462.692) -- 0:04:01
440000 -- [-2466.989] (-2470.780) (-2470.787) (-2464.067) * [-2472.099] (-2466.624) (-2476.768) (-2465.032) -- 0:04:00
Average standard deviation of split frequencies: 0.008229
440500 -- (-2462.758) (-2470.350) [-2464.819] (-2464.746) * [-2471.159] (-2469.193) (-2461.771) (-2462.313) -- 0:04:01
441000 -- (-2464.643) [-2464.752] (-2464.118) (-2460.322) * (-2477.043) (-2468.934) (-2462.470) [-2468.956] -- 0:04:00
441500 -- (-2465.324) (-2467.085) [-2470.487] (-2468.906) * (-2464.059) [-2465.970] (-2471.575) (-2463.271) -- 0:04:00
442000 -- (-2463.947) [-2467.068] (-2464.119) (-2476.906) * (-2478.223) [-2464.927] (-2474.234) (-2470.623) -- 0:04:01
442500 -- (-2467.668) (-2469.107) [-2463.456] (-2472.217) * [-2464.481] (-2473.444) (-2467.417) (-2462.489) -- 0:04:00
443000 -- (-2466.360) [-2462.275] (-2474.727) (-2469.256) * [-2462.094] (-2472.062) (-2475.920) (-2464.692) -- 0:04:00
443500 -- (-2457.814) (-2463.255) [-2459.375] (-2457.656) * (-2467.691) (-2465.550) (-2462.613) [-2470.995] -- 0:03:59
444000 -- (-2467.521) (-2462.038) [-2471.397] (-2465.482) * [-2455.860] (-2469.061) (-2465.741) (-2474.620) -- 0:03:59
444500 -- [-2462.008] (-2467.185) (-2476.896) (-2463.560) * (-2460.164) (-2467.969) [-2458.932] (-2463.519) -- 0:03:59
445000 -- [-2461.219] (-2469.260) (-2465.443) (-2465.289) * [-2468.674] (-2465.646) (-2466.948) (-2460.881) -- 0:03:59
Average standard deviation of split frequencies: 0.006667
445500 -- (-2468.274) [-2460.853] (-2469.482) (-2470.004) * (-2475.066) (-2464.617) (-2473.422) [-2461.941] -- 0:03:58
446000 -- (-2462.100) [-2458.184] (-2471.732) (-2461.850) * (-2469.831) [-2459.648] (-2463.242) (-2470.552) -- 0:03:58
446500 -- [-2465.146] (-2472.465) (-2463.426) (-2460.516) * (-2471.071) [-2458.717] (-2462.663) (-2465.726) -- 0:03:58
447000 -- (-2460.569) (-2470.048) (-2465.206) [-2469.395] * (-2480.291) (-2470.898) [-2464.731] (-2462.714) -- 0:03:58
447500 -- (-2459.750) (-2467.366) (-2467.563) [-2458.761] * (-2465.724) [-2463.681] (-2472.570) (-2461.746) -- 0:03:58
448000 -- (-2466.806) [-2469.734] (-2470.096) (-2468.590) * (-2468.184) (-2471.485) [-2472.535] (-2467.004) -- 0:03:57
448500 -- (-2469.053) [-2464.539] (-2466.933) (-2462.657) * [-2460.225] (-2471.439) (-2473.924) (-2473.725) -- 0:03:57
449000 -- (-2466.811) [-2462.739] (-2471.748) (-2466.372) * (-2468.434) (-2463.231) (-2470.503) [-2467.540] -- 0:03:58
449500 -- (-2466.104) (-2460.716) (-2474.979) [-2462.754] * [-2468.574] (-2470.647) (-2462.503) (-2464.785) -- 0:03:57
450000 -- [-2462.194] (-2469.478) (-2466.352) (-2468.708) * [-2463.081] (-2466.342) (-2466.087) (-2466.644) -- 0:03:57
Average standard deviation of split frequencies: 0.006517
450500 -- (-2469.828) (-2467.857) (-2471.547) [-2458.844] * (-2468.720) [-2463.909] (-2469.322) (-2468.178) -- 0:03:56
451000 -- (-2471.342) (-2469.670) (-2466.121) [-2463.460] * (-2467.922) [-2461.117] (-2464.880) (-2465.760) -- 0:03:56
451500 -- (-2482.601) [-2464.307] (-2466.249) (-2460.916) * (-2466.109) (-2459.976) [-2460.800] (-2463.423) -- 0:03:56
452000 -- (-2476.376) [-2467.303] (-2471.439) (-2470.405) * (-2462.924) [-2461.955] (-2464.236) (-2468.312) -- 0:03:56
452500 -- (-2471.501) (-2468.802) (-2467.464) [-2467.168] * [-2468.455] (-2460.204) (-2467.826) (-2463.639) -- 0:03:55
453000 -- (-2474.313) (-2467.324) (-2461.521) [-2472.564] * (-2464.613) [-2461.085] (-2472.926) (-2459.392) -- 0:03:55
453500 -- (-2474.203) (-2467.989) [-2460.870] (-2470.616) * (-2472.031) [-2458.936] (-2466.699) (-2463.120) -- 0:03:54
454000 -- (-2471.380) (-2475.677) [-2465.988] (-2472.046) * [-2467.322] (-2465.129) (-2465.346) (-2461.408) -- 0:03:55
454500 -- (-2468.888) (-2462.431) [-2464.877] (-2468.172) * (-2465.651) (-2468.150) [-2464.993] (-2465.626) -- 0:03:55
455000 -- (-2472.592) [-2464.757] (-2471.907) (-2480.380) * (-2469.942) (-2464.138) (-2470.614) [-2464.801] -- 0:03:54
Average standard deviation of split frequencies: 0.007316
455500 -- (-2461.502) [-2470.030] (-2463.698) (-2461.811) * (-2467.394) (-2473.138) (-2471.596) [-2467.682] -- 0:03:54
456000 -- [-2459.105] (-2469.612) (-2470.985) (-2465.652) * [-2464.695] (-2467.006) (-2476.352) (-2469.838) -- 0:03:55
456500 -- (-2462.565) (-2474.588) (-2476.031) [-2462.908] * (-2463.202) (-2466.575) (-2468.349) [-2466.814] -- 0:03:54
457000 -- [-2460.291] (-2470.955) (-2467.359) (-2461.419) * (-2461.132) [-2460.273] (-2461.910) (-2467.227) -- 0:03:54
457500 -- (-2467.255) [-2460.312] (-2468.612) (-2464.491) * (-2467.428) (-2466.894) (-2460.181) [-2459.419] -- 0:03:53
458000 -- [-2459.836] (-2463.793) (-2474.330) (-2474.132) * (-2469.832) (-2469.843) (-2473.559) [-2464.694] -- 0:03:53
458500 -- (-2462.380) (-2465.218) (-2468.676) [-2463.700] * [-2464.895] (-2458.487) (-2466.992) (-2475.248) -- 0:03:53
459000 -- [-2465.755] (-2459.308) (-2466.240) (-2465.481) * (-2462.556) [-2457.412] (-2461.056) (-2478.048) -- 0:03:53
459500 -- (-2472.995) [-2466.776] (-2467.964) (-2478.532) * (-2466.439) [-2464.865] (-2471.336) (-2461.921) -- 0:03:52
460000 -- [-2461.847] (-2471.963) (-2471.751) (-2481.324) * (-2467.715) (-2459.345) [-2464.952] (-2466.448) -- 0:03:52
Average standard deviation of split frequencies: 0.008186
460500 -- (-2466.192) (-2468.589) (-2465.358) [-2461.438] * [-2461.133] (-2468.798) (-2474.582) (-2471.494) -- 0:03:51
461000 -- [-2467.257] (-2474.354) (-2468.289) (-2476.606) * (-2462.734) [-2457.103] (-2463.276) (-2465.869) -- 0:03:52
461500 -- (-2465.752) (-2476.922) [-2460.964] (-2473.249) * [-2467.594] (-2459.888) (-2469.936) (-2480.650) -- 0:03:52
462000 -- (-2462.858) (-2470.603) [-2469.699] (-2472.147) * [-2467.254] (-2465.944) (-2469.502) (-2483.765) -- 0:03:51
462500 -- [-2457.576] (-2466.210) (-2463.200) (-2473.274) * (-2467.111) [-2466.058] (-2475.447) (-2476.398) -- 0:03:51
463000 -- (-2465.615) (-2473.747) (-2462.501) [-2466.947] * (-2472.223) [-2454.928] (-2469.534) (-2469.606) -- 0:03:51
463500 -- (-2465.740) [-2463.290] (-2471.276) (-2463.850) * (-2467.709) (-2466.930) [-2456.149] (-2470.995) -- 0:03:51
464000 -- [-2459.218] (-2462.063) (-2471.706) (-2468.141) * (-2466.434) (-2469.325) [-2459.574] (-2462.591) -- 0:03:51
464500 -- [-2461.563] (-2469.187) (-2472.921) (-2462.342) * (-2467.672) (-2465.101) [-2467.628] (-2476.814) -- 0:03:50
465000 -- (-2463.533) [-2468.350] (-2477.705) (-2465.672) * (-2468.710) [-2459.428] (-2467.379) (-2471.005) -- 0:03:50
Average standard deviation of split frequencies: 0.008093
465500 -- [-2466.899] (-2463.791) (-2466.890) (-2466.627) * [-2465.295] (-2464.321) (-2464.359) (-2466.131) -- 0:03:50
466000 -- (-2469.110) [-2476.107] (-2465.024) (-2471.802) * (-2472.618) [-2461.314] (-2461.694) (-2459.100) -- 0:03:50
466500 -- (-2480.998) (-2471.711) [-2464.955] (-2464.858) * [-2460.442] (-2470.199) (-2457.204) (-2461.367) -- 0:03:49
467000 -- [-2467.744] (-2469.630) (-2462.212) (-2463.272) * (-2467.511) [-2460.392] (-2473.835) (-2470.905) -- 0:03:49
467500 -- (-2467.810) (-2467.100) (-2468.988) [-2466.938] * (-2471.667) (-2463.336) (-2462.152) [-2460.090] -- 0:03:50
468000 -- (-2467.033) (-2468.232) (-2465.995) [-2464.828] * [-2467.286] (-2461.334) (-2465.348) (-2461.720) -- 0:03:49
468500 -- (-2468.870) (-2470.331) (-2462.737) [-2473.453] * (-2475.100) [-2463.160] (-2469.936) (-2458.842) -- 0:03:49
469000 -- [-2464.313] (-2476.376) (-2469.654) (-2469.476) * (-2469.107) (-2464.859) (-2464.209) [-2463.411] -- 0:03:48
469500 -- (-2464.393) [-2464.576] (-2479.807) (-2474.053) * (-2477.856) (-2471.418) [-2471.781] (-2465.521) -- 0:03:48
470000 -- [-2459.200] (-2475.070) (-2462.966) (-2476.638) * (-2469.008) (-2469.493) [-2464.562] (-2459.270) -- 0:03:48
Average standard deviation of split frequencies: 0.009168
470500 -- [-2463.940] (-2473.832) (-2464.224) (-2476.159) * (-2461.952) (-2463.750) [-2465.044] (-2462.288) -- 0:03:48
471000 -- (-2468.643) (-2466.437) [-2473.639] (-2461.917) * (-2471.537) [-2459.107] (-2478.812) (-2465.996) -- 0:03:47
471500 -- [-2469.154] (-2478.702) (-2466.871) (-2460.478) * (-2461.878) [-2462.815] (-2469.192) (-2473.543) -- 0:03:47
472000 -- [-2468.171] (-2465.938) (-2461.191) (-2471.599) * [-2460.386] (-2460.879) (-2466.464) (-2464.831) -- 0:03:47
472500 -- (-2460.243) (-2465.305) [-2470.365] (-2473.989) * (-2472.121) [-2465.507] (-2468.662) (-2465.841) -- 0:03:47
473000 -- (-2458.525) (-2467.612) [-2467.160] (-2467.727) * (-2468.783) (-2469.106) (-2477.227) [-2463.777] -- 0:03:47
473500 -- [-2466.268] (-2468.439) (-2470.918) (-2465.275) * (-2472.229) [-2464.794] (-2469.354) (-2466.187) -- 0:03:46
474000 -- (-2474.268) (-2470.326) [-2465.473] (-2471.270) * (-2464.747) (-2462.537) (-2462.521) [-2465.807] -- 0:03:46
474500 -- (-2471.209) (-2468.571) [-2468.774] (-2463.272) * [-2461.959] (-2469.589) (-2463.583) (-2484.029) -- 0:03:47
475000 -- (-2468.047) (-2467.532) [-2464.979] (-2469.869) * [-2467.936] (-2458.794) (-2466.543) (-2477.626) -- 0:03:46
Average standard deviation of split frequencies: 0.007999
475500 -- (-2463.092) [-2466.915] (-2476.095) (-2464.240) * [-2472.038] (-2466.271) (-2460.150) (-2471.599) -- 0:03:46
476000 -- [-2465.491] (-2464.312) (-2468.856) (-2470.621) * (-2471.654) (-2461.393) [-2461.093] (-2470.773) -- 0:03:45
476500 -- [-2467.242] (-2474.424) (-2479.789) (-2467.678) * [-2463.544] (-2463.729) (-2464.127) (-2462.694) -- 0:03:45
477000 -- (-2464.279) (-2467.813) [-2463.819] (-2476.806) * (-2474.629) (-2466.731) (-2467.613) [-2468.792] -- 0:03:45
477500 -- [-2467.699] (-2466.486) (-2459.748) (-2472.754) * [-2471.783] (-2462.489) (-2463.369) (-2470.944) -- 0:03:45
478000 -- (-2462.345) (-2462.169) (-2462.030) [-2468.066] * (-2461.781) (-2461.082) [-2467.383] (-2466.645) -- 0:03:44
478500 -- (-2464.525) (-2465.738) (-2466.101) [-2462.146] * (-2461.974) (-2475.523) [-2475.800] (-2469.082) -- 0:03:44
479000 -- (-2463.069) (-2470.240) (-2464.157) [-2462.005] * (-2462.016) (-2471.951) [-2462.594] (-2479.023) -- 0:03:44
479500 -- (-2481.521) (-2468.796) [-2462.504] (-2478.238) * [-2470.459] (-2468.107) (-2460.785) (-2459.628) -- 0:03:44
480000 -- [-2462.189] (-2463.129) (-2465.543) (-2463.605) * (-2472.267) (-2473.225) (-2468.020) [-2461.776] -- 0:03:44
Average standard deviation of split frequencies: 0.008990
480500 -- [-2468.442] (-2463.291) (-2472.109) (-2471.094) * [-2470.381] (-2468.666) (-2472.572) (-2463.413) -- 0:03:43
481000 -- (-2468.775) (-2459.650) [-2462.380] (-2467.730) * (-2467.286) [-2462.196] (-2478.464) (-2471.413) -- 0:03:43
481500 -- (-2470.274) [-2464.502] (-2466.663) (-2464.586) * [-2464.592] (-2464.935) (-2468.164) (-2468.651) -- 0:03:43
482000 -- (-2465.340) (-2467.205) (-2469.850) [-2464.550] * (-2471.123) [-2465.045] (-2469.871) (-2473.930) -- 0:03:43
482500 -- (-2474.060) [-2462.740] (-2462.115) (-2464.901) * (-2465.188) (-2466.271) [-2460.728] (-2477.653) -- 0:03:43
483000 -- (-2465.105) (-2467.128) (-2464.612) [-2471.443] * (-2468.465) (-2468.878) (-2464.417) [-2469.043] -- 0:03:42
483500 -- (-2472.639) (-2474.924) [-2464.795] (-2472.668) * (-2463.456) (-2478.590) (-2469.056) [-2471.374] -- 0:03:42
484000 -- (-2463.886) (-2464.963) (-2475.593) [-2462.995] * (-2467.487) (-2461.421) [-2461.286] (-2462.484) -- 0:03:42
484500 -- [-2465.953] (-2463.349) (-2465.904) (-2467.038) * (-2475.930) (-2460.797) (-2467.463) [-2461.992] -- 0:03:42
485000 -- (-2465.901) (-2465.724) [-2463.509] (-2467.727) * (-2463.438) (-2472.908) [-2466.913] (-2464.371) -- 0:03:41
Average standard deviation of split frequencies: 0.009103
485500 -- (-2472.555) [-2469.587] (-2464.350) (-2467.176) * (-2468.928) (-2466.963) (-2468.644) [-2466.192] -- 0:03:41
486000 -- [-2472.249] (-2469.342) (-2464.276) (-2468.144) * (-2468.188) (-2477.145) (-2469.174) [-2462.238] -- 0:03:41
486500 -- (-2460.553) (-2472.023) [-2460.680] (-2479.547) * (-2457.852) [-2472.140] (-2470.637) (-2473.755) -- 0:03:41
487000 -- [-2460.922] (-2466.484) (-2459.897) (-2465.744) * (-2465.043) (-2466.660) (-2462.711) [-2485.639] -- 0:03:41
487500 -- [-2476.577] (-2466.329) (-2463.039) (-2485.160) * (-2463.621) (-2472.285) (-2465.741) [-2471.060] -- 0:03:40
488000 -- [-2465.832] (-2464.624) (-2469.226) (-2471.281) * (-2468.140) (-2467.507) [-2473.722] (-2481.363) -- 0:03:40
488500 -- (-2467.182) [-2457.264] (-2461.199) (-2461.185) * (-2464.885) (-2465.749) [-2470.615] (-2481.006) -- 0:03:40
489000 -- [-2464.715] (-2477.655) (-2462.316) (-2468.591) * [-2464.136] (-2466.499) (-2468.895) (-2471.242) -- 0:03:40
489500 -- (-2459.587) (-2469.409) [-2467.441] (-2463.737) * [-2463.937] (-2470.484) (-2465.720) (-2474.439) -- 0:03:40
490000 -- [-2460.740] (-2468.009) (-2463.024) (-2459.108) * [-2463.719] (-2475.273) (-2470.609) (-2464.262) -- 0:03:39
Average standard deviation of split frequencies: 0.008407
490500 -- (-2469.241) (-2466.324) [-2466.851] (-2469.190) * (-2466.640) (-2471.153) [-2462.840] (-2466.438) -- 0:03:39
491000 -- (-2462.570) (-2462.816) [-2469.546] (-2476.887) * (-2462.823) (-2469.877) (-2464.728) [-2463.398] -- 0:03:39
491500 -- (-2463.992) (-2470.062) (-2460.406) [-2467.110] * (-2461.753) [-2472.212] (-2463.712) (-2468.002) -- 0:03:39
492000 -- (-2467.942) [-2466.866] (-2464.620) (-2461.410) * (-2467.049) [-2463.166] (-2464.235) (-2462.432) -- 0:03:38
492500 -- (-2468.134) [-2464.277] (-2469.008) (-2463.639) * (-2469.338) [-2468.661] (-2464.378) (-2465.927) -- 0:03:38
493000 -- (-2471.882) (-2465.709) (-2460.227) [-2462.471] * (-2473.116) (-2462.023) [-2457.916] (-2467.358) -- 0:03:38
493500 -- (-2472.988) [-2460.651] (-2465.659) (-2463.091) * (-2466.600) (-2469.817) [-2464.264] (-2465.023) -- 0:03:38
494000 -- [-2465.662] (-2466.523) (-2466.836) (-2466.770) * (-2461.010) (-2461.557) [-2460.909] (-2464.890) -- 0:03:38
494500 -- (-2474.258) (-2468.111) (-2472.013) [-2458.647] * (-2465.458) (-2469.294) (-2468.098) [-2461.474] -- 0:03:37
495000 -- [-2462.180] (-2464.114) (-2474.980) (-2467.508) * (-2461.576) (-2467.883) (-2463.363) [-2467.590] -- 0:03:37
Average standard deviation of split frequencies: 0.007841
495500 -- (-2470.654) (-2471.404) [-2471.914] (-2474.119) * (-2467.419) (-2460.463) (-2464.990) [-2463.935] -- 0:03:37
496000 -- (-2476.103) (-2459.391) (-2471.114) [-2459.921] * (-2464.663) [-2455.345] (-2481.539) (-2469.637) -- 0:03:37
496500 -- (-2474.952) (-2467.664) [-2474.144] (-2464.075) * (-2466.001) (-2463.778) [-2471.028] (-2468.322) -- 0:03:37
497000 -- [-2469.151] (-2466.261) (-2470.475) (-2466.028) * (-2466.598) (-2471.009) (-2469.895) [-2469.227] -- 0:03:36
497500 -- (-2472.248) (-2469.105) (-2470.110) [-2473.406] * (-2469.826) [-2461.449] (-2475.618) (-2466.234) -- 0:03:36
498000 -- [-2461.074] (-2470.633) (-2466.398) (-2468.275) * (-2464.101) [-2458.587] (-2464.600) (-2460.557) -- 0:03:36
498500 -- (-2466.683) (-2466.278) [-2467.075] (-2466.097) * (-2470.193) (-2465.248) (-2466.251) [-2470.539] -- 0:03:36
499000 -- (-2466.338) [-2458.232] (-2470.890) (-2469.477) * (-2472.895) (-2466.628) [-2463.791] (-2468.558) -- 0:03:35
499500 -- (-2465.864) [-2465.874] (-2472.077) (-2467.459) * (-2474.709) (-2466.094) [-2461.151] (-2479.874) -- 0:03:35
500000 -- [-2462.199] (-2464.087) (-2472.638) (-2467.189) * [-2462.537] (-2462.413) (-2460.489) (-2475.791) -- 0:03:35
Average standard deviation of split frequencies: 0.008552
500500 -- (-2472.086) (-2471.230) (-2470.167) [-2464.415] * [-2463.706] (-2478.963) (-2470.363) (-2465.733) -- 0:03:35
501000 -- (-2470.154) (-2457.613) [-2463.706] (-2469.277) * (-2463.066) [-2464.711] (-2470.193) (-2473.853) -- 0:03:35
501500 -- [-2462.041] (-2467.594) (-2463.888) (-2475.099) * (-2462.836) [-2466.738] (-2464.049) (-2459.209) -- 0:03:34
502000 -- (-2457.830) [-2458.038] (-2476.684) (-2467.419) * (-2466.865) (-2470.547) [-2459.851] (-2463.616) -- 0:03:34
502500 -- (-2465.556) (-2468.974) [-2469.809] (-2472.684) * (-2467.471) [-2462.998] (-2475.770) (-2467.763) -- 0:03:34
503000 -- (-2465.789) [-2462.774] (-2469.119) (-2471.572) * [-2472.909] (-2464.479) (-2467.261) (-2471.700) -- 0:03:34
503500 -- (-2465.798) (-2462.061) [-2460.522] (-2469.685) * (-2475.403) (-2470.752) (-2476.409) [-2471.300] -- 0:03:33
504000 -- (-2463.383) (-2473.630) [-2458.812] (-2467.888) * (-2466.883) (-2478.744) [-2469.968] (-2466.722) -- 0:03:33
504500 -- (-2460.029) (-2480.527) (-2463.672) [-2469.159] * (-2463.669) (-2464.461) (-2464.888) [-2463.161] -- 0:03:33
505000 -- (-2461.651) [-2468.077] (-2466.145) (-2464.816) * [-2465.828] (-2466.580) (-2464.555) (-2469.167) -- 0:03:33
Average standard deviation of split frequencies: 0.009173
505500 -- (-2469.464) (-2462.070) (-2467.162) [-2456.173] * (-2466.965) (-2472.091) [-2466.037] (-2467.825) -- 0:03:33
506000 -- (-2462.168) (-2467.626) (-2471.339) [-2462.239] * (-2466.637) (-2469.467) (-2472.562) [-2461.099] -- 0:03:32
506500 -- [-2464.913] (-2460.595) (-2485.583) (-2462.493) * (-2466.533) [-2468.772] (-2472.075) (-2458.068) -- 0:03:32
507000 -- (-2473.181) [-2473.059] (-2472.356) (-2462.777) * (-2465.175) [-2461.390] (-2472.568) (-2462.195) -- 0:03:31
507500 -- (-2467.865) (-2469.082) [-2462.375] (-2464.289) * [-2463.682] (-2472.809) (-2465.749) (-2461.922) -- 0:03:32
508000 -- (-2467.087) [-2466.528] (-2471.920) (-2470.642) * (-2461.465) (-2470.749) [-2461.275] (-2467.564) -- 0:03:32
508500 -- [-2459.880] (-2472.434) (-2462.478) (-2472.886) * (-2460.753) (-2461.876) (-2459.146) [-2465.543] -- 0:03:31
509000 -- (-2477.341) (-2465.375) (-2463.861) [-2461.491] * [-2460.430] (-2458.672) (-2459.281) (-2470.746) -- 0:03:31
509500 -- (-2464.380) (-2464.774) (-2467.238) [-2460.750] * (-2465.527) (-2473.590) [-2459.620] (-2463.424) -- 0:03:31
510000 -- [-2461.524] (-2466.474) (-2472.013) (-2462.802) * (-2464.856) (-2461.948) [-2460.121] (-2475.525) -- 0:03:31
Average standard deviation of split frequencies: 0.009586
510500 -- (-2467.259) (-2462.001) (-2472.752) [-2462.059] * (-2467.813) [-2461.440] (-2461.969) (-2461.682) -- 0:03:30
511000 -- (-2465.031) [-2464.376] (-2471.715) (-2461.698) * (-2469.535) (-2473.342) (-2454.720) [-2463.538] -- 0:03:30
511500 -- (-2460.284) (-2460.637) (-2463.820) [-2460.286] * [-2465.415] (-2469.770) (-2474.122) (-2462.116) -- 0:03:30
512000 -- [-2458.220] (-2473.462) (-2467.228) (-2472.127) * [-2466.120] (-2472.614) (-2469.723) (-2468.297) -- 0:03:30
512500 -- (-2471.729) [-2465.386] (-2465.743) (-2469.778) * (-2470.038) (-2466.569) [-2463.667] (-2466.300) -- 0:03:30
513000 -- [-2467.384] (-2468.729) (-2467.142) (-2469.051) * (-2472.062) (-2465.456) (-2465.381) [-2467.727] -- 0:03:29
513500 -- (-2464.870) (-2474.690) [-2464.906] (-2478.132) * (-2461.041) (-2476.214) [-2460.328] (-2466.942) -- 0:03:29
514000 -- (-2475.747) (-2464.368) [-2460.836] (-2465.522) * (-2468.688) (-2462.202) [-2461.871] (-2468.899) -- 0:03:28
514500 -- (-2465.653) (-2467.656) [-2463.770] (-2455.009) * (-2468.503) [-2465.266] (-2462.389) (-2468.805) -- 0:03:29
515000 -- (-2467.772) [-2465.113] (-2467.215) (-2461.728) * (-2465.109) [-2458.262] (-2472.433) (-2474.015) -- 0:03:29
Average standard deviation of split frequencies: 0.010330
515500 -- [-2464.175] (-2464.887) (-2468.434) (-2466.711) * (-2469.360) [-2460.716] (-2468.402) (-2471.636) -- 0:03:28
516000 -- (-2463.480) [-2462.417] (-2460.553) (-2466.554) * (-2462.981) [-2467.845] (-2464.610) (-2467.489) -- 0:03:28
516500 -- (-2466.875) (-2459.723) (-2467.422) [-2465.650] * (-2468.836) (-2467.091) [-2469.708] (-2469.632) -- 0:03:28
517000 -- [-2460.624] (-2462.756) (-2461.014) (-2466.978) * (-2474.928) (-2465.061) (-2469.851) [-2465.099] -- 0:03:28
517500 -- (-2470.998) [-2468.655] (-2467.866) (-2467.242) * (-2467.750) [-2459.363] (-2467.177) (-2465.716) -- 0:03:27
518000 -- (-2464.688) (-2472.015) [-2460.921] (-2458.762) * (-2469.175) [-2461.545] (-2459.220) (-2472.830) -- 0:03:27
518500 -- (-2473.245) (-2475.114) [-2463.536] (-2462.596) * (-2467.158) (-2469.788) [-2460.029] (-2463.013) -- 0:03:27
519000 -- (-2471.164) (-2468.351) (-2472.318) [-2461.557] * (-2464.841) [-2457.572] (-2459.139) (-2467.963) -- 0:03:27
519500 -- (-2468.627) (-2464.787) (-2466.476) [-2469.828] * (-2468.167) (-2464.492) [-2461.227] (-2471.939) -- 0:03:27
520000 -- (-2464.959) (-2475.269) [-2466.377] (-2467.670) * (-2474.671) (-2471.179) [-2461.643] (-2467.629) -- 0:03:26
Average standard deviation of split frequencies: 0.011143
520500 -- [-2460.789] (-2461.686) (-2473.903) (-2471.059) * (-2476.590) (-2461.154) [-2457.197] (-2471.893) -- 0:03:26
521000 -- (-2458.708) [-2461.313] (-2467.289) (-2462.407) * (-2479.569) [-2461.366] (-2471.569) (-2458.899) -- 0:03:26
521500 -- (-2468.924) [-2467.709] (-2463.244) (-2460.658) * (-2473.242) [-2466.578] (-2468.380) (-2466.811) -- 0:03:26
522000 -- (-2470.953) (-2458.506) [-2465.415] (-2474.854) * (-2486.442) (-2467.921) [-2464.465] (-2459.602) -- 0:03:26
522500 -- [-2473.762] (-2462.518) (-2469.550) (-2461.745) * (-2467.585) (-2465.961) (-2466.325) [-2463.392] -- 0:03:25
523000 -- (-2465.722) [-2460.213] (-2462.707) (-2466.558) * (-2464.888) [-2462.739] (-2470.070) (-2468.843) -- 0:03:25
523500 -- (-2466.862) (-2473.995) (-2459.971) [-2456.411] * (-2465.797) (-2462.951) [-2473.289] (-2468.486) -- 0:03:25
524000 -- (-2462.872) [-2458.498] (-2463.377) (-2464.754) * (-2459.221) [-2461.705] (-2468.994) (-2465.721) -- 0:03:25
524500 -- [-2463.244] (-2469.372) (-2472.015) (-2462.968) * (-2460.462) [-2475.524] (-2466.944) (-2467.333) -- 0:03:24
525000 -- (-2464.257) [-2458.514] (-2470.899) (-2469.483) * (-2465.550) (-2475.192) [-2461.251] (-2467.875) -- 0:03:24
Average standard deviation of split frequencies: 0.010341
525500 -- (-2469.398) (-2466.836) [-2460.977] (-2474.306) * (-2468.846) (-2475.423) [-2468.127] (-2470.886) -- 0:03:24
526000 -- (-2467.180) (-2469.619) (-2461.193) [-2463.025] * [-2471.565] (-2465.997) (-2459.184) (-2468.911) -- 0:03:24
526500 -- (-2467.160) [-2464.433] (-2465.085) (-2463.708) * [-2466.160] (-2466.163) (-2459.177) (-2466.986) -- 0:03:24
527000 -- [-2466.847] (-2469.209) (-2466.637) (-2458.005) * (-2469.760) (-2467.409) [-2466.861] (-2466.758) -- 0:03:23
527500 -- (-2477.123) (-2464.003) [-2460.150] (-2470.295) * (-2469.529) (-2467.205) (-2461.724) [-2461.301] -- 0:03:23
528000 -- (-2470.070) [-2460.043] (-2463.287) (-2458.635) * (-2468.099) (-2473.189) (-2469.313) [-2466.607] -- 0:03:23
528500 -- (-2473.356) [-2468.784] (-2463.514) (-2463.866) * (-2459.037) (-2474.334) (-2470.767) [-2462.146] -- 0:03:23
529000 -- (-2459.803) (-2470.195) (-2475.821) [-2456.229] * (-2466.179) (-2461.677) [-2461.008] (-2460.067) -- 0:03:23
529500 -- (-2471.765) (-2465.206) (-2467.400) [-2462.960] * [-2472.476] (-2468.626) (-2463.810) (-2470.908) -- 0:03:22
530000 -- (-2462.929) [-2463.839] (-2470.808) (-2463.779) * [-2465.008] (-2475.398) (-2463.242) (-2466.704) -- 0:03:22
Average standard deviation of split frequencies: 0.011343
530500 -- (-2472.441) (-2467.963) (-2467.100) [-2462.118] * (-2467.127) (-2471.663) [-2466.308] (-2467.865) -- 0:03:22
531000 -- (-2460.353) (-2476.486) (-2467.954) [-2456.663] * (-2463.600) (-2473.165) [-2468.186] (-2461.532) -- 0:03:22
531500 -- [-2464.509] (-2463.909) (-2462.317) (-2455.858) * (-2454.796) (-2461.794) (-2465.185) [-2469.721] -- 0:03:21
532000 -- (-2471.625) (-2479.881) [-2460.759] (-2464.333) * (-2469.141) (-2463.365) (-2464.287) [-2466.734] -- 0:03:21
532500 -- (-2471.075) (-2464.709) (-2467.475) [-2468.846] * (-2465.983) (-2466.360) (-2462.095) [-2459.167] -- 0:03:21
533000 -- (-2473.917) [-2465.211] (-2468.663) (-2478.961) * (-2467.363) (-2462.490) (-2466.012) [-2463.669] -- 0:03:21
533500 -- (-2470.205) (-2463.052) (-2466.404) [-2460.854] * (-2466.594) (-2466.660) [-2458.009] (-2467.343) -- 0:03:21
534000 -- (-2467.262) (-2461.622) (-2466.520) [-2460.908] * [-2469.127] (-2471.868) (-2467.680) (-2460.990) -- 0:03:20
534500 -- [-2460.629] (-2464.153) (-2476.210) (-2470.308) * (-2471.952) (-2470.511) (-2469.768) [-2471.222] -- 0:03:20
535000 -- (-2474.694) [-2462.662] (-2471.737) (-2478.664) * (-2456.012) (-2480.851) (-2469.522) [-2467.172] -- 0:03:20
Average standard deviation of split frequencies: 0.010689
535500 -- (-2469.892) (-2462.357) [-2467.224] (-2466.511) * [-2467.494] (-2468.403) (-2465.730) (-2461.274) -- 0:03:20
536000 -- [-2462.850] (-2460.737) (-2467.269) (-2458.083) * [-2468.292] (-2464.259) (-2463.048) (-2474.830) -- 0:03:19
536500 -- (-2463.543) (-2467.174) (-2464.161) [-2461.291] * (-2457.929) (-2474.236) (-2471.976) [-2460.861] -- 0:03:19
537000 -- (-2462.817) (-2462.483) (-2475.051) [-2463.293] * [-2467.955] (-2464.900) (-2471.062) (-2459.630) -- 0:03:19
537500 -- (-2462.337) (-2466.038) (-2461.156) [-2464.105] * (-2464.873) [-2460.782] (-2470.936) (-2470.674) -- 0:03:19
538000 -- [-2459.172] (-2465.011) (-2466.066) (-2471.145) * (-2469.992) [-2465.857] (-2464.461) (-2461.709) -- 0:03:19
538500 -- (-2465.652) (-2470.013) (-2472.107) [-2466.917] * (-2471.771) (-2471.578) [-2462.651] (-2466.900) -- 0:03:18
539000 -- (-2463.628) (-2468.309) [-2464.870] (-2469.795) * (-2464.737) [-2462.274] (-2473.846) (-2462.775) -- 0:03:18
539500 -- (-2462.005) (-2469.226) (-2471.076) [-2459.259] * [-2471.700] (-2467.313) (-2465.765) (-2465.411) -- 0:03:18
540000 -- (-2461.580) (-2469.972) [-2460.120] (-2472.490) * (-2470.054) (-2463.962) (-2471.572) [-2475.766] -- 0:03:18
Average standard deviation of split frequencies: 0.009792
540500 -- (-2464.578) (-2478.890) [-2460.212] (-2466.711) * [-2464.800] (-2475.884) (-2468.876) (-2462.083) -- 0:03:18
541000 -- (-2474.877) (-2476.613) [-2465.999] (-2462.743) * (-2459.997) (-2472.825) [-2466.836] (-2478.787) -- 0:03:17
541500 -- (-2471.959) (-2480.739) (-2469.957) [-2462.004] * [-2459.816] (-2469.065) (-2469.338) (-2472.576) -- 0:03:17
542000 -- (-2467.156) (-2480.465) (-2466.202) [-2460.741] * [-2467.689] (-2466.701) (-2476.234) (-2466.869) -- 0:03:17
542500 -- [-2461.475] (-2471.967) (-2468.120) (-2463.681) * [-2465.822] (-2471.000) (-2469.959) (-2472.690) -- 0:03:17
543000 -- (-2469.665) [-2460.690] (-2462.520) (-2473.608) * [-2460.290] (-2468.461) (-2466.381) (-2469.857) -- 0:03:16
543500 -- [-2467.271] (-2465.380) (-2475.693) (-2465.072) * (-2458.634) (-2466.560) [-2462.150] (-2470.694) -- 0:03:16
544000 -- (-2466.437) (-2470.495) [-2463.339] (-2475.394) * [-2462.828] (-2462.286) (-2468.384) (-2465.021) -- 0:03:16
544500 -- [-2466.251] (-2469.559) (-2467.452) (-2461.222) * (-2459.433) [-2464.686] (-2471.035) (-2463.887) -- 0:03:16
545000 -- [-2460.378] (-2474.959) (-2466.490) (-2466.876) * (-2465.515) [-2463.399] (-2466.715) (-2466.761) -- 0:03:16
Average standard deviation of split frequencies: 0.009896
545500 -- (-2464.872) [-2467.615] (-2481.398) (-2467.432) * (-2468.097) (-2465.002) [-2464.521] (-2470.819) -- 0:03:15
546000 -- (-2479.250) (-2465.225) [-2467.216] (-2464.891) * (-2475.039) (-2464.625) (-2466.865) [-2462.840] -- 0:03:15
546500 -- (-2467.133) (-2463.019) [-2471.791] (-2463.513) * (-2464.753) [-2470.130] (-2474.930) (-2472.700) -- 0:03:15
547000 -- (-2473.649) (-2465.528) (-2470.841) [-2462.903] * [-2466.420] (-2468.556) (-2466.845) (-2470.190) -- 0:03:15
547500 -- [-2464.389] (-2461.421) (-2463.181) (-2467.722) * (-2461.306) (-2473.057) [-2471.004] (-2464.795) -- 0:03:15
548000 -- (-2478.854) (-2466.440) (-2459.464) [-2461.588] * (-2467.346) [-2470.225] (-2477.676) (-2469.667) -- 0:03:14
548500 -- (-2472.017) (-2463.604) (-2459.792) [-2463.048] * [-2462.561] (-2469.341) (-2480.742) (-2469.707) -- 0:03:14
549000 -- (-2469.812) [-2465.513] (-2468.613) (-2468.376) * (-2465.700) (-2468.542) [-2460.884] (-2473.159) -- 0:03:14
549500 -- [-2470.850] (-2476.583) (-2471.719) (-2466.730) * (-2472.858) (-2467.111) [-2460.598] (-2465.993) -- 0:03:14
550000 -- (-2472.159) (-2463.878) [-2466.275] (-2468.681) * [-2467.170] (-2471.924) (-2467.451) (-2460.993) -- 0:03:13
Average standard deviation of split frequencies: 0.010009
550500 -- (-2469.353) (-2459.488) [-2466.933] (-2471.722) * (-2466.367) (-2473.753) [-2467.205] (-2467.200) -- 0:03:13
551000 -- (-2469.427) (-2466.240) [-2465.268] (-2464.376) * (-2463.525) (-2473.138) (-2472.730) [-2457.484] -- 0:03:13
551500 -- (-2460.306) (-2465.299) [-2462.807] (-2469.791) * (-2464.208) (-2460.239) [-2463.547] (-2463.623) -- 0:03:13
552000 -- (-2463.922) (-2460.710) (-2468.267) [-2468.436] * (-2475.334) [-2468.445] (-2462.091) (-2469.408) -- 0:03:13
552500 -- (-2461.290) [-2463.977] (-2463.028) (-2461.469) * (-2467.940) (-2469.633) [-2472.011] (-2464.699) -- 0:03:12
553000 -- (-2466.544) [-2459.808] (-2470.755) (-2465.644) * (-2464.882) (-2465.123) [-2458.660] (-2479.438) -- 0:03:12
553500 -- (-2465.284) [-2463.805] (-2468.738) (-2455.305) * (-2472.174) [-2461.081] (-2466.207) (-2467.363) -- 0:03:11
554000 -- (-2463.110) (-2458.104) [-2470.722] (-2462.470) * (-2472.336) (-2473.119) [-2469.596] (-2466.000) -- 0:03:12
554500 -- (-2477.512) [-2459.474] (-2468.891) (-2464.393) * (-2475.181) [-2465.022] (-2469.046) (-2467.585) -- 0:03:12
555000 -- (-2473.979) (-2471.169) (-2468.871) [-2467.236] * (-2464.807) (-2462.835) [-2461.372] (-2473.406) -- 0:03:11
Average standard deviation of split frequencies: 0.009979
555500 -- (-2473.681) [-2470.174] (-2466.375) (-2471.196) * (-2465.109) (-2467.159) [-2468.076] (-2460.880) -- 0:03:11
556000 -- (-2469.794) (-2472.742) (-2465.868) [-2469.392] * [-2464.253] (-2467.423) (-2468.656) (-2468.541) -- 0:03:11
556500 -- (-2469.655) [-2468.219] (-2470.133) (-2469.926) * [-2466.546] (-2475.014) (-2462.508) (-2463.924) -- 0:03:11
557000 -- (-2469.303) (-2468.566) (-2469.668) [-2464.099] * (-2468.946) (-2467.984) [-2460.956] (-2471.846) -- 0:03:10
557500 -- (-2465.608) [-2466.761] (-2463.530) (-2471.666) * (-2475.502) (-2471.570) [-2466.053] (-2462.415) -- 0:03:10
558000 -- (-2465.171) [-2462.585] (-2466.465) (-2470.970) * (-2468.251) [-2466.550] (-2463.898) (-2470.090) -- 0:03:10
558500 -- [-2462.647] (-2464.445) (-2461.543) (-2463.799) * (-2469.680) (-2468.027) (-2466.367) [-2466.112] -- 0:03:10
559000 -- (-2470.026) [-2462.764] (-2466.250) (-2461.555) * (-2487.970) (-2481.849) [-2455.898] (-2467.053) -- 0:03:10
559500 -- [-2467.998] (-2463.928) (-2471.487) (-2475.259) * (-2473.246) [-2471.587] (-2460.641) (-2466.329) -- 0:03:09
560000 -- [-2461.017] (-2465.971) (-2465.288) (-2468.902) * (-2465.698) [-2461.749] (-2461.295) (-2469.040) -- 0:03:09
Average standard deviation of split frequencies: 0.009831
560500 -- (-2472.718) [-2464.485] (-2470.635) (-2462.193) * [-2467.812] (-2469.586) (-2468.200) (-2465.725) -- 0:03:08
561000 -- (-2470.199) (-2464.214) [-2465.363] (-2469.980) * (-2474.368) (-2467.046) (-2463.320) [-2465.181] -- 0:03:09
561500 -- (-2474.376) [-2461.647] (-2472.500) (-2468.331) * [-2466.931] (-2464.787) (-2465.261) (-2469.124) -- 0:03:08
562000 -- (-2460.094) (-2470.779) (-2464.240) [-2467.613] * (-2465.634) [-2463.010] (-2461.125) (-2472.391) -- 0:03:08
562500 -- (-2469.102) (-2475.830) [-2470.366] (-2467.017) * (-2468.662) (-2461.537) [-2459.568] (-2459.827) -- 0:03:08
563000 -- (-2461.843) [-2459.165] (-2467.238) (-2464.315) * (-2475.447) (-2462.812) [-2461.993] (-2466.614) -- 0:03:08
563500 -- (-2463.904) (-2468.665) (-2469.986) [-2461.481] * (-2469.539) [-2456.441] (-2466.956) (-2468.861) -- 0:03:08
564000 -- (-2464.206) (-2468.909) (-2465.769) [-2468.700] * (-2470.776) (-2470.135) [-2463.872] (-2461.659) -- 0:03:07
564500 -- (-2465.231) (-2480.693) [-2471.433] (-2477.416) * (-2470.244) (-2468.442) (-2468.636) [-2460.178] -- 0:03:07
565000 -- (-2470.415) (-2470.648) [-2467.837] (-2466.130) * (-2464.408) (-2469.463) [-2471.075] (-2465.864) -- 0:03:07
Average standard deviation of split frequencies: 0.009418
565500 -- (-2476.725) (-2460.169) [-2467.979] (-2463.218) * (-2470.295) [-2469.097] (-2469.328) (-2462.501) -- 0:03:07
566000 -- (-2471.310) (-2464.713) [-2470.544] (-2465.680) * (-2470.451) [-2466.991] (-2465.997) (-2466.023) -- 0:03:07
566500 -- (-2468.222) [-2464.265] (-2475.635) (-2467.821) * (-2477.769) (-2462.461) (-2468.053) [-2464.121] -- 0:03:06
567000 -- [-2473.745] (-2462.299) (-2471.092) (-2464.466) * [-2468.312] (-2468.214) (-2468.613) (-2467.120) -- 0:03:06
567500 -- (-2464.433) [-2458.431] (-2471.147) (-2461.867) * (-2464.838) (-2467.077) (-2469.276) [-2459.787] -- 0:03:06
568000 -- (-2464.426) (-2461.975) (-2482.019) [-2466.465] * (-2472.505) (-2465.270) (-2463.025) [-2456.362] -- 0:03:06
568500 -- (-2465.180) (-2464.884) (-2476.167) [-2465.898] * (-2473.037) (-2468.375) (-2471.302) [-2461.770] -- 0:03:05
569000 -- (-2472.253) (-2460.004) [-2467.692] (-2473.052) * (-2472.169) (-2462.272) (-2455.043) [-2466.308] -- 0:03:05
569500 -- (-2468.878) [-2462.293] (-2465.989) (-2465.434) * (-2469.410) [-2462.803] (-2461.598) (-2470.099) -- 0:03:05
570000 -- (-2469.812) (-2460.918) [-2462.773] (-2470.173) * [-2464.243] (-2463.971) (-2466.834) (-2464.867) -- 0:03:05
Average standard deviation of split frequencies: 0.009341
570500 -- [-2466.343] (-2465.913) (-2463.241) (-2469.845) * (-2471.987) [-2462.784] (-2465.650) (-2466.704) -- 0:03:05
571000 -- (-2470.774) (-2468.368) [-2468.057] (-2469.559) * (-2463.509) (-2473.751) [-2469.278] (-2464.764) -- 0:03:04
571500 -- (-2470.540) (-2467.530) [-2466.256] (-2482.119) * [-2461.245] (-2463.377) (-2458.020) (-2460.574) -- 0:03:04
572000 -- [-2464.463] (-2464.175) (-2464.792) (-2469.955) * (-2469.039) (-2473.290) (-2462.068) [-2473.119] -- 0:03:04
572500 -- (-2461.425) (-2462.816) [-2467.431] (-2469.768) * (-2465.462) (-2466.386) [-2461.317] (-2466.121) -- 0:03:04
573000 -- (-2463.618) [-2464.805] (-2461.632) (-2469.349) * [-2465.234] (-2465.984) (-2458.334) (-2471.995) -- 0:03:04
573500 -- (-2458.835) [-2463.181] (-2464.358) (-2473.609) * (-2474.406) (-2464.529) [-2462.492] (-2467.711) -- 0:03:03
574000 -- [-2462.302] (-2465.409) (-2466.495) (-2462.367) * (-2458.572) (-2470.914) (-2462.786) [-2467.674] -- 0:03:03
574500 -- (-2470.539) (-2467.527) [-2462.747] (-2467.491) * (-2465.183) [-2464.981] (-2463.286) (-2461.190) -- 0:03:03
575000 -- (-2462.341) (-2470.076) (-2457.607) [-2465.396] * [-2470.507] (-2469.357) (-2461.625) (-2465.988) -- 0:03:03
Average standard deviation of split frequencies: 0.009003
575500 -- [-2465.634] (-2464.519) (-2473.680) (-2479.686) * (-2472.346) [-2466.591] (-2474.319) (-2466.475) -- 0:03:02
576000 -- [-2462.754] (-2465.324) (-2472.134) (-2468.303) * (-2472.640) [-2458.383] (-2482.650) (-2469.860) -- 0:03:02
576500 -- [-2465.784] (-2464.234) (-2469.571) (-2466.167) * [-2459.267] (-2475.200) (-2473.458) (-2469.840) -- 0:03:02
577000 -- (-2466.354) [-2470.411] (-2464.282) (-2466.909) * (-2465.002) (-2473.801) (-2467.437) [-2462.593] -- 0:03:02
577500 -- (-2464.967) (-2468.107) [-2459.198] (-2470.026) * (-2459.065) [-2465.625] (-2463.235) (-2473.817) -- 0:03:02
578000 -- (-2458.831) (-2467.162) [-2463.955] (-2473.824) * (-2458.203) (-2469.225) (-2466.003) [-2460.005] -- 0:03:01
578500 -- (-2461.258) [-2464.559] (-2462.739) (-2466.532) * (-2464.806) (-2467.781) [-2463.230] (-2473.824) -- 0:03:01
579000 -- (-2464.840) (-2470.557) [-2462.809] (-2464.834) * (-2467.719) [-2471.706] (-2463.889) (-2463.606) -- 0:03:01
579500 -- (-2458.096) [-2465.101] (-2465.159) (-2469.703) * (-2460.536) (-2464.504) [-2460.943] (-2470.728) -- 0:03:01
580000 -- (-2474.261) (-2475.208) [-2461.317] (-2467.671) * (-2460.872) (-2470.234) [-2461.205] (-2473.235) -- 0:03:01
Average standard deviation of split frequencies: 0.008524
580500 -- [-2465.609] (-2473.102) (-2459.852) (-2468.803) * (-2470.507) (-2476.769) (-2466.614) [-2472.790] -- 0:03:00
581000 -- (-2465.284) (-2468.469) (-2460.437) [-2467.475] * (-2461.266) (-2472.851) (-2474.984) [-2463.705] -- 0:03:00
581500 -- (-2463.896) (-2471.601) (-2463.026) [-2458.734] * (-2461.081) [-2458.295] (-2465.906) (-2465.747) -- 0:03:00
582000 -- (-2461.651) [-2468.207] (-2474.262) (-2467.465) * (-2460.343) [-2460.180] (-2472.043) (-2462.024) -- 0:03:00
582500 -- (-2464.017) (-2463.239) (-2465.771) [-2464.212] * (-2468.431) [-2460.001] (-2473.368) (-2470.393) -- 0:02:59
583000 -- (-2465.151) (-2462.824) (-2469.307) [-2466.863] * (-2460.498) [-2469.492] (-2473.782) (-2463.889) -- 0:02:59
583500 -- (-2478.900) (-2467.295) (-2474.720) [-2461.201] * [-2464.378] (-2465.332) (-2487.551) (-2456.085) -- 0:02:59
584000 -- (-2463.727) (-2463.532) [-2464.199] (-2466.873) * [-2472.518] (-2468.262) (-2480.702) (-2468.090) -- 0:02:59
584500 -- (-2460.350) (-2468.891) (-2466.843) [-2464.981] * (-2466.930) (-2465.042) (-2478.562) [-2468.831] -- 0:02:59
585000 -- (-2463.466) (-2473.894) [-2477.338] (-2471.272) * (-2458.827) [-2467.173] (-2465.443) (-2468.514) -- 0:02:58
Average standard deviation of split frequencies: 0.007910
585500 -- (-2460.020) (-2462.398) [-2471.185] (-2476.825) * [-2471.776] (-2465.365) (-2465.510) (-2462.379) -- 0:02:58
586000 -- [-2462.264] (-2464.930) (-2463.891) (-2474.254) * (-2461.616) (-2457.879) (-2464.925) [-2460.790] -- 0:02:58
586500 -- (-2467.862) [-2463.359] (-2464.754) (-2467.651) * [-2461.543] (-2463.115) (-2463.435) (-2461.192) -- 0:02:58
587000 -- [-2463.370] (-2464.408) (-2469.742) (-2469.769) * (-2468.379) [-2467.876] (-2464.466) (-2467.835) -- 0:02:58
587500 -- [-2465.689] (-2472.184) (-2468.739) (-2464.123) * [-2467.108] (-2462.623) (-2461.164) (-2468.824) -- 0:02:57
588000 -- (-2463.974) [-2464.750] (-2467.986) (-2465.751) * (-2465.622) [-2465.934] (-2466.105) (-2471.192) -- 0:02:57
588500 -- [-2462.927] (-2469.431) (-2465.109) (-2461.734) * (-2472.957) (-2476.302) [-2456.559] (-2463.531) -- 0:02:57
589000 -- (-2467.322) (-2470.394) [-2471.415] (-2473.065) * (-2472.320) (-2481.976) [-2459.313] (-2462.134) -- 0:02:57
589500 -- (-2463.784) [-2464.672] (-2463.519) (-2474.363) * (-2466.001) (-2484.034) (-2465.679) [-2466.371] -- 0:02:56
590000 -- [-2460.587] (-2475.952) (-2463.818) (-2473.933) * [-2463.470] (-2464.320) (-2456.456) (-2469.860) -- 0:02:56
Average standard deviation of split frequencies: 0.007715
590500 -- [-2459.732] (-2469.259) (-2470.343) (-2467.245) * (-2469.536) (-2460.375) [-2466.761] (-2463.985) -- 0:02:56
591000 -- (-2460.472) [-2459.341] (-2468.870) (-2474.436) * (-2464.134) [-2465.127] (-2466.320) (-2465.638) -- 0:02:56
591500 -- (-2470.846) [-2458.607] (-2460.590) (-2465.861) * (-2462.557) (-2463.712) [-2464.227] (-2472.907) -- 0:02:56
592000 -- (-2470.276) (-2476.906) (-2466.318) [-2467.845] * (-2465.179) (-2464.626) [-2462.556] (-2468.918) -- 0:02:55
592500 -- (-2467.591) (-2463.685) [-2463.044] (-2468.981) * (-2473.038) (-2476.452) [-2459.951] (-2467.703) -- 0:02:55
593000 -- (-2468.998) [-2466.979] (-2464.797) (-2486.913) * (-2470.268) (-2469.034) [-2464.594] (-2477.065) -- 0:02:55
593500 -- (-2468.142) [-2461.148] (-2466.808) (-2471.933) * (-2463.051) (-2469.474) (-2466.777) [-2464.804] -- 0:02:55
594000 -- (-2464.358) [-2461.784] (-2480.794) (-2461.358) * (-2460.972) (-2471.186) (-2461.581) [-2463.876] -- 0:02:54
594500 -- (-2467.409) (-2463.887) (-2461.920) [-2462.672] * [-2460.438] (-2469.595) (-2472.074) (-2470.852) -- 0:02:54
595000 -- (-2478.407) (-2469.957) (-2464.938) [-2469.791] * [-2469.405] (-2469.138) (-2469.674) (-2460.725) -- 0:02:54
Average standard deviation of split frequencies: 0.007580
595500 -- (-2469.231) (-2475.874) [-2466.701] (-2472.091) * [-2462.372] (-2465.877) (-2472.074) (-2469.768) -- 0:02:54
596000 -- (-2461.925) [-2469.261] (-2469.527) (-2462.608) * (-2465.488) (-2476.218) [-2464.399] (-2468.803) -- 0:02:54
596500 -- (-2459.847) (-2463.041) [-2469.577] (-2467.015) * [-2462.177] (-2473.865) (-2472.303) (-2472.646) -- 0:02:53
597000 -- (-2466.178) [-2461.777] (-2466.693) (-2464.398) * [-2460.465] (-2471.601) (-2468.098) (-2460.416) -- 0:02:53
597500 -- (-2465.079) (-2459.780) (-2470.109) [-2460.984] * (-2476.149) (-2480.017) [-2457.823] (-2460.141) -- 0:02:53
598000 -- [-2461.493] (-2464.247) (-2473.098) (-2474.072) * (-2468.738) (-2467.205) (-2467.654) [-2469.513] -- 0:02:53
598500 -- (-2466.166) [-2466.196] (-2467.775) (-2473.115) * (-2470.059) (-2462.422) [-2460.340] (-2482.495) -- 0:02:53
599000 -- [-2460.453] (-2458.954) (-2477.618) (-2462.007) * (-2463.891) (-2476.484) (-2460.670) [-2468.957] -- 0:02:52
599500 -- (-2466.760) [-2465.566] (-2473.227) (-2457.783) * (-2481.701) [-2472.059] (-2465.954) (-2469.612) -- 0:02:52
600000 -- [-2462.570] (-2472.707) (-2464.647) (-2464.099) * (-2473.108) (-2471.993) (-2463.883) [-2468.390] -- 0:02:52
Average standard deviation of split frequencies: 0.007456
600500 -- (-2463.487) (-2464.167) [-2457.168] (-2465.369) * (-2459.516) [-2466.614] (-2466.045) (-2467.340) -- 0:02:52
601000 -- (-2460.967) (-2466.980) [-2461.941] (-2465.623) * (-2462.002) (-2478.986) [-2467.143] (-2463.307) -- 0:02:51
601500 -- (-2475.470) (-2462.999) (-2468.260) [-2460.488] * (-2465.374) (-2462.152) (-2468.504) [-2455.322] -- 0:02:51
602000 -- (-2470.822) (-2475.194) (-2460.702) [-2464.168] * [-2461.932] (-2464.960) (-2464.166) (-2470.201) -- 0:02:51
602500 -- (-2475.212) (-2468.329) (-2465.601) [-2463.547] * (-2463.812) (-2465.628) [-2461.096] (-2461.535) -- 0:02:51
603000 -- (-2462.510) [-2463.381] (-2463.595) (-2468.830) * (-2458.457) (-2461.733) (-2468.798) [-2463.478] -- 0:02:51
603500 -- [-2468.291] (-2477.628) (-2470.904) (-2466.587) * (-2460.905) (-2475.993) [-2466.878] (-2464.451) -- 0:02:50
604000 -- (-2465.278) (-2473.100) [-2467.648] (-2471.427) * (-2468.439) (-2473.992) (-2474.595) [-2466.122] -- 0:02:50
604500 -- (-2463.900) [-2465.512] (-2469.263) (-2469.487) * (-2464.182) (-2465.090) (-2471.839) [-2467.377] -- 0:02:50
605000 -- (-2471.388) (-2466.940) (-2471.025) [-2460.678] * [-2478.622] (-2467.923) (-2474.085) (-2465.704) -- 0:02:50
Average standard deviation of split frequencies: 0.008362
605500 -- [-2466.782] (-2464.505) (-2465.866) (-2461.613) * (-2466.499) (-2458.842) [-2467.596] (-2473.546) -- 0:02:50
606000 -- (-2471.926) (-2466.235) (-2478.295) [-2457.320] * (-2466.473) (-2471.069) [-2468.072] (-2468.754) -- 0:02:49
606500 -- [-2464.356] (-2465.825) (-2474.309) (-2461.621) * (-2467.545) [-2466.705] (-2456.364) (-2463.611) -- 0:02:49
607000 -- (-2466.563) (-2470.699) [-2469.394] (-2463.041) * (-2463.206) [-2468.830] (-2468.043) (-2459.882) -- 0:02:49
607500 -- (-2475.098) (-2461.813) (-2463.956) [-2454.004] * [-2458.558] (-2465.171) (-2464.607) (-2463.895) -- 0:02:49
608000 -- (-2462.203) (-2466.213) [-2465.982] (-2465.336) * [-2457.428] (-2462.413) (-2473.673) (-2466.170) -- 0:02:48
608500 -- (-2468.543) [-2471.641] (-2474.199) (-2467.722) * [-2463.433] (-2467.998) (-2461.441) (-2462.464) -- 0:02:48
609000 -- (-2468.600) (-2463.945) [-2466.901] (-2471.279) * (-2463.812) [-2467.362] (-2470.515) (-2464.558) -- 0:02:48
609500 -- (-2467.299) (-2468.736) [-2460.984] (-2464.837) * (-2468.949) [-2470.087] (-2463.318) (-2461.740) -- 0:02:48
610000 -- (-2464.399) [-2461.836] (-2467.743) (-2467.858) * (-2465.618) [-2461.906] (-2466.472) (-2476.682) -- 0:02:48
Average standard deviation of split frequencies: 0.007912
610500 -- (-2468.688) (-2470.203) (-2463.012) [-2472.906] * (-2465.492) [-2472.877] (-2461.739) (-2471.149) -- 0:02:47
611000 -- (-2466.094) (-2466.130) (-2466.651) [-2467.565] * (-2464.851) (-2469.173) [-2456.758] (-2465.443) -- 0:02:47
611500 -- (-2471.902) (-2478.379) [-2466.564] (-2468.871) * (-2462.951) [-2464.101] (-2463.880) (-2466.332) -- 0:02:47
612000 -- (-2472.534) (-2471.413) [-2461.689] (-2471.152) * (-2473.240) (-2460.537) [-2463.148] (-2471.669) -- 0:02:47
612500 -- (-2469.157) (-2468.164) [-2460.771] (-2473.538) * (-2464.752) [-2464.684] (-2467.143) (-2464.330) -- 0:02:47
613000 -- (-2466.384) (-2459.809) [-2464.940] (-2468.577) * [-2466.390] (-2464.882) (-2467.540) (-2468.465) -- 0:02:46
613500 -- (-2465.574) [-2463.165] (-2472.055) (-2466.900) * [-2465.159] (-2470.151) (-2464.162) (-2464.214) -- 0:02:46
614000 -- (-2468.656) (-2460.611) [-2460.831] (-2475.277) * (-2470.604) (-2470.328) (-2459.458) [-2462.711] -- 0:02:46
614500 -- (-2464.747) (-2470.117) (-2465.516) [-2467.076] * (-2461.689) [-2469.989] (-2466.959) (-2465.128) -- 0:02:46
615000 -- (-2472.708) (-2463.691) [-2469.816] (-2464.951) * (-2469.853) [-2465.538] (-2471.425) (-2471.474) -- 0:02:45
Average standard deviation of split frequencies: 0.008545
615500 -- (-2459.367) (-2473.646) (-2462.058) [-2457.176] * [-2460.622] (-2469.514) (-2469.320) (-2471.509) -- 0:02:45
616000 -- (-2463.924) (-2469.693) (-2468.485) [-2462.028] * (-2461.513) [-2463.396] (-2472.736) (-2463.116) -- 0:02:45
616500 -- [-2464.504] (-2466.821) (-2463.921) (-2469.495) * (-2472.707) [-2474.256] (-2470.752) (-2467.744) -- 0:02:45
617000 -- (-2471.861) (-2466.407) (-2465.356) [-2468.317] * (-2470.966) (-2463.595) (-2469.742) [-2461.358] -- 0:02:45
617500 -- [-2462.920] (-2467.241) (-2468.897) (-2473.579) * (-2474.356) [-2462.276] (-2462.875) (-2468.587) -- 0:02:44
618000 -- (-2481.093) [-2463.653] (-2463.409) (-2467.064) * (-2472.092) (-2464.073) (-2461.715) [-2466.505] -- 0:02:44
618500 -- (-2468.210) (-2464.342) (-2468.203) [-2465.111] * (-2469.834) [-2459.722] (-2462.320) (-2461.919) -- 0:02:44
619000 -- (-2465.655) (-2464.984) (-2468.540) [-2469.659] * (-2470.510) [-2460.026] (-2465.340) (-2461.702) -- 0:02:44
619500 -- (-2464.379) (-2460.933) (-2466.656) [-2465.717] * (-2481.169) (-2464.405) [-2461.288] (-2468.633) -- 0:02:43
620000 -- [-2468.152] (-2465.591) (-2471.446) (-2471.016) * (-2472.084) (-2467.185) (-2467.596) [-2461.423] -- 0:02:43
Average standard deviation of split frequencies: 0.008228
620500 -- (-2470.012) (-2464.347) [-2462.863] (-2476.011) * [-2476.358] (-2463.537) (-2463.805) (-2471.285) -- 0:02:43
621000 -- (-2471.976) (-2467.122) (-2471.108) [-2463.407] * (-2460.935) [-2463.758] (-2464.105) (-2468.365) -- 0:02:43
621500 -- (-2471.640) (-2459.339) [-2463.472] (-2464.435) * [-2462.841] (-2470.761) (-2466.578) (-2463.292) -- 0:02:43
622000 -- (-2462.773) [-2462.240] (-2467.781) (-2466.585) * [-2464.203] (-2466.954) (-2461.810) (-2473.885) -- 0:02:42
622500 -- [-2464.113] (-2469.740) (-2471.371) (-2467.086) * (-2468.552) (-2460.641) (-2477.508) [-2470.306] -- 0:02:42
623000 -- (-2460.784) (-2465.787) (-2462.536) [-2464.418] * (-2466.249) [-2464.483] (-2472.378) (-2471.824) -- 0:02:42
623500 -- [-2460.055] (-2485.102) (-2458.234) (-2468.082) * (-2466.291) (-2465.921) (-2466.160) [-2458.493] -- 0:02:42
624000 -- (-2470.845) (-2468.376) (-2457.557) [-2467.809] * (-2465.140) [-2465.838] (-2459.306) (-2470.858) -- 0:02:42
624500 -- (-2471.247) [-2466.264] (-2465.271) (-2465.558) * (-2465.125) [-2466.670] (-2460.410) (-2472.556) -- 0:02:41
625000 -- (-2466.448) [-2468.169] (-2466.402) (-2461.413) * (-2470.019) (-2473.876) [-2456.671] (-2461.615) -- 0:02:41
Average standard deviation of split frequencies: 0.008095
625500 -- (-2474.457) (-2473.741) [-2462.567] (-2462.913) * (-2466.596) (-2476.058) [-2462.111] (-2461.530) -- 0:02:41
626000 -- (-2462.309) (-2461.958) (-2471.287) [-2466.324] * (-2472.290) (-2461.097) (-2472.034) [-2463.461] -- 0:02:41
626500 -- [-2469.816] (-2466.873) (-2463.527) (-2470.157) * (-2470.229) [-2468.068] (-2484.030) (-2469.624) -- 0:02:40
627000 -- (-2467.096) [-2463.534] (-2468.608) (-2469.710) * (-2465.981) [-2460.519] (-2470.648) (-2474.259) -- 0:02:40
627500 -- [-2464.334] (-2469.515) (-2463.814) (-2468.546) * (-2457.781) (-2468.952) (-2463.234) [-2461.941] -- 0:02:40
628000 -- (-2466.225) [-2465.816] (-2469.546) (-2463.253) * (-2465.467) (-2472.119) [-2466.150] (-2463.286) -- 0:02:40
628500 -- [-2461.887] (-2467.624) (-2464.933) (-2459.630) * (-2464.892) (-2467.156) [-2467.067] (-2469.125) -- 0:02:40
629000 -- (-2473.382) [-2465.130] (-2469.988) (-2469.166) * [-2460.628] (-2479.581) (-2470.133) (-2472.132) -- 0:02:39
629500 -- [-2463.674] (-2463.984) (-2469.248) (-2469.791) * (-2461.223) [-2464.507] (-2471.270) (-2466.049) -- 0:02:39
630000 -- (-2472.552) (-2462.881) (-2471.226) [-2462.448] * [-2463.454] (-2473.282) (-2464.536) (-2465.105) -- 0:02:39
Average standard deviation of split frequencies: 0.008658
630500 -- (-2466.673) (-2464.531) [-2466.738] (-2458.527) * (-2470.625) (-2464.638) (-2465.678) [-2459.616] -- 0:02:39
631000 -- (-2464.405) (-2462.902) [-2467.606] (-2468.786) * [-2464.848] (-2463.500) (-2471.562) (-2468.002) -- 0:02:39
631500 -- (-2459.293) (-2473.776) [-2464.207] (-2457.247) * (-2460.854) (-2460.363) (-2465.316) [-2465.081] -- 0:02:38
632000 -- (-2462.454) (-2467.932) (-2466.453) [-2456.572] * (-2468.941) [-2459.660] (-2465.021) (-2475.518) -- 0:02:38
632500 -- (-2460.038) (-2469.905) [-2464.213] (-2464.646) * (-2464.976) (-2467.120) [-2465.349] (-2459.128) -- 0:02:38
633000 -- (-2456.919) (-2472.737) [-2464.193] (-2469.963) * (-2461.892) [-2458.173] (-2465.295) (-2469.281) -- 0:02:38
633500 -- (-2461.612) [-2467.059] (-2465.784) (-2470.345) * [-2461.847] (-2475.808) (-2467.562) (-2463.256) -- 0:02:37
634000 -- (-2466.644) (-2480.474) [-2467.459] (-2472.068) * (-2468.228) (-2468.117) (-2467.011) [-2458.956] -- 0:02:37
634500 -- [-2464.538] (-2482.388) (-2469.147) (-2465.963) * [-2463.060] (-2464.951) (-2471.363) (-2470.904) -- 0:02:37
635000 -- [-2468.841] (-2468.198) (-2468.656) (-2467.032) * (-2472.295) [-2466.492] (-2469.642) (-2465.116) -- 0:02:37
Average standard deviation of split frequencies: 0.008586
635500 -- [-2465.226] (-2471.655) (-2480.709) (-2463.251) * [-2464.996] (-2460.134) (-2464.980) (-2461.551) -- 0:02:37
636000 -- (-2464.973) (-2472.599) (-2470.507) [-2462.051] * (-2463.171) (-2461.598) [-2461.298] (-2461.394) -- 0:02:36
636500 -- [-2461.422] (-2463.530) (-2468.890) (-2463.415) * (-2470.003) (-2458.087) (-2467.774) [-2465.723] -- 0:02:36
637000 -- [-2466.359] (-2464.792) (-2472.837) (-2460.586) * (-2468.727) [-2465.558] (-2464.215) (-2477.564) -- 0:02:36
637500 -- (-2465.664) (-2463.296) (-2476.134) [-2463.350] * (-2475.534) (-2457.990) [-2470.249] (-2470.577) -- 0:02:36
638000 -- (-2460.525) [-2461.695] (-2475.189) (-2468.585) * (-2467.262) [-2464.346] (-2466.221) (-2467.903) -- 0:02:36
638500 -- (-2461.700) (-2470.519) [-2466.584] (-2471.360) * (-2463.185) (-2467.678) (-2459.062) [-2470.766] -- 0:02:35
639000 -- (-2468.046) (-2475.965) [-2467.287] (-2466.823) * (-2462.442) (-2465.838) [-2469.662] (-2467.439) -- 0:02:35
639500 -- [-2463.290] (-2466.455) (-2471.806) (-2468.299) * (-2462.758) [-2467.248] (-2468.767) (-2476.358) -- 0:02:35
640000 -- (-2478.673) (-2467.232) (-2462.852) [-2461.553] * [-2457.106] (-2462.003) (-2473.016) (-2463.454) -- 0:02:35
Average standard deviation of split frequencies: 0.008155
640500 -- (-2466.912) (-2470.793) [-2457.979] (-2464.495) * (-2472.548) (-2460.881) [-2462.810] (-2468.813) -- 0:02:34
641000 -- [-2465.527] (-2471.135) (-2473.583) (-2467.116) * (-2468.597) (-2464.504) [-2470.712] (-2463.225) -- 0:02:34
641500 -- [-2464.561] (-2459.973) (-2466.699) (-2469.438) * (-2467.475) [-2465.751] (-2466.508) (-2466.863) -- 0:02:34
642000 -- [-2461.902] (-2471.375) (-2463.238) (-2470.227) * [-2459.914] (-2468.539) (-2461.579) (-2467.787) -- 0:02:34
642500 -- (-2467.651) [-2465.683] (-2467.446) (-2479.823) * (-2463.942) [-2464.900] (-2466.001) (-2464.246) -- 0:02:34
643000 -- (-2463.448) (-2465.112) (-2467.330) [-2469.141] * (-2472.580) (-2467.774) [-2471.262] (-2470.387) -- 0:02:33
643500 -- (-2460.815) [-2460.223] (-2471.415) (-2466.539) * (-2468.315) (-2464.541) [-2461.618] (-2465.873) -- 0:02:33
644000 -- [-2466.845] (-2460.581) (-2474.377) (-2464.494) * (-2462.726) (-2476.398) (-2464.553) [-2460.909] -- 0:02:33
644500 -- (-2459.623) (-2469.781) [-2464.841] (-2459.196) * (-2483.465) (-2470.560) (-2462.622) [-2471.222] -- 0:02:33
645000 -- (-2457.662) (-2477.116) [-2461.327] (-2462.021) * (-2466.684) (-2465.082) (-2466.419) [-2458.504] -- 0:02:33
Average standard deviation of split frequencies: 0.008453
645500 -- (-2465.264) (-2474.436) (-2471.655) [-2464.603] * (-2465.818) (-2470.292) (-2459.987) [-2463.199] -- 0:02:32
646000 -- (-2464.449) (-2471.428) [-2469.222] (-2468.627) * [-2459.537] (-2462.591) (-2472.320) (-2477.213) -- 0:02:32
646500 -- (-2472.940) (-2469.126) [-2462.947] (-2460.038) * [-2465.867] (-2463.193) (-2475.362) (-2471.609) -- 0:02:32
647000 -- (-2474.686) (-2468.301) (-2461.745) [-2461.889] * (-2468.236) (-2468.751) [-2466.631] (-2470.677) -- 0:02:32
647500 -- (-2472.588) (-2478.449) [-2461.736] (-2461.256) * [-2463.278] (-2468.845) (-2469.621) (-2471.959) -- 0:02:31
648000 -- (-2465.274) (-2466.997) [-2464.983] (-2462.741) * (-2460.457) [-2461.090] (-2461.135) (-2471.551) -- 0:02:31
648500 -- (-2468.604) (-2463.410) [-2467.332] (-2466.446) * (-2464.585) [-2456.941] (-2471.709) (-2468.932) -- 0:02:31
649000 -- (-2461.942) (-2464.297) (-2466.833) [-2465.823] * (-2458.177) (-2461.988) [-2466.157] (-2462.097) -- 0:02:31
649500 -- (-2463.257) (-2463.094) (-2468.473) [-2469.417] * (-2464.348) [-2461.381] (-2469.814) (-2473.435) -- 0:02:31
650000 -- (-2468.446) [-2463.069] (-2464.005) (-2464.252) * (-2473.493) [-2462.748] (-2459.870) (-2464.332) -- 0:02:30
Average standard deviation of split frequencies: 0.008452
650500 -- [-2461.283] (-2462.180) (-2464.136) (-2471.777) * [-2462.179] (-2462.620) (-2465.426) (-2460.240) -- 0:02:30
651000 -- (-2472.200) (-2467.342) (-2468.013) [-2463.882] * (-2463.499) (-2471.780) (-2467.858) [-2465.139] -- 0:02:30
651500 -- (-2467.999) [-2465.085] (-2464.991) (-2462.557) * [-2459.338] (-2475.488) (-2472.404) (-2463.651) -- 0:02:30
652000 -- (-2463.860) (-2463.621) [-2467.112] (-2467.351) * (-2468.710) (-2461.991) [-2465.501] (-2463.625) -- 0:02:29
652500 -- (-2464.344) (-2465.379) (-2465.201) [-2461.217] * [-2469.943] (-2472.343) (-2470.695) (-2474.978) -- 0:02:29
653000 -- (-2464.279) [-2467.192] (-2464.005) (-2468.072) * (-2472.674) [-2469.685] (-2476.179) (-2463.725) -- 0:02:29
653500 -- (-2469.657) (-2462.672) [-2463.438] (-2465.689) * (-2478.185) (-2466.842) [-2459.790] (-2466.898) -- 0:02:29
654000 -- [-2467.412] (-2472.551) (-2473.152) (-2465.948) * (-2467.428) (-2469.355) [-2461.978] (-2464.396) -- 0:02:29
654500 -- (-2464.310) (-2473.467) (-2467.220) [-2469.045] * (-2465.435) [-2461.265] (-2469.503) (-2469.848) -- 0:02:28
655000 -- [-2459.490] (-2467.748) (-2469.757) (-2466.591) * (-2461.434) (-2463.678) [-2464.624] (-2472.338) -- 0:02:28
Average standard deviation of split frequencies: 0.008264
655500 -- (-2466.941) [-2463.092] (-2465.307) (-2479.306) * [-2463.998] (-2462.296) (-2471.595) (-2465.239) -- 0:02:28
656000 -- (-2470.135) [-2457.006] (-2465.957) (-2461.816) * (-2467.996) (-2470.254) (-2467.564) [-2461.614] -- 0:02:28
656500 -- [-2466.359] (-2466.707) (-2464.882) (-2467.309) * (-2463.343) (-2475.694) [-2467.587] (-2474.647) -- 0:02:28
657000 -- [-2462.832] (-2460.790) (-2479.024) (-2460.455) * (-2464.213) (-2466.525) [-2460.812] (-2477.058) -- 0:02:27
657500 -- [-2459.994] (-2467.772) (-2475.364) (-2467.201) * [-2464.101] (-2469.163) (-2463.030) (-2475.078) -- 0:02:27
658000 -- [-2462.303] (-2462.676) (-2470.232) (-2467.497) * (-2465.258) (-2473.013) [-2465.529] (-2467.823) -- 0:02:27
658500 -- (-2460.237) [-2460.384] (-2464.657) (-2474.547) * [-2461.336] (-2465.612) (-2472.019) (-2469.991) -- 0:02:27
659000 -- (-2460.405) (-2462.453) (-2461.386) [-2472.125] * (-2462.710) [-2464.889] (-2469.782) (-2467.182) -- 0:02:26
659500 -- (-2474.491) [-2468.325] (-2461.629) (-2463.956) * (-2464.184) [-2463.907] (-2473.692) (-2468.864) -- 0:02:26
660000 -- (-2470.884) (-2464.775) [-2466.809] (-2475.297) * (-2466.973) [-2466.855] (-2466.522) (-2468.719) -- 0:02:26
Average standard deviation of split frequencies: 0.008800
660500 -- (-2471.647) (-2462.159) [-2460.666] (-2463.960) * (-2466.106) [-2472.357] (-2474.055) (-2463.974) -- 0:02:26
661000 -- (-2464.209) [-2465.447] (-2471.278) (-2468.505) * [-2461.337] (-2464.552) (-2466.091) (-2469.402) -- 0:02:26
661500 -- (-2460.649) [-2457.071] (-2470.481) (-2470.019) * [-2466.081] (-2478.169) (-2471.310) (-2468.483) -- 0:02:25
662000 -- (-2469.420) (-2465.515) [-2463.667] (-2460.173) * (-2462.846) (-2471.738) (-2473.316) [-2465.914] -- 0:02:25
662500 -- (-2467.782) [-2463.077] (-2468.001) (-2464.019) * (-2474.332) (-2472.437) [-2463.255] (-2466.336) -- 0:02:25
663000 -- [-2457.717] (-2463.466) (-2459.616) (-2470.613) * [-2466.890] (-2464.554) (-2462.477) (-2463.645) -- 0:02:25
663500 -- (-2464.934) (-2466.702) [-2463.799] (-2466.196) * [-2463.069] (-2475.479) (-2470.815) (-2465.673) -- 0:02:25
664000 -- (-2464.489) [-2471.565] (-2471.245) (-2466.943) * (-2467.913) (-2475.651) [-2465.669] (-2463.223) -- 0:02:24
664500 -- (-2479.720) (-2482.394) (-2463.801) [-2462.845] * (-2468.834) [-2462.914] (-2470.015) (-2466.275) -- 0:02:24
665000 -- (-2465.819) (-2477.627) (-2457.323) [-2462.753] * [-2467.087] (-2465.135) (-2465.636) (-2472.354) -- 0:02:24
Average standard deviation of split frequencies: 0.009084
665500 -- (-2470.188) (-2462.493) [-2464.445] (-2469.790) * (-2467.258) [-2468.837] (-2465.536) (-2465.757) -- 0:02:24
666000 -- (-2471.802) [-2463.183] (-2464.876) (-2476.057) * [-2466.132] (-2459.801) (-2467.933) (-2467.515) -- 0:02:23
666500 -- [-2464.351] (-2462.563) (-2463.869) (-2465.064) * (-2462.903) (-2464.848) [-2462.753] (-2466.194) -- 0:02:23
667000 -- (-2476.476) (-2470.539) [-2474.724] (-2465.169) * (-2469.350) (-2468.391) [-2465.978] (-2470.110) -- 0:02:23
667500 -- [-2465.471] (-2462.507) (-2458.239) (-2467.049) * (-2464.737) (-2460.880) (-2460.388) [-2470.107] -- 0:02:23
668000 -- (-2464.230) (-2470.731) (-2472.729) [-2464.558] * (-2464.161) (-2468.669) [-2462.661] (-2477.497) -- 0:02:23
668500 -- (-2467.675) [-2459.614] (-2477.523) (-2464.524) * (-2468.458) [-2456.458] (-2460.282) (-2479.017) -- 0:02:22
669000 -- (-2464.571) (-2474.725) [-2458.493] (-2466.462) * (-2466.882) (-2466.475) (-2471.987) [-2468.132] -- 0:02:22
669500 -- [-2460.769] (-2471.548) (-2461.598) (-2465.335) * (-2469.593) [-2468.391] (-2473.706) (-2470.052) -- 0:02:22
670000 -- (-2462.638) [-2460.558] (-2464.908) (-2464.482) * (-2472.717) (-2468.445) (-2470.570) [-2463.387] -- 0:02:22
Average standard deviation of split frequencies: 0.008728
670500 -- (-2467.167) (-2459.633) (-2460.896) [-2463.770] * (-2470.470) (-2464.902) (-2469.090) [-2462.962] -- 0:02:22
671000 -- (-2465.150) (-2465.825) [-2465.124] (-2461.658) * (-2467.586) (-2463.522) [-2469.324] (-2467.469) -- 0:02:21
671500 -- (-2478.783) [-2471.214] (-2463.907) (-2469.036) * (-2473.644) [-2472.715] (-2462.200) (-2469.267) -- 0:02:21
672000 -- (-2464.806) (-2465.679) [-2461.933] (-2469.447) * [-2459.365] (-2466.814) (-2464.093) (-2469.051) -- 0:02:21
672500 -- [-2460.809] (-2464.549) (-2461.609) (-2467.341) * (-2461.350) (-2465.742) (-2473.850) [-2466.696] -- 0:02:21
673000 -- [-2461.494] (-2468.753) (-2469.773) (-2469.151) * [-2456.881] (-2466.175) (-2462.027) (-2473.807) -- 0:02:20
673500 -- (-2463.550) [-2470.447] (-2465.407) (-2458.751) * (-2470.677) (-2475.907) [-2463.126] (-2467.713) -- 0:02:20
674000 -- (-2466.452) (-2470.059) (-2472.013) [-2469.276] * (-2468.616) [-2466.036] (-2466.215) (-2463.297) -- 0:02:20
674500 -- (-2472.583) (-2475.999) [-2463.049] (-2463.883) * (-2464.026) (-2468.537) [-2463.006] (-2461.630) -- 0:02:20
675000 -- (-2471.930) (-2459.962) (-2468.511) [-2466.451] * (-2464.097) [-2471.625] (-2462.996) (-2468.649) -- 0:02:20
Average standard deviation of split frequencies: 0.008368
675500 -- (-2461.059) [-2464.843] (-2462.326) (-2470.936) * (-2463.080) (-2469.128) [-2459.133] (-2472.848) -- 0:02:19
676000 -- [-2464.960] (-2461.802) (-2462.797) (-2474.466) * [-2462.585] (-2458.009) (-2467.488) (-2464.889) -- 0:02:19
676500 -- (-2473.286) (-2470.143) (-2465.241) [-2464.079] * (-2463.220) [-2467.873] (-2462.531) (-2467.075) -- 0:02:19
677000 -- [-2472.711] (-2470.598) (-2463.156) (-2478.760) * (-2474.307) [-2466.648] (-2471.532) (-2462.234) -- 0:02:19
677500 -- (-2471.671) (-2466.742) [-2461.310] (-2474.687) * [-2461.783] (-2468.991) (-2473.985) (-2468.794) -- 0:02:18
678000 -- [-2458.936] (-2470.641) (-2460.615) (-2460.151) * (-2472.209) [-2466.479] (-2475.711) (-2477.867) -- 0:02:18
678500 -- (-2465.785) (-2466.438) [-2458.049] (-2477.422) * [-2463.785] (-2465.862) (-2472.177) (-2469.819) -- 0:02:18
679000 -- (-2469.361) (-2471.868) (-2459.486) [-2466.942] * (-2473.984) (-2467.044) [-2469.124] (-2463.481) -- 0:02:18
679500 -- [-2463.529] (-2462.782) (-2468.052) (-2473.401) * (-2462.992) (-2470.688) [-2470.245] (-2468.425) -- 0:02:18
680000 -- (-2474.234) (-2466.589) (-2469.235) [-2465.217] * (-2473.550) (-2475.485) (-2471.623) [-2470.064] -- 0:02:17
Average standard deviation of split frequencies: 0.008426
680500 -- (-2464.597) (-2471.994) [-2462.903] (-2478.134) * (-2464.598) (-2467.591) [-2465.350] (-2464.755) -- 0:02:17
681000 -- [-2462.247] (-2475.676) (-2473.352) (-2471.201) * (-2476.059) (-2464.670) [-2461.955] (-2467.726) -- 0:02:17
681500 -- (-2460.489) (-2475.732) [-2456.956] (-2456.385) * [-2467.553] (-2468.555) (-2470.429) (-2464.874) -- 0:02:17
682000 -- (-2472.892) (-2471.422) [-2458.137] (-2461.425) * (-2467.886) (-2477.960) (-2466.043) [-2460.369] -- 0:02:17
682500 -- (-2466.936) (-2473.224) [-2466.337] (-2465.469) * [-2459.582] (-2460.849) (-2480.934) (-2459.887) -- 0:02:16
683000 -- (-2467.224) [-2464.191] (-2458.661) (-2469.792) * [-2466.878] (-2464.890) (-2468.801) (-2455.987) -- 0:02:16
683500 -- (-2466.824) (-2462.694) [-2462.865] (-2468.930) * (-2464.711) [-2463.197] (-2471.005) (-2469.554) -- 0:02:16
684000 -- [-2464.575] (-2462.563) (-2467.418) (-2465.907) * (-2468.663) (-2470.819) [-2461.776] (-2463.750) -- 0:02:16
684500 -- [-2472.107] (-2475.175) (-2471.236) (-2468.303) * (-2479.708) (-2467.815) [-2465.709] (-2461.919) -- 0:02:15
685000 -- (-2476.677) (-2472.002) [-2465.652] (-2472.114) * (-2467.576) (-2464.935) (-2464.799) [-2465.025] -- 0:02:15
Average standard deviation of split frequencies: 0.008303
685500 -- (-2466.227) (-2470.737) [-2458.271] (-2463.085) * (-2464.257) (-2472.076) (-2470.117) [-2463.749] -- 0:02:15
686000 -- (-2470.648) (-2466.121) [-2457.650] (-2457.550) * [-2460.737] (-2466.090) (-2463.303) (-2465.800) -- 0:02:15
686500 -- (-2471.223) (-2470.426) [-2468.023] (-2464.337) * (-2467.586) (-2469.219) (-2469.147) [-2468.381] -- 0:02:15
687000 -- (-2475.424) (-2463.008) [-2463.772] (-2464.765) * [-2462.252] (-2470.447) (-2462.237) (-2465.629) -- 0:02:14
687500 -- [-2467.340] (-2466.033) (-2464.528) (-2464.387) * (-2472.022) [-2464.781] (-2460.256) (-2467.241) -- 0:02:14
688000 -- (-2471.579) [-2458.846] (-2463.098) (-2471.232) * [-2466.222] (-2464.646) (-2466.909) (-2473.155) -- 0:02:14
688500 -- [-2457.031] (-2462.538) (-2469.451) (-2463.245) * (-2463.122) [-2467.344] (-2480.571) (-2470.246) -- 0:02:14
689000 -- [-2456.801] (-2464.221) (-2463.688) (-2462.846) * (-2471.672) (-2467.901) (-2476.300) [-2474.574] -- 0:02:14
689500 -- [-2464.578] (-2463.851) (-2465.689) (-2467.330) * (-2473.129) [-2469.677] (-2468.704) (-2473.514) -- 0:02:13
690000 -- (-2467.831) (-2472.786) (-2469.276) [-2464.875] * [-2467.774] (-2469.765) (-2474.003) (-2461.208) -- 0:02:13
Average standard deviation of split frequencies: 0.008759
690500 -- [-2458.689] (-2467.295) (-2467.413) (-2465.268) * (-2462.154) (-2465.953) (-2468.745) [-2460.687] -- 0:02:13
691000 -- [-2464.078] (-2467.883) (-2465.164) (-2453.940) * (-2467.949) [-2461.689] (-2463.170) (-2476.065) -- 0:02:13
691500 -- (-2463.009) [-2464.227] (-2472.918) (-2467.503) * [-2464.227] (-2462.123) (-2459.928) (-2477.554) -- 0:02:12
692000 -- (-2472.520) (-2460.797) (-2472.318) [-2460.972] * [-2462.555] (-2465.641) (-2466.653) (-2471.392) -- 0:02:12
692500 -- [-2465.463] (-2459.077) (-2461.474) (-2469.197) * [-2461.840] (-2461.626) (-2466.722) (-2467.963) -- 0:02:12
693000 -- [-2464.291] (-2467.302) (-2466.449) (-2472.514) * (-2464.006) [-2464.412] (-2464.372) (-2461.003) -- 0:02:12
693500 -- (-2469.678) (-2461.393) (-2469.037) [-2468.695] * (-2484.708) (-2468.184) (-2470.124) [-2462.575] -- 0:02:12
694000 -- (-2478.816) (-2463.712) (-2467.784) [-2465.549] * (-2467.416) (-2478.942) (-2461.609) [-2462.449] -- 0:02:11
694500 -- (-2473.772) (-2480.912) [-2458.753] (-2470.157) * (-2464.918) (-2463.705) (-2464.528) [-2465.919] -- 0:02:11
695000 -- (-2477.140) (-2472.220) (-2470.396) [-2467.260] * [-2461.001] (-2459.008) (-2470.430) (-2470.324) -- 0:02:11
Average standard deviation of split frequencies: 0.008918
695500 -- [-2463.642] (-2479.001) (-2460.393) (-2460.460) * (-2467.614) (-2466.295) [-2473.617] (-2467.284) -- 0:02:11
696000 -- (-2464.301) [-2458.873] (-2463.080) (-2474.140) * (-2462.909) (-2465.602) (-2470.520) [-2468.562] -- 0:02:11
696500 -- (-2463.069) (-2463.222) [-2463.908] (-2471.863) * [-2464.628] (-2465.249) (-2477.363) (-2465.481) -- 0:02:10
697000 -- (-2470.175) [-2465.390] (-2465.645) (-2465.043) * [-2458.988] (-2468.381) (-2472.092) (-2479.436) -- 0:02:10
697500 -- (-2470.830) [-2468.295] (-2465.139) (-2470.532) * [-2462.752] (-2470.142) (-2470.727) (-2470.039) -- 0:02:10
698000 -- (-2467.469) (-2468.123) (-2462.394) [-2461.397] * [-2458.972] (-2469.102) (-2467.658) (-2468.058) -- 0:02:10
698500 -- [-2459.624] (-2461.483) (-2459.341) (-2469.582) * (-2468.704) (-2469.076) [-2469.536] (-2472.940) -- 0:02:09
699000 -- (-2462.279) (-2466.940) (-2463.913) [-2470.018] * (-2473.180) (-2470.072) [-2471.203] (-2466.792) -- 0:02:09
699500 -- (-2466.798) (-2467.320) [-2463.206] (-2477.751) * [-2461.618] (-2463.140) (-2458.068) (-2464.756) -- 0:02:09
700000 -- (-2467.183) [-2464.109] (-2471.222) (-2471.209) * (-2469.607) (-2469.778) (-2470.041) [-2457.401] -- 0:02:09
Average standard deviation of split frequencies: 0.008858
700500 -- (-2456.147) (-2468.953) (-2472.732) [-2466.114] * (-2464.649) (-2460.417) [-2464.748] (-2461.237) -- 0:02:09
701000 -- (-2465.943) (-2469.485) (-2468.864) [-2461.832] * [-2460.684] (-2465.365) (-2467.409) (-2471.086) -- 0:02:08
701500 -- (-2463.955) (-2464.485) (-2472.635) [-2460.490] * (-2466.560) [-2465.582] (-2457.508) (-2463.877) -- 0:02:08
702000 -- (-2466.437) (-2471.722) (-2469.873) [-2465.004] * (-2461.132) (-2476.749) (-2469.021) [-2461.192] -- 0:02:08
702500 -- (-2467.864) (-2474.411) [-2469.948] (-2466.909) * (-2479.425) [-2468.757] (-2456.517) (-2463.626) -- 0:02:08
703000 -- (-2464.800) (-2467.241) [-2470.810] (-2474.304) * (-2467.520) (-2467.970) [-2460.871] (-2468.267) -- 0:02:08
703500 -- [-2470.950] (-2463.919) (-2462.477) (-2472.232) * [-2460.454] (-2468.482) (-2463.705) (-2462.277) -- 0:02:07
704000 -- (-2463.473) (-2463.040) [-2460.519] (-2459.845) * (-2469.148) (-2463.202) (-2472.487) [-2469.545] -- 0:02:07
704500 -- (-2458.817) (-2462.257) (-2475.548) [-2470.281] * [-2470.872] (-2471.355) (-2465.123) (-2468.637) -- 0:02:07
705000 -- (-2462.720) (-2471.480) (-2469.810) [-2464.746] * (-2461.793) [-2467.464] (-2470.403) (-2466.692) -- 0:02:07
Average standard deviation of split frequencies: 0.009014
705500 -- [-2469.762] (-2464.691) (-2461.390) (-2459.058) * (-2469.937) (-2473.733) (-2461.560) [-2461.903] -- 0:02:06
706000 -- (-2464.128) (-2463.654) [-2457.426] (-2464.406) * (-2469.460) (-2467.032) [-2468.044] (-2463.895) -- 0:02:07
706500 -- (-2460.893) (-2462.352) (-2466.443) [-2466.856] * (-2468.116) (-2465.520) (-2472.090) [-2470.602] -- 0:02:06
707000 -- [-2468.116] (-2466.113) (-2473.831) (-2463.904) * (-2466.967) (-2465.289) [-2467.143] (-2467.349) -- 0:02:06
707500 -- (-2461.250) [-2458.251] (-2469.186) (-2468.068) * (-2463.314) (-2470.498) [-2470.063] (-2468.396) -- 0:02:06
708000 -- (-2470.287) [-2459.489] (-2470.079) (-2466.957) * (-2471.228) [-2466.645] (-2467.740) (-2466.885) -- 0:02:05
708500 -- (-2467.425) (-2460.968) [-2462.134] (-2468.061) * (-2468.058) [-2470.380] (-2468.425) (-2470.637) -- 0:02:05
709000 -- [-2467.481] (-2464.907) (-2471.236) (-2466.112) * [-2466.809] (-2467.775) (-2469.612) (-2461.513) -- 0:02:05
709500 -- (-2466.808) [-2460.152] (-2466.219) (-2469.012) * [-2459.063] (-2467.712) (-2476.192) (-2471.937) -- 0:02:05
710000 -- (-2474.179) (-2461.295) [-2468.591] (-2463.130) * [-2471.233] (-2464.168) (-2465.074) (-2462.869) -- 0:02:04
Average standard deviation of split frequencies: 0.009010
710500 -- (-2465.399) (-2460.508) (-2464.969) [-2463.977] * (-2464.671) (-2473.477) (-2457.878) [-2465.474] -- 0:02:04
711000 -- (-2466.931) (-2460.769) [-2465.743] (-2474.458) * (-2462.819) (-2467.476) (-2464.697) [-2459.485] -- 0:02:04
711500 -- (-2468.818) (-2465.069) [-2457.377] (-2464.388) * (-2468.505) (-2473.405) (-2468.007) [-2463.626] -- 0:02:04
712000 -- (-2465.798) [-2462.715] (-2463.539) (-2475.281) * [-2466.523] (-2469.911) (-2469.350) (-2463.310) -- 0:02:04
712500 -- (-2466.976) (-2465.488) (-2467.242) [-2468.563] * (-2467.078) (-2466.267) [-2470.819] (-2468.228) -- 0:02:03
713000 -- (-2472.494) [-2463.865] (-2464.010) (-2461.463) * (-2466.720) (-2463.511) (-2468.834) [-2460.776] -- 0:02:03
713500 -- (-2474.314) [-2467.871] (-2467.457) (-2469.351) * (-2463.043) (-2472.950) [-2467.183] (-2462.615) -- 0:02:03
714000 -- [-2457.506] (-2470.869) (-2461.929) (-2475.510) * (-2467.917) (-2460.020) (-2467.391) [-2461.408] -- 0:02:03
714500 -- (-2481.251) (-2462.253) [-2465.257] (-2464.666) * (-2463.290) [-2460.552] (-2469.030) (-2469.411) -- 0:02:03
715000 -- (-2477.292) (-2471.200) (-2475.636) [-2461.777] * [-2459.247] (-2462.919) (-2489.024) (-2469.608) -- 0:02:02
Average standard deviation of split frequencies: 0.009217
715500 -- (-2461.405) (-2464.092) [-2470.058] (-2467.111) * (-2470.036) [-2471.828] (-2481.177) (-2467.743) -- 0:02:02
716000 -- (-2466.518) [-2461.868] (-2471.975) (-2473.908) * [-2466.406] (-2460.356) (-2467.467) (-2467.727) -- 0:02:02
716500 -- (-2479.947) (-2462.950) (-2463.028) [-2470.088] * (-2464.252) (-2473.376) [-2462.114] (-2472.008) -- 0:02:02
717000 -- (-2471.025) (-2458.289) [-2463.008] (-2473.314) * [-2467.925] (-2462.085) (-2473.665) (-2475.170) -- 0:02:01
717500 -- (-2464.763) (-2475.223) [-2470.074] (-2461.428) * (-2472.097) (-2469.652) (-2471.745) [-2470.461] -- 0:02:01
718000 -- (-2472.055) (-2472.426) [-2477.502] (-2467.170) * (-2459.180) (-2471.349) (-2463.665) [-2460.920] -- 0:02:01
718500 -- (-2466.261) [-2467.348] (-2469.119) (-2462.332) * [-2459.095] (-2473.538) (-2464.675) (-2469.684) -- 0:02:01
719000 -- [-2462.553] (-2463.201) (-2478.378) (-2469.678) * (-2468.258) (-2478.671) (-2464.775) [-2457.054] -- 0:02:01
719500 -- [-2461.687] (-2461.718) (-2460.598) (-2462.356) * [-2468.990] (-2462.641) (-2471.490) (-2467.017) -- 0:02:00
720000 -- (-2470.074) (-2467.455) (-2470.879) [-2460.267] * [-2463.897] (-2465.491) (-2463.672) (-2465.847) -- 0:02:00
Average standard deviation of split frequencies: 0.009594
720500 -- (-2490.238) (-2466.967) (-2468.259) [-2461.022] * (-2458.094) [-2464.191] (-2463.904) (-2462.832) -- 0:02:00
721000 -- [-2468.996] (-2468.493) (-2469.935) (-2465.969) * (-2462.870) [-2462.917] (-2468.512) (-2473.991) -- 0:02:00
721500 -- (-2465.063) [-2464.646] (-2464.327) (-2463.517) * (-2466.902) (-2474.520) [-2465.854] (-2476.131) -- 0:02:00
722000 -- (-2470.358) [-2466.967] (-2466.480) (-2463.892) * (-2467.227) (-2464.690) [-2463.729] (-2474.410) -- 0:01:59
722500 -- [-2461.341] (-2468.097) (-2472.873) (-2459.651) * (-2466.770) [-2456.970] (-2469.101) (-2467.582) -- 0:01:59
723000 -- (-2473.990) (-2459.528) [-2464.919] (-2465.378) * (-2463.608) [-2458.585] (-2471.366) (-2461.088) -- 0:01:59
723500 -- (-2469.415) (-2458.139) [-2466.747] (-2460.765) * (-2468.272) [-2473.129] (-2467.628) (-2463.630) -- 0:01:59
724000 -- (-2472.544) [-2460.516] (-2461.905) (-2460.662) * (-2461.857) [-2458.472] (-2469.765) (-2462.450) -- 0:01:58
724500 -- (-2470.812) (-2460.831) [-2458.137] (-2464.662) * (-2462.582) (-2462.532) (-2464.609) [-2464.331] -- 0:01:59
725000 -- (-2464.125) (-2463.835) (-2460.583) [-2469.593] * (-2466.905) (-2464.006) (-2470.626) [-2462.505] -- 0:01:58
Average standard deviation of split frequencies: 0.009415
725500 -- (-2470.500) (-2467.512) [-2466.996] (-2467.659) * (-2464.908) (-2468.725) [-2460.258] (-2462.352) -- 0:01:58
726000 -- (-2472.038) [-2461.432] (-2469.991) (-2469.070) * [-2459.069] (-2472.453) (-2472.457) (-2465.431) -- 0:01:58
726500 -- (-2463.963) (-2466.245) [-2463.531] (-2463.971) * (-2466.320) [-2468.620] (-2466.938) (-2462.433) -- 0:01:57
727000 -- (-2461.707) (-2467.631) (-2460.280) [-2459.298] * (-2461.198) [-2463.771] (-2462.857) (-2462.717) -- 0:01:57
727500 -- (-2460.678) (-2464.942) (-2469.496) [-2464.739] * (-2470.454) (-2463.206) [-2461.366] (-2468.944) -- 0:01:57
728000 -- (-2463.879) (-2463.784) [-2461.031] (-2463.433) * (-2461.895) (-2473.075) [-2467.591] (-2463.959) -- 0:01:57
728500 -- (-2472.571) (-2470.722) (-2458.832) [-2463.635] * (-2473.682) (-2468.972) [-2466.685] (-2473.155) -- 0:01:57
729000 -- [-2459.727] (-2465.389) (-2459.677) (-2459.557) * (-2464.917) (-2465.314) [-2464.895] (-2472.489) -- 0:01:56
729500 -- (-2460.731) (-2469.217) [-2471.101] (-2473.902) * [-2472.527] (-2471.122) (-2457.814) (-2471.059) -- 0:01:56
730000 -- (-2468.830) (-2471.891) (-2472.149) [-2470.445] * (-2475.657) [-2471.249] (-2467.330) (-2476.344) -- 0:01:56
Average standard deviation of split frequencies: 0.009785
730500 -- (-2464.738) (-2473.250) [-2465.685] (-2459.108) * (-2464.929) (-2468.028) (-2470.109) [-2464.459] -- 0:01:56
731000 -- (-2474.412) (-2468.478) (-2471.460) [-2461.238] * (-2464.625) (-2473.938) [-2478.000] (-2460.697) -- 0:01:55
731500 -- [-2456.200] (-2474.434) (-2470.663) (-2463.384) * [-2471.398] (-2467.781) (-2461.195) (-2464.451) -- 0:01:55
732000 -- (-2463.473) (-2473.340) [-2465.803] (-2463.325) * (-2465.702) (-2478.701) (-2467.559) [-2460.741] -- 0:01:55
732500 -- (-2464.888) [-2470.785] (-2463.665) (-2467.840) * [-2467.842] (-2461.070) (-2468.110) (-2461.283) -- 0:01:55
733000 -- [-2459.938] (-2475.832) (-2469.617) (-2477.701) * (-2471.623) (-2467.774) (-2469.947) [-2461.763] -- 0:01:55
733500 -- (-2473.331) [-2467.213] (-2472.787) (-2458.683) * (-2459.056) (-2462.159) (-2467.585) [-2459.739] -- 0:01:54
734000 -- (-2468.700) [-2460.864] (-2467.383) (-2475.060) * (-2465.323) [-2468.759] (-2475.156) (-2465.012) -- 0:01:54
734500 -- (-2463.667) (-2472.883) (-2467.074) [-2461.639] * (-2469.195) (-2470.019) [-2474.848] (-2466.537) -- 0:01:54
735000 -- (-2466.417) [-2463.480] (-2464.503) (-2462.204) * (-2468.631) (-2466.952) (-2463.837) [-2465.217] -- 0:01:54
Average standard deviation of split frequencies: 0.009341
735500 -- (-2476.693) (-2462.131) (-2465.021) [-2465.368] * (-2462.915) [-2461.362] (-2474.231) (-2470.227) -- 0:01:53
736000 -- (-2458.486) (-2466.576) (-2463.272) [-2457.125] * [-2468.009] (-2469.028) (-2464.583) (-2472.810) -- 0:01:53
736500 -- [-2461.335] (-2466.681) (-2473.867) (-2458.615) * (-2462.512) (-2483.302) (-2460.695) [-2465.062] -- 0:01:53
737000 -- (-2461.401) [-2466.336] (-2472.257) (-2462.245) * (-2461.801) (-2484.505) (-2466.487) [-2459.203] -- 0:01:53
737500 -- (-2467.501) (-2475.432) [-2466.640] (-2472.794) * [-2465.678] (-2479.529) (-2461.414) (-2463.853) -- 0:01:53
738000 -- [-2467.946] (-2469.959) (-2468.926) (-2476.160) * (-2462.737) (-2475.068) [-2462.413] (-2465.487) -- 0:01:52
738500 -- [-2463.156] (-2467.369) (-2469.708) (-2472.687) * [-2465.912] (-2466.615) (-2469.365) (-2465.298) -- 0:01:52
739000 -- [-2465.931] (-2468.902) (-2471.760) (-2467.491) * (-2463.997) [-2464.101] (-2463.124) (-2472.644) -- 0:01:52
739500 -- (-2470.015) [-2461.626] (-2464.930) (-2467.064) * [-2463.151] (-2464.404) (-2470.175) (-2468.306) -- 0:01:52
740000 -- [-2468.609] (-2467.296) (-2461.084) (-2473.569) * (-2459.881) (-2468.790) (-2462.662) [-2466.621] -- 0:01:52
Average standard deviation of split frequencies: 0.009282
740500 -- [-2465.831] (-2463.998) (-2462.109) (-2478.406) * [-2465.103] (-2470.495) (-2475.354) (-2470.633) -- 0:01:51
741000 -- [-2463.024] (-2464.640) (-2469.341) (-2487.360) * [-2468.995] (-2470.456) (-2467.326) (-2467.465) -- 0:01:51
741500 -- [-2455.583] (-2467.034) (-2474.269) (-2465.656) * (-2466.063) (-2470.549) (-2470.529) [-2470.771] -- 0:01:51
742000 -- (-2464.173) (-2470.630) [-2472.309] (-2465.235) * [-2464.444] (-2468.626) (-2469.654) (-2463.168) -- 0:01:51
742500 -- [-2458.597] (-2467.008) (-2480.883) (-2465.507) * (-2462.106) (-2469.921) (-2462.687) [-2460.125] -- 0:01:50
743000 -- (-2464.053) (-2471.156) [-2467.268] (-2472.342) * (-2461.926) (-2466.660) (-2463.514) [-2461.568] -- 0:01:51
743500 -- [-2459.792] (-2467.162) (-2461.823) (-2467.748) * [-2463.083] (-2460.810) (-2461.096) (-2465.155) -- 0:01:50
744000 -- (-2467.314) (-2472.403) [-2464.929] (-2460.994) * (-2461.483) (-2469.101) [-2464.905] (-2460.632) -- 0:01:50
744500 -- (-2473.735) (-2469.917) (-2466.544) [-2464.139] * (-2464.278) [-2466.959] (-2470.890) (-2465.650) -- 0:01:50
745000 -- (-2467.897) (-2465.947) [-2459.873] (-2468.072) * [-2460.621] (-2459.518) (-2467.500) (-2463.623) -- 0:01:49
Average standard deviation of split frequencies: 0.008899
745500 -- (-2464.980) [-2459.732] (-2463.482) (-2474.065) * [-2460.078] (-2463.930) (-2461.560) (-2463.781) -- 0:01:49
746000 -- [-2468.691] (-2470.490) (-2467.918) (-2467.642) * (-2469.883) (-2469.737) [-2470.290] (-2462.416) -- 0:01:49
746500 -- [-2473.209] (-2469.668) (-2469.431) (-2468.121) * [-2460.928] (-2471.354) (-2471.768) (-2466.568) -- 0:01:49
747000 -- (-2469.770) (-2470.307) (-2472.308) [-2469.911] * (-2466.583) (-2461.943) [-2476.118] (-2464.070) -- 0:01:49
747500 -- [-2464.569] (-2464.514) (-2464.851) (-2461.310) * (-2458.226) (-2467.037) [-2464.717] (-2463.403) -- 0:01:48
748000 -- (-2461.191) (-2467.394) [-2463.425] (-2464.406) * (-2466.212) [-2463.480] (-2462.755) (-2467.859) -- 0:01:48
748500 -- (-2466.876) (-2464.382) (-2470.091) [-2465.687] * (-2472.906) (-2478.924) (-2463.935) [-2458.604] -- 0:01:48
749000 -- (-2466.741) (-2465.654) (-2466.791) [-2463.577] * [-2467.467] (-2486.764) (-2457.589) (-2464.278) -- 0:01:48
749500 -- (-2470.682) (-2470.868) (-2466.359) [-2460.172] * [-2462.894] (-2469.219) (-2464.995) (-2466.124) -- 0:01:47
750000 -- (-2471.056) (-2470.521) [-2463.012] (-2467.782) * (-2469.522) (-2465.104) [-2456.543] (-2459.615) -- 0:01:48
Average standard deviation of split frequencies: 0.009367
750500 -- (-2466.022) [-2469.837] (-2469.037) (-2467.867) * (-2466.421) (-2467.230) [-2464.170] (-2467.926) -- 0:01:47
751000 -- (-2462.061) (-2471.083) (-2476.280) [-2465.564] * (-2466.554) (-2473.505) [-2461.757] (-2462.897) -- 0:01:47
751500 -- (-2465.102) [-2466.936] (-2467.923) (-2468.165) * (-2477.634) (-2471.729) [-2462.465] (-2463.936) -- 0:01:47
752000 -- (-2474.839) (-2468.910) (-2465.458) [-2472.101] * (-2466.245) [-2462.652] (-2460.283) (-2467.540) -- 0:01:46
752500 -- (-2468.382) [-2469.382] (-2468.737) (-2463.908) * [-2463.720] (-2469.987) (-2463.545) (-2465.891) -- 0:01:46
753000 -- (-2463.676) (-2469.576) [-2469.692] (-2477.576) * [-2460.472] (-2465.557) (-2465.140) (-2462.945) -- 0:01:46
753500 -- [-2461.126] (-2470.973) (-2466.095) (-2468.209) * [-2462.652] (-2465.696) (-2467.827) (-2470.783) -- 0:01:46
754000 -- (-2468.411) (-2466.845) [-2455.380] (-2474.792) * (-2472.506) (-2469.726) (-2462.789) [-2462.366] -- 0:01:46
754500 -- (-2459.756) [-2468.201] (-2467.757) (-2468.814) * [-2464.389] (-2474.099) (-2471.950) (-2465.320) -- 0:01:46
755000 -- (-2469.898) (-2464.908) [-2463.579] (-2463.636) * (-2468.738) (-2460.170) (-2467.892) [-2462.350] -- 0:01:45
Average standard deviation of split frequencies: 0.009249
755500 -- [-2467.465] (-2466.381) (-2478.851) (-2459.030) * (-2469.781) [-2457.561] (-2469.176) (-2466.328) -- 0:01:45
756000 -- (-2466.739) (-2470.177) [-2466.128] (-2458.794) * (-2463.833) (-2461.898) [-2469.330] (-2469.404) -- 0:01:45
756500 -- (-2459.586) (-2472.682) [-2461.021] (-2463.075) * (-2469.890) [-2462.098] (-2466.086) (-2469.845) -- 0:01:44
757000 -- (-2462.583) [-2459.777] (-2468.482) (-2461.516) * [-2473.638] (-2479.861) (-2474.140) (-2464.069) -- 0:01:44
757500 -- (-2467.963) [-2462.811] (-2461.795) (-2470.288) * [-2464.155] (-2477.168) (-2463.452) (-2472.655) -- 0:01:44
758000 -- (-2461.995) (-2478.022) [-2467.497] (-2463.769) * (-2465.402) [-2459.780] (-2461.426) (-2471.601) -- 0:01:44
758500 -- [-2467.344] (-2464.076) (-2471.769) (-2465.377) * (-2459.093) (-2465.270) (-2483.893) [-2468.722] -- 0:01:44
759000 -- (-2467.886) [-2463.498] (-2474.239) (-2463.297) * (-2460.701) (-2465.108) (-2466.681) [-2463.872] -- 0:01:43
759500 -- (-2476.242) [-2464.591] (-2480.734) (-2462.035) * (-2473.322) (-2466.150) (-2474.799) [-2459.034] -- 0:01:43
760000 -- [-2471.454] (-2464.575) (-2464.952) (-2469.789) * (-2473.487) (-2469.457) (-2475.752) [-2465.116] -- 0:01:43
Average standard deviation of split frequencies: 0.009554
760500 -- (-2470.304) (-2465.087) [-2461.282] (-2456.966) * [-2469.917] (-2476.620) (-2466.397) (-2467.695) -- 0:01:43
761000 -- (-2469.426) [-2463.822] (-2463.270) (-2474.167) * (-2464.469) (-2474.631) [-2465.456] (-2468.513) -- 0:01:43
761500 -- (-2463.115) (-2464.074) [-2459.549] (-2461.871) * (-2472.101) (-2474.555) (-2459.679) [-2463.512] -- 0:01:43
762000 -- [-2461.536] (-2468.689) (-2470.294) (-2467.679) * [-2468.771] (-2471.719) (-2460.614) (-2461.967) -- 0:01:42
762500 -- [-2461.412] (-2468.938) (-2469.565) (-2460.812) * (-2471.697) (-2480.268) (-2461.490) [-2471.969] -- 0:01:42
763000 -- [-2468.866] (-2463.958) (-2466.778) (-2468.238) * [-2477.278] (-2471.060) (-2471.995) (-2460.803) -- 0:01:42
763500 -- (-2464.180) (-2463.177) [-2469.936] (-2465.699) * (-2474.363) (-2462.572) [-2468.230] (-2464.519) -- 0:01:41
764000 -- (-2466.504) (-2466.995) (-2470.169) [-2464.774] * (-2469.383) (-2470.018) (-2466.239) [-2465.106] -- 0:01:41
764500 -- (-2464.247) [-2470.560] (-2464.559) (-2478.134) * (-2471.558) [-2463.195] (-2468.090) (-2464.683) -- 0:01:41
765000 -- (-2470.689) (-2464.361) [-2466.682] (-2471.813) * (-2479.298) (-2466.155) [-2465.620] (-2465.937) -- 0:01:41
Average standard deviation of split frequencies: 0.009488
765500 -- (-2464.040) (-2465.711) (-2473.795) [-2465.563] * (-2477.975) (-2462.844) (-2469.675) [-2469.895] -- 0:01:41
766000 -- (-2460.236) (-2465.521) [-2464.776] (-2478.039) * (-2467.040) (-2464.767) (-2462.816) [-2470.469] -- 0:01:40
766500 -- (-2462.224) (-2476.366) (-2461.249) [-2466.439] * (-2464.533) [-2465.761] (-2465.919) (-2474.817) -- 0:01:40
767000 -- (-2465.943) (-2466.580) (-2467.559) [-2466.563] * (-2468.367) (-2464.852) [-2464.628] (-2461.883) -- 0:01:40
767500 -- (-2460.838) [-2465.714] (-2472.145) (-2466.707) * (-2464.269) [-2473.927] (-2466.432) (-2470.208) -- 0:01:40
768000 -- (-2470.453) (-2461.518) (-2471.943) [-2467.381] * (-2466.767) [-2468.303] (-2463.170) (-2469.930) -- 0:01:39
768500 -- [-2463.309] (-2465.016) (-2470.637) (-2459.479) * (-2467.484) [-2473.609] (-2467.597) (-2471.379) -- 0:01:40
769000 -- (-2467.045) [-2464.828] (-2475.988) (-2463.052) * (-2468.894) [-2473.782] (-2466.609) (-2465.373) -- 0:01:39
769500 -- (-2469.116) (-2470.115) (-2463.746) [-2461.039] * [-2463.757] (-2465.282) (-2472.679) (-2470.530) -- 0:01:39
770000 -- [-2462.614] (-2463.506) (-2475.392) (-2466.101) * (-2462.758) [-2466.976] (-2463.929) (-2476.524) -- 0:01:39
Average standard deviation of split frequencies: 0.009991
770500 -- [-2465.802] (-2479.120) (-2466.758) (-2461.509) * [-2464.823] (-2460.535) (-2471.684) (-2460.557) -- 0:01:38
771000 -- (-2466.493) (-2477.083) (-2464.451) [-2471.789] * (-2469.409) [-2461.315] (-2465.812) (-2472.123) -- 0:01:38
771500 -- [-2467.426] (-2471.679) (-2460.064) (-2465.489) * [-2466.067] (-2464.869) (-2469.377) (-2468.855) -- 0:01:38
772000 -- (-2461.805) (-2468.092) (-2467.809) [-2464.505] * (-2468.139) (-2471.493) (-2475.030) [-2462.398] -- 0:01:38
772500 -- [-2458.544] (-2460.947) (-2463.686) (-2465.614) * (-2464.504) (-2463.985) [-2465.162] (-2460.283) -- 0:01:38
773000 -- (-2463.583) [-2459.152] (-2466.273) (-2459.944) * (-2464.481) [-2464.199] (-2465.874) (-2469.446) -- 0:01:38
773500 -- [-2463.003] (-2467.090) (-2470.522) (-2460.317) * (-2470.045) [-2459.101] (-2471.818) (-2473.992) -- 0:01:37
774000 -- [-2466.141] (-2465.957) (-2473.725) (-2467.329) * (-2473.095) (-2461.460) [-2460.766] (-2469.173) -- 0:01:37
774500 -- (-2468.279) [-2462.407] (-2462.746) (-2464.232) * (-2468.356) (-2464.434) [-2462.711] (-2471.692) -- 0:01:37
775000 -- (-2461.499) [-2468.878] (-2469.329) (-2465.577) * (-2472.062) [-2467.607] (-2464.214) (-2473.553) -- 0:01:36
Average standard deviation of split frequencies: 0.010226
775500 -- (-2471.934) (-2468.305) (-2463.922) [-2475.589] * (-2465.126) (-2481.391) [-2463.314] (-2471.949) -- 0:01:36
776000 -- (-2466.149) (-2472.062) [-2463.567] (-2470.916) * [-2466.380] (-2467.809) (-2478.258) (-2463.194) -- 0:01:36
776500 -- (-2467.329) (-2467.756) (-2463.515) [-2461.359] * (-2471.681) (-2465.104) [-2468.886] (-2467.050) -- 0:01:36
777000 -- (-2464.880) (-2469.922) [-2466.068] (-2466.770) * (-2459.299) (-2471.614) [-2467.480] (-2469.463) -- 0:01:36
777500 -- [-2463.604] (-2463.578) (-2462.026) (-2461.392) * (-2465.462) (-2468.162) [-2466.859] (-2468.997) -- 0:01:35
778000 -- (-2467.660) (-2469.347) [-2463.639] (-2469.888) * (-2466.329) (-2471.803) (-2472.026) [-2464.576] -- 0:01:35
778500 -- (-2467.522) [-2462.561] (-2466.137) (-2466.190) * [-2465.723] (-2464.407) (-2468.082) (-2462.334) -- 0:01:35
779000 -- (-2474.607) (-2464.920) [-2461.034] (-2466.549) * (-2470.872) (-2456.366) (-2472.551) [-2469.204] -- 0:01:35
779500 -- (-2464.784) (-2468.119) [-2463.695] (-2468.963) * [-2460.213] (-2466.270) (-2460.434) (-2457.861) -- 0:01:35
780000 -- (-2482.315) (-2469.988) [-2460.072] (-2463.555) * [-2463.262] (-2466.369) (-2477.379) (-2469.619) -- 0:01:35
Average standard deviation of split frequencies: 0.011372
780500 -- [-2470.043] (-2472.733) (-2467.055) (-2465.228) * [-2473.770] (-2477.097) (-2465.490) (-2459.413) -- 0:01:34
781000 -- (-2470.980) [-2465.787] (-2471.674) (-2470.160) * (-2463.881) (-2483.760) (-2466.688) [-2457.414] -- 0:01:34
781500 -- [-2460.966] (-2475.524) (-2469.361) (-2465.131) * (-2477.129) (-2472.989) (-2462.045) [-2466.720] -- 0:01:34
782000 -- (-2466.134) [-2469.165] (-2466.019) (-2461.951) * (-2463.935) (-2472.941) (-2464.967) [-2460.926] -- 0:01:33
782500 -- (-2464.580) (-2475.731) [-2462.847] (-2467.198) * [-2462.470] (-2473.051) (-2471.256) (-2467.462) -- 0:01:33
783000 -- (-2469.432) (-2464.664) [-2467.852] (-2477.381) * (-2467.481) (-2468.420) [-2467.637] (-2463.138) -- 0:01:33
783500 -- (-2472.664) (-2463.139) (-2475.820) [-2464.358] * (-2471.168) (-2460.206) [-2467.645] (-2466.003) -- 0:01:33
784000 -- (-2472.324) (-2470.781) (-2470.038) [-2461.535] * (-2468.192) [-2466.026] (-2465.872) (-2466.285) -- 0:01:33
784500 -- (-2470.947) (-2466.274) (-2464.155) [-2465.160] * (-2470.351) [-2466.958] (-2464.116) (-2472.547) -- 0:01:33
785000 -- (-2483.502) (-2470.887) [-2469.021] (-2464.662) * (-2472.553) [-2465.485] (-2462.567) (-2473.007) -- 0:01:32
Average standard deviation of split frequencies: 0.011745
785500 -- [-2469.753] (-2463.108) (-2468.911) (-2468.477) * (-2470.466) (-2470.404) [-2460.323] (-2486.747) -- 0:01:32
786000 -- (-2476.380) (-2468.449) [-2459.331] (-2465.897) * (-2459.512) (-2468.595) [-2464.672] (-2481.591) -- 0:01:32
786500 -- (-2467.319) (-2465.010) (-2458.265) [-2472.881] * (-2467.143) (-2465.743) (-2463.521) [-2469.848] -- 0:01:32
787000 -- (-2467.840) (-2458.108) [-2459.590] (-2465.963) * (-2469.859) (-2468.446) (-2465.965) [-2468.246] -- 0:01:32
787500 -- (-2468.186) (-2459.582) (-2462.983) [-2468.468] * [-2462.536] (-2472.622) (-2467.335) (-2465.603) -- 0:01:31
788000 -- (-2468.046) [-2463.154] (-2460.563) (-2476.661) * (-2463.441) [-2471.390] (-2469.416) (-2476.223) -- 0:01:31
788500 -- (-2470.527) [-2462.690] (-2467.112) (-2471.522) * (-2462.359) (-2462.956) (-2469.526) [-2460.512] -- 0:01:31
789000 -- [-2463.172] (-2468.952) (-2474.140) (-2465.711) * (-2465.908) (-2466.623) (-2462.781) [-2469.020] -- 0:01:30
789500 -- (-2481.517) (-2465.323) (-2460.916) [-2458.170] * (-2463.217) (-2466.643) (-2470.076) [-2467.475] -- 0:01:30
790000 -- (-2473.000) [-2464.542] (-2468.094) (-2464.913) * (-2472.527) (-2464.125) [-2462.328] (-2461.112) -- 0:01:30
Average standard deviation of split frequencies: 0.011775
790500 -- (-2472.867) (-2471.608) [-2463.533] (-2471.182) * (-2473.139) (-2462.155) (-2462.201) [-2457.818] -- 0:01:30
791000 -- (-2467.391) (-2465.216) (-2461.830) [-2462.102] * (-2466.936) (-2462.448) (-2470.508) [-2460.768] -- 0:01:30
791500 -- (-2467.913) (-2458.652) (-2469.800) [-2465.892] * (-2462.633) (-2461.927) (-2465.223) [-2464.123] -- 0:01:30
792000 -- (-2474.241) [-2464.043] (-2471.198) (-2467.507) * [-2459.167] (-2465.752) (-2465.938) (-2476.904) -- 0:01:29
792500 -- (-2472.990) [-2461.559] (-2467.334) (-2467.507) * (-2473.005) (-2470.087) [-2467.243] (-2463.126) -- 0:01:29
793000 -- (-2464.589) (-2472.220) (-2470.816) [-2460.824] * (-2485.784) [-2463.045] (-2464.233) (-2464.085) -- 0:01:29
793500 -- (-2469.339) (-2472.886) [-2464.242] (-2462.107) * (-2467.778) [-2464.232] (-2461.519) (-2461.760) -- 0:01:29
794000 -- [-2468.618] (-2470.221) (-2466.902) (-2463.165) * (-2465.936) [-2463.736] (-2462.349) (-2461.922) -- 0:01:28
794500 -- (-2463.632) (-2468.878) [-2464.028] (-2463.618) * (-2475.005) [-2462.485] (-2468.602) (-2465.412) -- 0:01:28
795000 -- [-2463.687] (-2470.393) (-2465.380) (-2467.972) * (-2463.050) [-2468.482] (-2468.021) (-2470.590) -- 0:01:28
Average standard deviation of split frequencies: 0.011647
795500 -- [-2459.907] (-2467.716) (-2459.758) (-2462.986) * (-2467.651) [-2460.713] (-2462.993) (-2471.569) -- 0:01:28
796000 -- (-2462.839) (-2471.041) [-2472.101] (-2465.633) * (-2465.653) [-2462.102] (-2461.211) (-2473.589) -- 0:01:28
796500 -- (-2465.836) (-2467.856) [-2464.625] (-2463.566) * (-2466.939) (-2461.361) (-2466.080) [-2459.823] -- 0:01:27
797000 -- (-2464.021) (-2467.346) [-2466.770] (-2475.826) * (-2476.144) (-2465.000) [-2460.008] (-2464.351) -- 0:01:27
797500 -- (-2463.217) (-2463.240) (-2469.305) [-2464.541] * (-2472.946) (-2463.391) (-2470.414) [-2462.703] -- 0:01:27
798000 -- (-2471.088) [-2462.070] (-2465.658) (-2464.157) * (-2470.916) [-2465.130] (-2464.334) (-2466.417) -- 0:01:27
798500 -- (-2463.354) (-2468.776) [-2467.509] (-2464.995) * (-2467.606) (-2478.618) (-2462.838) [-2466.083] -- 0:01:27
799000 -- (-2463.812) [-2463.391] (-2476.307) (-2468.381) * [-2462.067] (-2465.282) (-2465.609) (-2468.088) -- 0:01:26
799500 -- (-2471.417) [-2464.152] (-2468.832) (-2466.690) * (-2464.342) (-2459.295) [-2475.999] (-2466.415) -- 0:01:26
800000 -- (-2479.263) (-2463.008) [-2468.878] (-2465.821) * [-2466.510] (-2464.234) (-2466.319) (-2473.919) -- 0:01:26
Average standard deviation of split frequencies: 0.011824
800500 -- (-2470.593) (-2469.973) [-2469.088] (-2474.281) * (-2463.177) (-2460.482) (-2467.270) [-2470.053] -- 0:01:25
801000 -- (-2471.979) (-2466.601) (-2464.709) [-2465.515] * (-2465.045) (-2471.063) (-2463.675) [-2467.302] -- 0:01:25
801500 -- (-2468.029) [-2460.409] (-2463.842) (-2463.534) * (-2460.224) [-2462.228] (-2470.546) (-2469.988) -- 0:01:25
802000 -- (-2466.887) (-2473.849) (-2468.369) [-2471.312] * [-2460.205] (-2468.004) (-2470.706) (-2471.744) -- 0:01:25
802500 -- (-2468.029) [-2465.746] (-2463.986) (-2467.865) * [-2467.014] (-2466.788) (-2470.251) (-2473.036) -- 0:01:25
803000 -- (-2462.683) (-2467.753) [-2461.217] (-2461.816) * [-2465.842] (-2470.824) (-2463.354) (-2471.572) -- 0:01:25
803500 -- (-2466.184) (-2470.625) (-2467.033) [-2458.206] * [-2457.023] (-2465.812) (-2466.228) (-2473.125) -- 0:01:24
804000 -- (-2467.948) (-2475.446) (-2466.479) [-2466.175] * (-2467.059) [-2461.308] (-2464.718) (-2471.288) -- 0:01:24
804500 -- (-2464.380) (-2463.234) (-2467.141) [-2464.634] * (-2468.686) (-2469.802) [-2459.967] (-2476.423) -- 0:01:24
805000 -- (-2477.939) [-2463.389] (-2469.856) (-2463.224) * [-2468.382] (-2467.371) (-2456.188) (-2481.523) -- 0:01:24
Average standard deviation of split frequencies: 0.011697
805500 -- (-2458.410) (-2466.504) (-2482.075) [-2467.993] * (-2469.786) (-2471.662) [-2462.968] (-2464.152) -- 0:01:24
806000 -- (-2463.848) (-2465.201) (-2465.766) [-2462.273] * (-2469.276) (-2469.134) [-2465.113] (-2465.699) -- 0:01:23
806500 -- (-2460.255) (-2474.755) [-2460.130] (-2465.146) * (-2469.521) [-2465.788] (-2467.698) (-2466.847) -- 0:01:23
807000 -- (-2470.363) [-2462.033] (-2471.411) (-2468.012) * [-2465.741] (-2472.236) (-2465.702) (-2461.321) -- 0:01:23
807500 -- (-2474.435) (-2461.855) (-2469.348) [-2472.824] * (-2465.823) [-2460.970] (-2472.500) (-2468.971) -- 0:01:22
808000 -- (-2478.561) (-2467.964) (-2463.995) [-2462.131] * (-2463.412) [-2463.893] (-2465.543) (-2461.481) -- 0:01:22
808500 -- (-2461.754) (-2463.769) (-2467.401) [-2468.934] * (-2464.990) (-2465.352) (-2472.247) [-2462.833] -- 0:01:22
809000 -- (-2463.443) (-2467.906) [-2464.935] (-2466.538) * (-2470.913) [-2470.547] (-2461.855) (-2471.793) -- 0:01:22
809500 -- (-2477.945) (-2472.287) [-2460.126] (-2476.097) * (-2473.340) (-2467.989) [-2469.266] (-2464.545) -- 0:01:22
810000 -- [-2466.000] (-2462.600) (-2468.408) (-2483.054) * (-2471.594) (-2467.200) (-2475.501) [-2462.521] -- 0:01:22
Average standard deviation of split frequencies: 0.011291
810500 -- (-2474.849) (-2459.617) (-2469.392) [-2465.023] * [-2473.277] (-2464.782) (-2482.145) (-2461.603) -- 0:01:21
811000 -- (-2472.212) (-2465.381) [-2465.286] (-2464.895) * (-2471.697) [-2464.067] (-2471.981) (-2471.629) -- 0:01:21
811500 -- (-2478.594) (-2462.421) (-2462.420) [-2472.181] * (-2465.005) [-2463.020] (-2468.090) (-2479.845) -- 0:01:21
812000 -- (-2472.952) (-2473.984) [-2459.569] (-2466.446) * (-2460.759) (-2469.511) (-2457.739) [-2475.424] -- 0:01:21
812500 -- (-2462.880) (-2469.130) [-2468.717] (-2462.363) * [-2463.413] (-2482.456) (-2461.446) (-2465.329) -- 0:01:21
813000 -- (-2468.870) [-2469.928] (-2468.541) (-2462.744) * [-2461.042] (-2467.979) (-2465.744) (-2464.408) -- 0:01:20
813500 -- (-2471.016) [-2472.584] (-2466.885) (-2462.705) * (-2464.693) [-2462.981] (-2458.759) (-2462.146) -- 0:01:20
814000 -- (-2471.113) (-2471.344) (-2468.193) [-2464.928] * (-2469.837) [-2464.010] (-2465.897) (-2474.501) -- 0:01:20
814500 -- [-2467.022] (-2471.411) (-2466.573) (-2470.450) * (-2475.799) (-2462.849) (-2471.483) [-2464.193] -- 0:01:20
815000 -- [-2469.616] (-2468.288) (-2463.017) (-2468.263) * (-2465.510) (-2470.878) (-2474.208) [-2470.661] -- 0:01:19
Average standard deviation of split frequencies: 0.011747
815500 -- (-2468.431) [-2464.693] (-2464.800) (-2473.217) * (-2466.830) (-2465.538) [-2466.565] (-2467.276) -- 0:01:19
816000 -- [-2466.907] (-2465.898) (-2466.033) (-2464.097) * [-2464.269] (-2463.975) (-2466.156) (-2458.703) -- 0:01:19
816500 -- (-2466.379) (-2463.725) [-2461.605] (-2465.877) * [-2460.210] (-2464.179) (-2464.257) (-2466.605) -- 0:01:19
817000 -- (-2474.874) [-2465.034] (-2459.343) (-2465.423) * (-2462.267) (-2462.650) [-2461.280] (-2462.871) -- 0:01:19
817500 -- [-2463.946] (-2464.402) (-2467.118) (-2465.240) * (-2459.024) (-2472.040) (-2462.570) [-2466.492] -- 0:01:18
818000 -- (-2462.923) (-2469.333) [-2470.170] (-2473.729) * (-2469.422) (-2464.507) [-2458.997] (-2461.905) -- 0:01:18
818500 -- [-2464.845] (-2471.394) (-2472.639) (-2466.888) * (-2466.388) (-2462.206) (-2474.166) [-2464.074] -- 0:01:18
819000 -- (-2464.677) (-2465.993) (-2463.139) [-2460.997] * (-2464.656) [-2465.122] (-2471.101) (-2472.366) -- 0:01:18
819500 -- (-2471.728) (-2464.037) (-2465.378) [-2461.483] * (-2463.722) (-2460.991) (-2469.054) [-2461.293] -- 0:01:17
820000 -- [-2466.275] (-2463.205) (-2464.912) (-2466.191) * (-2480.085) (-2471.635) (-2471.888) [-2464.084] -- 0:01:17
Average standard deviation of split frequencies: 0.011440
820500 -- (-2464.131) (-2475.491) (-2467.202) [-2469.444] * (-2465.106) [-2468.431] (-2469.614) (-2466.720) -- 0:01:17
821000 -- [-2462.704] (-2464.836) (-2465.789) (-2472.557) * (-2468.802) (-2464.246) [-2460.282] (-2474.531) -- 0:01:17
821500 -- (-2472.458) [-2466.354] (-2461.950) (-2466.212) * (-2468.774) (-2466.659) [-2462.946] (-2468.222) -- 0:01:17
822000 -- [-2458.685] (-2460.439) (-2472.877) (-2459.261) * (-2479.393) (-2467.889) [-2463.389] (-2466.863) -- 0:01:16
822500 -- [-2465.248] (-2469.588) (-2470.266) (-2463.093) * (-2466.362) (-2467.632) [-2471.674] (-2471.933) -- 0:01:16
823000 -- [-2465.685] (-2475.406) (-2477.613) (-2467.551) * (-2469.143) [-2468.741] (-2461.945) (-2461.932) -- 0:01:16
823500 -- (-2474.331) (-2467.938) (-2477.327) [-2462.983] * [-2468.566] (-2479.357) (-2461.499) (-2461.379) -- 0:01:16
824000 -- (-2468.327) (-2466.101) [-2466.326] (-2463.415) * (-2462.292) (-2475.086) [-2468.772] (-2484.348) -- 0:01:16
824500 -- [-2461.362] (-2464.265) (-2472.369) (-2466.861) * (-2465.226) (-2461.726) [-2468.896] (-2475.328) -- 0:01:15
825000 -- [-2467.440] (-2466.988) (-2476.625) (-2468.695) * (-2464.423) (-2467.487) (-2464.430) [-2473.979] -- 0:01:15
Average standard deviation of split frequencies: 0.011747
825500 -- (-2468.488) [-2467.425] (-2473.093) (-2458.475) * (-2464.414) (-2463.361) [-2464.889] (-2481.596) -- 0:01:15
826000 -- (-2467.142) [-2458.963] (-2471.780) (-2478.843) * (-2471.394) [-2460.230] (-2467.543) (-2467.947) -- 0:01:15
826500 -- [-2464.074] (-2470.659) (-2469.720) (-2469.138) * (-2468.314) (-2463.626) [-2461.503] (-2478.358) -- 0:01:14
827000 -- (-2462.700) (-2464.749) [-2464.060] (-2469.119) * (-2462.939) [-2458.452] (-2466.852) (-2469.854) -- 0:01:14
827500 -- (-2468.566) (-2472.355) [-2468.054] (-2470.995) * (-2470.879) (-2466.369) (-2469.245) [-2467.533] -- 0:01:14
828000 -- (-2463.258) (-2467.672) (-2477.352) [-2456.003] * (-2470.030) [-2463.232] (-2471.546) (-2468.570) -- 0:01:14
828500 -- [-2464.136] (-2467.531) (-2468.916) (-2467.926) * (-2469.021) (-2460.843) (-2469.631) [-2471.096] -- 0:01:14
829000 -- (-2472.482) (-2467.415) (-2464.261) [-2468.617] * (-2469.954) [-2460.810] (-2464.850) (-2471.430) -- 0:01:13
829500 -- (-2479.371) (-2467.976) [-2473.184] (-2468.555) * (-2459.779) (-2465.225) (-2480.606) [-2466.515] -- 0:01:13
830000 -- (-2472.830) [-2463.688] (-2457.790) (-2467.100) * (-2466.883) (-2465.808) [-2469.878] (-2465.691) -- 0:01:13
Average standard deviation of split frequencies: 0.010924
830500 -- (-2467.473) (-2467.300) [-2461.406] (-2459.542) * [-2460.467] (-2470.131) (-2475.683) (-2465.949) -- 0:01:13
831000 -- (-2469.132) [-2463.006] (-2467.810) (-2469.004) * (-2467.345) (-2482.708) [-2467.640] (-2462.709) -- 0:01:13
831500 -- (-2465.253) [-2463.984] (-2468.192) (-2469.014) * (-2468.032) (-2465.248) [-2463.796] (-2461.595) -- 0:01:12
832000 -- [-2473.977] (-2466.406) (-2469.850) (-2468.617) * (-2470.788) (-2473.525) (-2464.824) [-2462.460] -- 0:01:12
832500 -- [-2464.447] (-2467.002) (-2463.869) (-2468.595) * (-2471.916) (-2471.488) (-2464.459) [-2463.923] -- 0:01:12
833000 -- [-2463.171] (-2465.774) (-2462.713) (-2468.233) * (-2460.038) (-2472.253) [-2470.337] (-2469.287) -- 0:01:12
833500 -- (-2472.596) [-2465.782] (-2462.504) (-2471.797) * (-2464.531) (-2474.424) [-2461.578] (-2464.348) -- 0:01:11
834000 -- (-2469.501) [-2470.132] (-2457.846) (-2479.192) * (-2467.083) (-2473.463) [-2469.007] (-2470.076) -- 0:01:11
834500 -- [-2466.977] (-2465.887) (-2468.169) (-2477.278) * (-2465.963) [-2464.139] (-2458.681) (-2466.983) -- 0:01:11
835000 -- (-2468.104) [-2463.128] (-2477.407) (-2472.013) * (-2465.442) [-2465.738] (-2468.083) (-2472.523) -- 0:01:11
Average standard deviation of split frequencies: 0.010150
835500 -- (-2466.729) [-2467.866] (-2470.211) (-2470.113) * [-2462.262] (-2467.232) (-2460.698) (-2461.623) -- 0:01:11
836000 -- (-2463.153) [-2461.460] (-2467.297) (-2462.802) * (-2469.248) [-2461.691] (-2467.222) (-2464.564) -- 0:01:10
836500 -- (-2467.227) (-2472.748) (-2462.026) [-2467.533] * (-2459.001) (-2464.332) (-2466.991) [-2465.248] -- 0:01:10
837000 -- (-2474.331) (-2481.111) [-2465.569] (-2464.614) * (-2469.023) [-2461.333] (-2459.538) (-2466.547) -- 0:01:10
837500 -- [-2465.639] (-2468.232) (-2466.199) (-2472.229) * (-2468.419) (-2462.364) [-2465.929] (-2472.754) -- 0:01:10
838000 -- [-2467.552] (-2466.178) (-2472.942) (-2470.366) * (-2468.003) [-2458.123] (-2472.197) (-2464.789) -- 0:01:09
838500 -- (-2466.255) [-2469.671] (-2471.028) (-2470.489) * [-2466.764] (-2468.046) (-2464.913) (-2466.643) -- 0:01:09
839000 -- [-2463.965] (-2465.868) (-2460.562) (-2462.267) * (-2466.052) (-2463.450) (-2471.282) [-2467.273] -- 0:01:09
839500 -- [-2467.094] (-2464.536) (-2474.850) (-2472.635) * (-2483.448) (-2469.616) [-2466.912] (-2465.443) -- 0:01:09
840000 -- [-2462.146] (-2466.130) (-2470.984) (-2465.111) * [-2473.700] (-2469.957) (-2461.132) (-2470.807) -- 0:01:09
Average standard deviation of split frequencies: 0.009813
840500 -- (-2466.969) (-2481.736) [-2464.047] (-2465.687) * (-2459.675) [-2464.138] (-2463.578) (-2468.953) -- 0:01:08
841000 -- (-2465.822) [-2467.053] (-2468.304) (-2471.928) * [-2473.828] (-2465.422) (-2465.629) (-2478.265) -- 0:01:08
841500 -- [-2461.620] (-2467.958) (-2467.229) (-2464.344) * (-2467.487) [-2468.087] (-2471.070) (-2478.898) -- 0:01:08
842000 -- (-2470.411) [-2466.262] (-2481.532) (-2467.646) * [-2463.540] (-2465.119) (-2466.983) (-2464.165) -- 0:01:08
842500 -- (-2469.110) (-2470.064) [-2468.347] (-2473.513) * (-2469.328) (-2460.745) [-2468.098] (-2473.386) -- 0:01:08
843000 -- (-2470.772) [-2469.207] (-2464.856) (-2465.230) * (-2463.965) (-2466.783) (-2470.732) [-2462.979] -- 0:01:07
843500 -- (-2475.081) [-2463.963] (-2466.542) (-2463.563) * [-2465.763] (-2475.325) (-2466.762) (-2469.026) -- 0:01:07
844000 -- (-2465.650) [-2466.088] (-2470.337) (-2476.463) * [-2465.648] (-2479.299) (-2462.468) (-2473.034) -- 0:01:07
844500 -- (-2467.806) [-2466.457] (-2464.492) (-2474.997) * (-2463.274) (-2464.139) [-2465.534] (-2467.495) -- 0:01:07
845000 -- (-2474.259) (-2460.725) (-2467.529) [-2472.502] * (-2466.142) (-2463.909) [-2458.819] (-2461.529) -- 0:01:06
Average standard deviation of split frequencies: 0.009844
845500 -- [-2464.085] (-2460.052) (-2472.865) (-2465.930) * (-2468.001) (-2467.795) [-2461.093] (-2470.445) -- 0:01:06
846000 -- (-2464.245) (-2467.785) [-2465.841] (-2471.367) * [-2479.196] (-2465.648) (-2460.663) (-2465.274) -- 0:01:06
846500 -- (-2463.742) (-2463.527) (-2468.547) [-2465.506] * (-2467.420) (-2466.175) (-2468.399) [-2467.710] -- 0:01:06
847000 -- (-2455.269) (-2478.164) [-2469.972] (-2471.084) * [-2465.740] (-2474.140) (-2471.682) (-2467.759) -- 0:01:06
847500 -- (-2463.370) [-2465.919] (-2483.845) (-2465.828) * (-2464.920) (-2462.816) (-2474.027) [-2465.408] -- 0:01:05
848000 -- (-2464.732) (-2473.392) [-2466.685] (-2467.165) * [-2462.548] (-2470.299) (-2469.370) (-2475.630) -- 0:01:05
848500 -- (-2465.185) (-2469.362) (-2463.782) [-2466.382] * (-2465.184) [-2464.283] (-2465.291) (-2465.023) -- 0:01:05
849000 -- (-2473.382) [-2466.143] (-2464.243) (-2463.851) * [-2464.811] (-2466.604) (-2465.641) (-2465.248) -- 0:01:05
849500 -- [-2456.073] (-2463.032) (-2468.692) (-2473.460) * [-2468.036] (-2468.908) (-2474.073) (-2465.831) -- 0:01:05
850000 -- (-2461.690) (-2466.611) [-2464.730] (-2464.108) * (-2465.961) [-2463.153] (-2464.935) (-2460.869) -- 0:01:04
Average standard deviation of split frequencies: 0.010390
850500 -- (-2458.757) (-2466.917) (-2464.016) [-2467.480] * [-2459.159] (-2478.416) (-2464.862) (-2470.492) -- 0:01:04
851000 -- [-2469.452] (-2459.013) (-2465.921) (-2461.621) * (-2465.019) [-2464.835] (-2468.847) (-2469.797) -- 0:01:04
851500 -- (-2477.017) [-2464.174] (-2466.156) (-2462.571) * [-2461.318] (-2467.660) (-2467.294) (-2460.520) -- 0:01:04
852000 -- (-2467.302) (-2461.993) [-2462.880] (-2466.499) * [-2466.319] (-2471.078) (-2464.364) (-2463.514) -- 0:01:03
852500 -- (-2467.194) (-2463.016) (-2472.992) [-2464.440] * (-2468.822) (-2462.439) (-2470.277) [-2470.039] -- 0:01:03
853000 -- (-2465.084) (-2466.921) [-2462.438] (-2461.849) * [-2466.637] (-2472.431) (-2461.832) (-2469.055) -- 0:01:03
853500 -- (-2469.053) (-2475.071) (-2462.335) [-2463.585] * [-2464.240] (-2463.349) (-2476.181) (-2469.592) -- 0:01:03
854000 -- (-2468.105) (-2469.925) (-2461.654) [-2463.231] * (-2466.124) (-2473.139) (-2467.882) [-2472.304] -- 0:01:03
854500 -- (-2469.911) (-2463.433) [-2456.875] (-2470.155) * [-2461.350] (-2462.319) (-2470.821) (-2474.969) -- 0:01:02
855000 -- (-2466.855) (-2477.764) (-2490.147) [-2468.191] * (-2472.826) (-2474.340) (-2468.877) [-2461.384] -- 0:01:02
Average standard deviation of split frequencies: 0.010280
855500 -- (-2475.619) (-2457.609) (-2473.734) [-2457.598] * (-2462.090) (-2465.750) (-2478.437) [-2465.100] -- 0:01:02
856000 -- (-2465.687) (-2463.667) [-2462.710] (-2461.711) * [-2458.890] (-2466.442) (-2468.153) (-2459.023) -- 0:01:02
856500 -- [-2459.791] (-2465.007) (-2470.251) (-2461.114) * (-2466.526) [-2469.302] (-2469.990) (-2473.260) -- 0:01:01
857000 -- (-2471.868) (-2469.603) [-2472.305] (-2466.773) * (-2469.302) [-2460.596] (-2471.466) (-2471.190) -- 0:01:01
857500 -- (-2474.522) (-2473.697) (-2464.826) [-2461.955] * [-2458.986] (-2462.745) (-2465.773) (-2478.106) -- 0:01:01
858000 -- (-2477.578) (-2463.227) [-2462.822] (-2460.321) * (-2466.221) (-2468.867) [-2469.734] (-2473.630) -- 0:01:01
858500 -- (-2465.704) (-2462.206) (-2465.124) [-2463.866] * (-2466.453) (-2477.185) (-2471.055) [-2467.420] -- 0:01:01
859000 -- [-2461.472] (-2468.288) (-2472.613) (-2471.686) * (-2472.780) (-2461.138) (-2467.020) [-2469.325] -- 0:01:00
859500 -- (-2467.303) [-2463.786] (-2468.692) (-2465.114) * (-2461.580) (-2465.872) (-2467.840) [-2466.410] -- 0:01:00
860000 -- (-2464.809) [-2462.523] (-2462.635) (-2470.046) * (-2465.129) [-2464.363] (-2463.603) (-2466.831) -- 0:01:00
Average standard deviation of split frequencies: 0.010042
860500 -- (-2469.045) (-2462.581) [-2460.940] (-2463.768) * [-2462.804] (-2468.638) (-2468.337) (-2466.209) -- 0:01:00
861000 -- (-2462.144) (-2463.562) [-2461.395] (-2473.663) * [-2461.165] (-2463.824) (-2465.058) (-2465.140) -- 0:01:00
861500 -- (-2462.803) (-2468.227) [-2459.286] (-2463.315) * (-2478.704) (-2462.601) (-2470.661) [-2464.137] -- 0:00:59
862000 -- (-2464.732) (-2471.247) [-2467.455] (-2468.825) * (-2469.183) (-2475.273) [-2472.264] (-2467.894) -- 0:00:59
862500 -- (-2460.947) (-2457.195) [-2456.782] (-2462.654) * (-2473.326) [-2456.705] (-2482.812) (-2463.505) -- 0:00:59
863000 -- (-2463.217) (-2456.622) [-2469.975] (-2466.595) * (-2471.556) (-2463.733) [-2466.027] (-2463.598) -- 0:00:59
863500 -- (-2464.157) (-2478.726) [-2463.051] (-2470.631) * [-2469.674] (-2469.722) (-2458.345) (-2466.745) -- 0:00:58
864000 -- [-2467.533] (-2471.623) (-2468.546) (-2476.247) * (-2464.324) [-2461.904] (-2471.060) (-2465.559) -- 0:00:58
864500 -- (-2462.105) (-2455.489) [-2459.454] (-2467.652) * [-2466.316] (-2462.277) (-2470.048) (-2463.286) -- 0:00:58
865000 -- (-2464.388) [-2468.351] (-2457.647) (-2467.472) * (-2463.830) (-2463.252) (-2474.770) [-2462.450] -- 0:00:58
Average standard deviation of split frequencies: 0.010433
865500 -- (-2468.722) [-2458.751] (-2476.350) (-2460.783) * (-2462.011) (-2461.771) [-2464.455] (-2467.107) -- 0:00:58
866000 -- [-2461.565] (-2461.646) (-2464.913) (-2465.188) * (-2470.934) [-2469.429] (-2468.054) (-2470.398) -- 0:00:57
866500 -- [-2462.386] (-2466.012) (-2463.857) (-2473.132) * (-2468.674) (-2466.654) [-2460.889] (-2458.894) -- 0:00:57
867000 -- [-2464.783] (-2467.542) (-2466.294) (-2465.183) * (-2477.144) (-2478.718) (-2465.921) [-2468.150] -- 0:00:57
867500 -- (-2467.117) (-2471.491) (-2464.300) [-2466.880] * (-2477.515) [-2473.328] (-2464.389) (-2462.966) -- 0:00:57
868000 -- (-2468.040) [-2467.272] (-2473.552) (-2468.972) * (-2463.876) (-2476.868) (-2468.390) [-2466.239] -- 0:00:57
868500 -- [-2462.669] (-2470.862) (-2475.921) (-2462.871) * (-2467.388) [-2468.976] (-2463.622) (-2474.890) -- 0:00:56
869000 -- (-2471.501) (-2464.780) (-2476.678) [-2471.315] * [-2465.245] (-2464.107) (-2461.510) (-2472.112) -- 0:00:56
869500 -- (-2470.543) (-2466.805) (-2469.498) [-2466.505] * (-2464.184) (-2467.314) [-2463.863] (-2468.094) -- 0:00:56
870000 -- (-2462.379) (-2466.122) [-2460.313] (-2471.626) * [-2465.289] (-2464.314) (-2465.492) (-2466.961) -- 0:00:56
Average standard deviation of split frequencies: 0.010287
870500 -- [-2465.857] (-2473.461) (-2462.997) (-2467.928) * (-2460.283) (-2463.434) [-2468.410] (-2462.058) -- 0:00:55
871000 -- (-2470.652) (-2468.348) (-2465.100) [-2470.542] * (-2461.585) [-2463.991] (-2466.788) (-2467.406) -- 0:00:55
871500 -- [-2464.680] (-2464.074) (-2471.719) (-2463.284) * (-2463.706) [-2460.918] (-2455.960) (-2464.564) -- 0:00:55
872000 -- (-2463.227) [-2462.978] (-2467.490) (-2461.483) * [-2464.844] (-2459.472) (-2458.783) (-2471.110) -- 0:00:55
872500 -- (-2474.645) (-2468.126) (-2470.330) [-2463.026] * (-2477.555) (-2467.513) [-2463.579] (-2470.033) -- 0:00:55
873000 -- [-2461.714] (-2458.952) (-2464.488) (-2473.035) * (-2467.234) (-2464.752) [-2460.190] (-2477.682) -- 0:00:54
873500 -- (-2467.495) (-2466.997) (-2472.178) [-2465.263] * (-2471.132) [-2464.264] (-2470.859) (-2470.378) -- 0:00:54
874000 -- (-2468.148) (-2464.215) (-2471.004) [-2470.241] * (-2473.000) [-2465.914] (-2472.564) (-2468.194) -- 0:00:54
874500 -- (-2467.747) (-2465.635) (-2460.083) [-2464.216] * [-2469.912] (-2467.137) (-2465.014) (-2468.729) -- 0:00:54
875000 -- (-2467.247) [-2461.560] (-2467.786) (-2466.948) * (-2471.125) [-2469.877] (-2470.181) (-2465.275) -- 0:00:54
Average standard deviation of split frequencies: 0.010000
875500 -- (-2469.157) (-2470.052) (-2469.054) [-2462.972] * (-2470.135) (-2472.380) (-2471.468) [-2476.630] -- 0:00:53
876000 -- (-2471.044) (-2465.923) [-2470.953] (-2483.331) * (-2462.940) (-2462.882) (-2474.802) [-2469.298] -- 0:00:53
876500 -- [-2466.977] (-2471.038) (-2458.532) (-2472.643) * [-2462.920] (-2465.216) (-2468.268) (-2466.949) -- 0:00:53
877000 -- [-2463.594] (-2471.450) (-2468.593) (-2465.130) * (-2457.459) [-2458.408] (-2463.414) (-2471.672) -- 0:00:53
877500 -- (-2476.302) [-2469.422] (-2465.153) (-2467.839) * (-2464.092) (-2460.497) (-2469.822) [-2463.167] -- 0:00:52
878000 -- [-2467.779] (-2465.815) (-2463.448) (-2464.926) * (-2470.892) (-2461.424) [-2465.097] (-2468.863) -- 0:00:52
878500 -- (-2472.317) (-2464.190) [-2469.274] (-2471.961) * (-2465.153) (-2463.254) [-2458.787] (-2467.369) -- 0:00:52
879000 -- (-2463.885) [-2460.037] (-2460.996) (-2460.249) * (-2472.356) [-2465.931] (-2462.559) (-2469.820) -- 0:00:52
879500 -- [-2462.318] (-2463.388) (-2473.289) (-2471.222) * (-2471.938) (-2475.003) (-2471.614) [-2461.796] -- 0:00:52
880000 -- (-2461.185) [-2470.192] (-2467.053) (-2463.292) * [-2467.685] (-2465.386) (-2483.539) (-2468.271) -- 0:00:51
Average standard deviation of split frequencies: 0.009813
880500 -- (-2464.181) [-2461.756] (-2461.028) (-2474.106) * [-2473.955] (-2460.075) (-2470.726) (-2468.293) -- 0:00:51
881000 -- (-2465.543) [-2464.421] (-2462.628) (-2461.359) * (-2464.318) (-2471.560) [-2469.761] (-2464.920) -- 0:00:51
881500 -- (-2477.126) (-2466.990) [-2472.395] (-2459.876) * [-2467.170] (-2475.612) (-2480.154) (-2465.482) -- 0:00:51
882000 -- (-2476.077) (-2476.925) (-2472.118) [-2460.149] * (-2473.225) (-2474.214) (-2481.653) [-2457.819] -- 0:00:50
882500 -- (-2470.402) (-2472.061) (-2464.238) [-2471.826] * (-2469.513) (-2470.163) (-2469.016) [-2460.098] -- 0:00:50
883000 -- (-2473.267) [-2463.971] (-2463.627) (-2466.596) * [-2464.092] (-2471.470) (-2469.475) (-2474.701) -- 0:00:50
883500 -- (-2471.059) (-2471.397) (-2462.575) [-2460.457] * [-2469.264] (-2465.318) (-2469.442) (-2466.233) -- 0:00:50
884000 -- (-2474.670) [-2458.720] (-2461.022) (-2468.423) * [-2467.283] (-2465.655) (-2464.445) (-2467.557) -- 0:00:50
884500 -- (-2468.876) (-2460.634) [-2458.565] (-2466.422) * [-2463.391] (-2464.990) (-2471.202) (-2476.899) -- 0:00:49
885000 -- (-2470.697) (-2476.804) (-2462.678) [-2460.343] * (-2467.176) (-2473.902) (-2467.320) [-2471.685] -- 0:00:49
Average standard deviation of split frequencies: 0.009754
885500 -- (-2475.644) (-2461.762) [-2459.395] (-2468.700) * (-2461.048) [-2463.836] (-2471.154) (-2478.397) -- 0:00:49
886000 -- (-2464.026) (-2469.165) (-2462.151) [-2464.045] * (-2462.791) [-2463.195] (-2473.911) (-2466.051) -- 0:00:49
886500 -- [-2464.059] (-2466.861) (-2464.901) (-2459.758) * (-2475.576) (-2464.751) (-2472.013) [-2458.662] -- 0:00:49
887000 -- [-2460.680] (-2474.237) (-2466.881) (-2471.389) * (-2471.912) (-2466.208) (-2467.866) [-2463.775] -- 0:00:48
887500 -- (-2464.098) (-2473.010) (-2472.724) [-2465.194] * (-2471.610) (-2467.979) [-2464.347] (-2461.139) -- 0:00:48
888000 -- (-2470.462) [-2470.494] (-2472.772) (-2461.460) * (-2471.203) (-2464.185) [-2464.912] (-2463.318) -- 0:00:48
888500 -- (-2463.393) (-2462.428) [-2470.111] (-2469.766) * (-2469.592) (-2469.400) (-2461.723) [-2459.670] -- 0:00:48
889000 -- (-2461.397) (-2464.870) [-2462.644] (-2473.411) * [-2467.648] (-2467.870) (-2481.304) (-2461.395) -- 0:00:47
889500 -- (-2462.087) [-2464.317] (-2466.967) (-2475.067) * (-2478.311) [-2471.568] (-2469.602) (-2468.663) -- 0:00:47
890000 -- (-2466.259) (-2478.412) [-2463.263] (-2456.852) * (-2471.531) (-2472.330) [-2461.890] (-2463.762) -- 0:00:47
Average standard deviation of split frequencies: 0.009174
890500 -- (-2467.554) (-2471.426) [-2461.804] (-2459.821) * (-2465.922) [-2470.836] (-2461.028) (-2477.729) -- 0:00:47
891000 -- (-2472.389) (-2470.735) [-2461.907] (-2469.017) * (-2464.785) [-2461.704] (-2468.932) (-2481.583) -- 0:00:47
891500 -- (-2469.149) (-2479.927) [-2465.151] (-2464.510) * (-2467.759) [-2463.389] (-2459.580) (-2471.806) -- 0:00:46
892000 -- (-2478.414) (-2467.721) [-2464.083] (-2463.404) * [-2466.455] (-2472.405) (-2466.566) (-2474.197) -- 0:00:46
892500 -- (-2473.706) (-2467.379) (-2467.120) [-2465.523] * [-2467.565] (-2469.679) (-2459.753) (-2466.455) -- 0:00:46
893000 -- (-2462.257) (-2469.494) (-2463.603) [-2459.039] * [-2468.020] (-2469.217) (-2462.760) (-2468.566) -- 0:00:46
893500 -- (-2460.656) [-2461.728] (-2460.599) (-2465.009) * (-2471.258) [-2467.196] (-2477.174) (-2474.322) -- 0:00:46
894000 -- (-2455.626) [-2469.443] (-2471.174) (-2472.146) * (-2476.027) [-2459.174] (-2465.643) (-2474.383) -- 0:00:45
894500 -- (-2474.029) [-2461.715] (-2472.877) (-2469.859) * (-2468.687) [-2456.606] (-2466.041) (-2465.074) -- 0:00:45
895000 -- [-2465.327] (-2459.313) (-2471.863) (-2463.733) * (-2476.814) [-2457.745] (-2469.211) (-2464.668) -- 0:00:45
Average standard deviation of split frequencies: 0.009076
895500 -- (-2466.581) (-2468.856) (-2466.202) [-2459.452] * (-2469.222) (-2463.594) [-2459.050] (-2461.761) -- 0:00:45
896000 -- (-2471.276) (-2465.811) [-2462.136] (-2460.845) * (-2474.583) [-2460.154] (-2463.117) (-2467.192) -- 0:00:44
896500 -- [-2461.053] (-2458.194) (-2468.142) (-2471.603) * (-2470.155) (-2462.791) [-2465.898] (-2465.256) -- 0:00:44
897000 -- [-2460.785] (-2464.216) (-2464.226) (-2467.356) * [-2458.187] (-2467.280) (-2461.869) (-2465.514) -- 0:00:44
897500 -- (-2463.798) (-2470.007) (-2462.020) [-2462.730] * (-2468.461) (-2462.037) [-2463.590] (-2464.598) -- 0:00:44
898000 -- [-2467.118] (-2472.493) (-2472.744) (-2461.429) * (-2468.407) (-2470.088) (-2461.896) [-2464.003] -- 0:00:44
898500 -- (-2468.760) (-2466.186) (-2466.644) [-2463.477] * (-2467.484) (-2461.781) [-2467.115] (-2463.617) -- 0:00:43
899000 -- (-2474.547) (-2463.082) (-2472.843) [-2461.170] * [-2467.091] (-2458.589) (-2469.932) (-2474.332) -- 0:00:43
899500 -- (-2465.771) (-2472.454) (-2474.670) [-2467.917] * (-2463.867) [-2459.475] (-2465.889) (-2468.494) -- 0:00:43
900000 -- (-2478.744) [-2462.098] (-2472.241) (-2469.181) * (-2470.098) [-2460.985] (-2464.747) (-2473.152) -- 0:00:43
Average standard deviation of split frequencies: 0.009770
900500 -- [-2462.734] (-2477.632) (-2474.441) (-2468.225) * [-2469.791] (-2478.539) (-2458.931) (-2465.618) -- 0:00:42
901000 -- (-2460.066) (-2468.324) (-2463.389) [-2475.314] * (-2462.460) [-2465.578] (-2470.550) (-2471.054) -- 0:00:42
901500 -- (-2468.946) (-2460.382) (-2464.978) [-2462.251] * [-2460.490] (-2464.741) (-2471.097) (-2459.524) -- 0:00:42
902000 -- (-2464.115) [-2467.611] (-2461.454) (-2475.116) * (-2464.249) [-2462.588] (-2473.743) (-2461.976) -- 0:00:42
902500 -- (-2463.421) (-2473.148) (-2469.545) [-2466.303] * (-2467.135) (-2467.514) (-2458.523) [-2463.098] -- 0:00:42
903000 -- (-2463.009) (-2467.980) [-2470.820] (-2462.537) * (-2464.440) (-2462.606) (-2465.154) [-2466.494] -- 0:00:41
903500 -- (-2468.260) (-2472.447) (-2471.950) [-2462.915] * (-2465.078) (-2467.232) [-2459.440] (-2471.029) -- 0:00:41
904000 -- (-2468.258) [-2463.126] (-2476.029) (-2466.405) * (-2472.446) (-2471.105) [-2456.107] (-2466.972) -- 0:00:41
904500 -- (-2474.747) (-2475.372) (-2468.513) [-2460.462] * (-2463.865) (-2460.517) [-2470.538] (-2462.645) -- 0:00:41
905000 -- (-2470.551) (-2470.456) [-2460.988] (-2469.001) * [-2466.604] (-2460.898) (-2461.952) (-2464.625) -- 0:00:41
Average standard deviation of split frequencies: 0.010103
905500 -- [-2465.343] (-2464.620) (-2459.629) (-2464.478) * [-2463.202] (-2466.978) (-2459.818) (-2462.894) -- 0:00:40
906000 -- [-2460.972] (-2462.585) (-2468.903) (-2469.995) * (-2466.584) [-2457.402] (-2470.657) (-2470.389) -- 0:00:40
906500 -- [-2464.320] (-2463.219) (-2464.784) (-2465.636) * (-2468.843) [-2460.183] (-2467.756) (-2469.391) -- 0:00:40
907000 -- (-2473.806) [-2463.028] (-2469.519) (-2466.453) * (-2464.993) (-2456.447) (-2463.624) [-2472.995] -- 0:00:40
907500 -- (-2470.413) (-2465.551) (-2462.946) [-2471.804] * (-2470.317) (-2462.107) [-2464.902] (-2466.706) -- 0:00:39
908000 -- (-2475.398) (-2466.450) [-2469.334] (-2476.791) * (-2466.115) (-2466.547) [-2463.187] (-2468.834) -- 0:00:39
908500 -- (-2477.307) (-2466.918) (-2468.767) [-2465.527] * (-2476.551) (-2459.764) [-2465.150] (-2472.013) -- 0:00:39
909000 -- (-2461.811) [-2463.490] (-2471.766) (-2464.323) * (-2470.706) (-2464.619) (-2469.395) [-2466.673] -- 0:00:39
909500 -- (-2462.912) (-2472.331) [-2462.917] (-2466.958) * (-2470.383) (-2469.503) (-2467.913) [-2469.207] -- 0:00:39
910000 -- [-2469.602] (-2467.850) (-2464.995) (-2464.473) * (-2465.149) (-2472.717) [-2465.687] (-2468.061) -- 0:00:38
Average standard deviation of split frequencies: 0.009231
910500 -- [-2469.162] (-2462.298) (-2464.016) (-2464.836) * (-2473.804) (-2477.369) (-2474.973) [-2469.107] -- 0:00:38
911000 -- (-2482.626) (-2480.606) [-2467.683] (-2467.866) * (-2477.335) [-2467.145] (-2466.906) (-2470.902) -- 0:00:38
911500 -- (-2471.759) [-2465.185] (-2463.730) (-2464.271) * (-2473.870) (-2465.420) [-2465.252] (-2474.037) -- 0:00:38
912000 -- [-2460.207] (-2461.350) (-2464.627) (-2463.628) * (-2464.582) [-2461.384] (-2464.457) (-2472.384) -- 0:00:38
912500 -- (-2465.944) (-2464.115) (-2480.733) [-2462.664] * (-2464.479) (-2464.622) (-2476.255) [-2461.688] -- 0:00:37
913000 -- (-2459.332) (-2469.670) [-2471.330] (-2475.376) * (-2462.327) [-2461.952] (-2472.498) (-2471.502) -- 0:00:37
913500 -- [-2461.643] (-2468.972) (-2466.601) (-2466.000) * (-2466.793) (-2462.732) [-2469.272] (-2470.113) -- 0:00:37
914000 -- [-2456.587] (-2469.858) (-2472.179) (-2471.989) * [-2462.488] (-2466.897) (-2466.436) (-2467.517) -- 0:00:37
914500 -- [-2465.688] (-2470.939) (-2463.516) (-2467.389) * [-2462.956] (-2464.120) (-2473.380) (-2467.542) -- 0:00:36
915000 -- (-2463.686) (-2463.232) [-2466.408] (-2473.134) * (-2470.381) (-2466.876) [-2473.430] (-2471.577) -- 0:00:36
Average standard deviation of split frequencies: 0.009521
915500 -- (-2472.873) [-2458.534] (-2481.707) (-2475.374) * (-2464.730) (-2465.896) (-2463.964) [-2462.623] -- 0:00:36
916000 -- (-2475.251) (-2461.111) (-2476.253) [-2463.780] * (-2466.810) (-2461.453) (-2462.448) [-2462.858] -- 0:00:36
916500 -- (-2459.943) [-2463.947] (-2462.923) (-2465.687) * (-2473.002) [-2459.389] (-2466.198) (-2463.433) -- 0:00:36
917000 -- (-2463.316) [-2464.195] (-2466.197) (-2463.176) * (-2470.043) [-2467.187] (-2471.772) (-2468.231) -- 0:00:35
917500 -- (-2463.330) (-2470.777) (-2472.009) [-2465.854] * (-2470.931) [-2467.778] (-2470.341) (-2477.221) -- 0:00:35
918000 -- (-2463.353) (-2469.131) [-2465.155] (-2466.844) * (-2465.513) (-2473.086) [-2471.695] (-2465.152) -- 0:00:35
918500 -- (-2467.583) (-2469.737) [-2464.626] (-2473.010) * (-2467.170) [-2460.426] (-2470.007) (-2474.244) -- 0:00:35
919000 -- (-2464.880) (-2463.299) (-2465.885) [-2468.671] * (-2461.287) [-2464.569] (-2471.675) (-2462.059) -- 0:00:34
919500 -- [-2465.933] (-2458.874) (-2462.771) (-2462.962) * [-2465.931] (-2469.934) (-2479.740) (-2463.364) -- 0:00:34
920000 -- [-2465.010] (-2463.388) (-2469.356) (-2479.494) * (-2472.669) [-2459.472] (-2468.688) (-2471.386) -- 0:00:34
Average standard deviation of split frequencies: 0.008790
920500 -- (-2476.578) (-2475.167) (-2462.058) [-2458.789] * [-2465.213] (-2463.501) (-2466.097) (-2464.121) -- 0:00:34
921000 -- (-2464.970) [-2461.940] (-2466.066) (-2464.680) * (-2465.985) [-2462.628] (-2469.891) (-2468.092) -- 0:00:34
921500 -- (-2471.042) (-2473.987) (-2464.004) [-2461.010] * (-2463.153) (-2463.690) [-2465.134] (-2473.237) -- 0:00:33
922000 -- (-2474.135) (-2465.032) [-2471.523] (-2467.486) * (-2465.090) (-2462.202) [-2465.256] (-2465.166) -- 0:00:33
922500 -- [-2466.436] (-2460.367) (-2471.399) (-2471.304) * (-2465.245) (-2468.142) (-2466.836) [-2466.363] -- 0:00:33
923000 -- (-2464.924) (-2467.942) (-2469.671) [-2469.902] * (-2465.957) (-2464.427) (-2474.486) [-2466.222] -- 0:00:33
923500 -- (-2465.004) [-2470.163] (-2462.913) (-2473.775) * (-2464.690) [-2468.216] (-2472.079) (-2470.566) -- 0:00:33
924000 -- [-2468.369] (-2464.572) (-2464.739) (-2468.428) * (-2466.684) (-2470.121) [-2464.720] (-2465.993) -- 0:00:32
924500 -- [-2467.703] (-2473.830) (-2477.282) (-2473.855) * (-2472.621) [-2468.064] (-2459.553) (-2466.235) -- 0:00:32
925000 -- (-2467.083) (-2466.923) (-2464.828) [-2460.745] * (-2460.357) (-2466.171) [-2471.560] (-2468.627) -- 0:00:32
Average standard deviation of split frequencies: 0.009121
925500 -- (-2469.897) [-2466.741] (-2470.216) (-2462.567) * (-2469.807) [-2467.648] (-2480.171) (-2464.276) -- 0:00:32
926000 -- [-2463.376] (-2471.431) (-2484.775) (-2464.898) * [-2466.224] (-2476.345) (-2485.101) (-2466.069) -- 0:00:31
926500 -- (-2476.438) [-2466.005] (-2466.212) (-2467.520) * (-2470.349) (-2464.868) [-2467.522] (-2463.226) -- 0:00:31
927000 -- (-2465.644) (-2461.068) (-2468.381) [-2461.023] * [-2468.301] (-2468.412) (-2465.835) (-2471.384) -- 0:00:31
927500 -- [-2468.241] (-2465.627) (-2475.974) (-2464.309) * (-2471.089) (-2462.582) (-2467.040) [-2464.978] -- 0:00:31
928000 -- (-2474.056) [-2464.524] (-2464.099) (-2470.339) * (-2473.942) (-2471.301) [-2473.768] (-2463.850) -- 0:00:31
928500 -- (-2468.709) (-2468.815) [-2466.087] (-2463.342) * (-2472.087) (-2473.450) [-2464.474] (-2461.542) -- 0:00:30
929000 -- [-2461.181] (-2475.055) (-2460.534) (-2464.149) * (-2461.228) (-2469.618) [-2464.669] (-2469.033) -- 0:00:30
929500 -- (-2469.147) [-2469.131] (-2466.186) (-2460.670) * (-2469.721) [-2466.730] (-2462.442) (-2466.637) -- 0:00:30
930000 -- [-2462.936] (-2467.381) (-2469.193) (-2469.587) * (-2470.021) (-2465.984) (-2468.217) [-2467.888] -- 0:00:30
Average standard deviation of split frequencies: 0.008653
930500 -- (-2459.033) [-2463.206] (-2469.300) (-2471.692) * (-2466.660) (-2467.048) (-2469.824) [-2464.801] -- 0:00:30
931000 -- [-2462.780] (-2478.037) (-2466.359) (-2469.266) * (-2463.747) (-2463.073) [-2469.155] (-2479.688) -- 0:00:29
931500 -- (-2470.555) (-2469.551) [-2465.141] (-2468.446) * (-2466.947) (-2468.850) [-2461.781] (-2472.298) -- 0:00:29
932000 -- (-2463.661) (-2474.783) (-2465.421) [-2460.720] * (-2465.621) [-2462.638] (-2484.771) (-2465.536) -- 0:00:29
932500 -- [-2459.500] (-2471.963) (-2464.590) (-2466.725) * (-2461.094) (-2463.678) [-2470.804] (-2465.560) -- 0:00:29
933000 -- [-2465.029] (-2460.960) (-2473.670) (-2467.784) * [-2459.129] (-2472.224) (-2468.578) (-2467.603) -- 0:00:28
933500 -- (-2468.974) [-2463.781] (-2466.079) (-2474.748) * (-2468.048) (-2463.364) [-2458.485] (-2460.637) -- 0:00:28
934000 -- (-2468.243) [-2455.247] (-2476.417) (-2459.458) * (-2463.643) [-2466.110] (-2469.311) (-2469.886) -- 0:00:28
934500 -- (-2472.832) (-2461.443) (-2469.769) [-2463.815] * (-2460.159) (-2463.080) [-2462.709] (-2474.023) -- 0:00:28
935000 -- [-2464.336] (-2463.084) (-2464.737) (-2461.030) * [-2460.797] (-2464.535) (-2461.684) (-2472.682) -- 0:00:28
Average standard deviation of split frequencies: 0.008688
935500 -- (-2465.242) (-2464.827) [-2459.317] (-2464.456) * [-2462.900] (-2465.871) (-2472.202) (-2467.329) -- 0:00:27
936000 -- [-2467.412] (-2466.289) (-2471.504) (-2463.853) * (-2470.773) (-2464.699) [-2468.480] (-2477.408) -- 0:00:27
936500 -- (-2466.393) [-2465.986] (-2466.848) (-2473.497) * (-2469.822) (-2471.540) [-2464.891] (-2463.834) -- 0:00:27
937000 -- (-2464.291) [-2463.930] (-2477.409) (-2465.624) * (-2468.542) [-2464.483] (-2468.296) (-2461.664) -- 0:00:27
937500 -- (-2464.261) (-2474.893) (-2464.472) [-2457.330] * (-2473.899) (-2465.114) (-2469.774) [-2457.392] -- 0:00:27
938000 -- (-2461.942) (-2466.846) [-2458.517] (-2470.183) * (-2468.314) (-2473.058) [-2457.989] (-2468.647) -- 0:00:26
938500 -- (-2461.165) (-2469.760) (-2466.515) [-2459.395] * (-2465.601) [-2461.624] (-2466.455) (-2466.206) -- 0:00:26
939000 -- (-2464.493) (-2470.562) (-2470.438) [-2471.748] * (-2463.987) (-2463.338) (-2471.576) [-2464.316] -- 0:00:26
939500 -- [-2465.044] (-2466.467) (-2471.899) (-2468.082) * [-2468.758] (-2472.013) (-2467.317) (-2465.857) -- 0:00:26
940000 -- (-2463.548) (-2464.904) [-2471.700] (-2464.483) * (-2472.749) (-2474.366) (-2461.562) [-2462.853] -- 0:00:25
Average standard deviation of split frequencies: 0.008686
940500 -- (-2475.116) (-2463.501) [-2460.650] (-2469.261) * (-2472.012) (-2464.609) (-2472.627) [-2465.424] -- 0:00:25
941000 -- (-2470.899) (-2463.479) [-2464.958] (-2466.698) * (-2456.561) (-2461.396) (-2466.228) [-2459.683] -- 0:00:25
941500 -- (-2464.033) [-2457.393] (-2459.501) (-2465.085) * (-2463.520) (-2471.062) (-2465.670) [-2457.731] -- 0:00:25
942000 -- (-2465.117) [-2461.751] (-2461.984) (-2477.226) * (-2468.321) [-2475.375] (-2473.390) (-2460.391) -- 0:00:25
942500 -- [-2469.992] (-2460.832) (-2463.275) (-2468.217) * [-2461.900] (-2468.774) (-2471.066) (-2461.870) -- 0:00:24
943000 -- [-2464.473] (-2463.392) (-2466.684) (-2462.824) * (-2465.123) (-2469.719) [-2465.523] (-2464.619) -- 0:00:24
943500 -- (-2466.276) [-2465.949] (-2474.319) (-2464.594) * (-2471.678) (-2465.661) (-2466.204) [-2455.347] -- 0:00:24
944000 -- (-2462.521) [-2457.973] (-2464.541) (-2466.177) * (-2465.552) (-2463.564) (-2465.191) [-2459.147] -- 0:00:24
944500 -- [-2470.625] (-2466.486) (-2462.918) (-2472.082) * (-2464.163) (-2473.561) (-2461.966) [-2467.843] -- 0:00:23
945000 -- (-2465.623) (-2461.352) [-2461.141] (-2468.938) * [-2467.675] (-2463.486) (-2465.041) (-2468.600) -- 0:00:23
Average standard deviation of split frequencies: 0.008970
945500 -- (-2467.324) (-2467.482) (-2467.337) [-2464.796] * (-2466.888) [-2463.950] (-2467.300) (-2478.657) -- 0:00:23
946000 -- (-2469.737) (-2467.514) [-2461.339] (-2468.400) * (-2468.312) (-2466.953) [-2468.625] (-2477.807) -- 0:00:23
946500 -- (-2470.967) [-2463.650] (-2459.525) (-2471.353) * [-2469.698] (-2470.179) (-2473.246) (-2470.135) -- 0:00:23
947000 -- [-2465.772] (-2466.607) (-2465.394) (-2463.261) * (-2476.497) (-2466.265) (-2468.741) [-2461.308] -- 0:00:22
947500 -- (-2469.922) [-2465.149] (-2462.331) (-2468.689) * (-2464.384) (-2466.444) (-2470.815) [-2466.768] -- 0:00:22
948000 -- (-2466.421) (-2473.881) (-2463.424) [-2465.231] * (-2463.902) [-2466.472] (-2464.883) (-2463.165) -- 0:00:22
948500 -- (-2464.518) (-2469.939) (-2465.877) [-2459.443] * (-2474.352) (-2463.641) [-2463.905] (-2473.976) -- 0:00:22
949000 -- (-2464.503) [-2464.792] (-2470.722) (-2460.047) * (-2477.672) [-2462.937] (-2458.344) (-2460.990) -- 0:00:22
949500 -- [-2466.437] (-2475.327) (-2471.386) (-2467.528) * (-2472.115) [-2466.222] (-2466.635) (-2467.372) -- 0:00:21
950000 -- (-2462.862) (-2472.094) [-2470.131] (-2477.810) * (-2465.070) (-2468.794) (-2462.112) [-2462.962] -- 0:00:21
Average standard deviation of split frequencies: 0.009215
950500 -- (-2469.230) [-2466.132] (-2462.735) (-2478.261) * (-2466.838) [-2463.580] (-2469.651) (-2463.627) -- 0:00:21
951000 -- (-2472.710) (-2468.845) [-2468.502] (-2469.933) * [-2467.220] (-2464.980) (-2468.405) (-2462.138) -- 0:00:21
951500 -- [-2467.137] (-2469.010) (-2466.954) (-2471.702) * (-2484.554) [-2462.614] (-2463.506) (-2459.576) -- 0:00:20
952000 -- (-2464.715) [-2467.088] (-2467.350) (-2469.842) * [-2467.468] (-2473.513) (-2467.683) (-2464.104) -- 0:00:20
952500 -- (-2466.861) (-2466.613) (-2468.694) [-2474.831] * [-2468.327] (-2460.849) (-2461.934) (-2476.119) -- 0:00:20
953000 -- (-2463.814) (-2467.257) [-2466.711] (-2464.798) * (-2467.408) (-2468.576) [-2469.119] (-2471.405) -- 0:00:20
953500 -- (-2465.931) (-2461.813) [-2463.763] (-2473.394) * (-2466.475) [-2468.517] (-2470.913) (-2459.790) -- 0:00:20
954000 -- [-2460.237] (-2465.299) (-2461.175) (-2465.155) * [-2467.494] (-2466.638) (-2469.656) (-2461.342) -- 0:00:19
954500 -- (-2463.508) (-2466.450) (-2461.321) [-2461.667] * (-2462.370) [-2469.036] (-2474.179) (-2466.428) -- 0:00:19
955000 -- (-2468.552) (-2469.073) [-2470.160] (-2468.014) * (-2466.951) (-2465.723) (-2478.888) [-2466.827] -- 0:00:19
Average standard deviation of split frequencies: 0.009328
955500 -- (-2465.010) (-2466.430) [-2461.251] (-2472.795) * (-2472.066) (-2473.362) [-2460.064] (-2476.976) -- 0:00:19
956000 -- (-2468.187) (-2464.744) (-2465.347) [-2460.318] * (-2468.159) [-2466.396] (-2466.665) (-2466.484) -- 0:00:19
956500 -- (-2467.184) (-2466.093) [-2457.615] (-2468.388) * (-2468.117) (-2465.458) [-2462.287] (-2470.677) -- 0:00:18
957000 -- (-2461.692) [-2463.706] (-2466.385) (-2462.481) * (-2467.495) (-2468.772) [-2464.057] (-2471.141) -- 0:00:18
957500 -- [-2466.651] (-2468.108) (-2466.598) (-2469.821) * [-2457.629] (-2477.645) (-2463.869) (-2459.113) -- 0:00:18
958000 -- (-2463.522) (-2462.952) [-2458.383] (-2472.531) * (-2466.168) (-2467.183) [-2460.252] (-2465.649) -- 0:00:18
958500 -- (-2471.830) (-2465.216) [-2458.251] (-2462.412) * [-2460.306] (-2472.663) (-2464.847) (-2469.818) -- 0:00:17
959000 -- (-2469.557) (-2463.718) [-2464.299] (-2468.263) * [-2462.565] (-2474.325) (-2471.105) (-2462.674) -- 0:00:17
959500 -- [-2460.961] (-2469.744) (-2479.180) (-2473.378) * (-2468.130) (-2469.078) [-2459.762] (-2470.673) -- 0:00:17
960000 -- (-2464.277) (-2471.198) [-2467.205] (-2464.076) * (-2467.145) (-2463.091) (-2465.620) [-2468.230] -- 0:00:17
Average standard deviation of split frequencies: 0.009242
960500 -- (-2465.382) (-2469.650) [-2461.561] (-2472.652) * [-2464.675] (-2475.850) (-2467.261) (-2458.506) -- 0:00:17
961000 -- (-2462.439) (-2473.293) [-2461.915] (-2472.207) * (-2470.420) (-2472.628) (-2472.381) [-2465.984] -- 0:00:16
961500 -- (-2467.634) (-2467.618) [-2459.035] (-2462.806) * (-2467.906) [-2464.795] (-2469.996) (-2467.415) -- 0:00:16
962000 -- (-2469.959) [-2460.700] (-2463.161) (-2465.256) * (-2472.257) [-2464.321] (-2458.420) (-2472.903) -- 0:00:16
962500 -- (-2471.199) [-2461.357] (-2462.620) (-2467.146) * (-2471.926) (-2463.409) [-2463.969] (-2463.992) -- 0:00:16
963000 -- (-2463.942) [-2473.114] (-2460.396) (-2466.186) * (-2475.487) (-2463.949) [-2473.808] (-2460.064) -- 0:00:15
963500 -- (-2463.355) (-2466.039) (-2467.127) [-2465.511] * (-2463.305) [-2460.580] (-2470.719) (-2463.998) -- 0:00:15
964000 -- (-2459.363) (-2467.518) (-2470.787) [-2459.944] * (-2468.576) [-2460.935] (-2467.944) (-2464.114) -- 0:00:15
964500 -- (-2459.802) [-2466.281] (-2476.203) (-2466.878) * (-2478.776) (-2464.390) (-2472.260) [-2467.773] -- 0:00:15
965000 -- [-2473.926] (-2461.885) (-2463.506) (-2468.550) * (-2462.996) (-2469.061) [-2456.644] (-2462.325) -- 0:00:15
Average standard deviation of split frequencies: 0.009353
965500 -- (-2476.483) [-2460.525] (-2469.842) (-2459.463) * (-2469.469) [-2463.403] (-2465.101) (-2463.789) -- 0:00:14
966000 -- (-2472.082) (-2465.108) (-2467.320) [-2465.670] * [-2460.593] (-2461.722) (-2464.254) (-2471.134) -- 0:00:14
966500 -- (-2470.468) [-2467.819] (-2468.974) (-2464.564) * (-2470.500) (-2457.125) [-2466.086] (-2473.957) -- 0:00:14
967000 -- (-2474.236) (-2463.765) [-2465.806] (-2468.711) * (-2465.527) (-2464.663) (-2467.629) [-2465.392] -- 0:00:14
967500 -- (-2471.579) (-2468.003) (-2475.146) [-2466.842] * (-2466.700) (-2464.163) [-2464.789] (-2463.310) -- 0:00:14
968000 -- (-2461.206) [-2463.808] (-2468.450) (-2462.411) * [-2463.430] (-2468.617) (-2460.425) (-2461.439) -- 0:00:13
968500 -- [-2459.127] (-2467.399) (-2466.326) (-2463.014) * (-2465.156) (-2463.812) [-2459.705] (-2468.278) -- 0:00:13
969000 -- [-2463.732] (-2472.888) (-2460.977) (-2465.584) * (-2458.636) (-2469.204) (-2469.320) [-2462.902] -- 0:00:13
969500 -- (-2468.742) (-2469.476) [-2470.740] (-2463.279) * (-2463.262) (-2476.018) (-2469.748) [-2468.435] -- 0:00:13
970000 -- (-2465.053) (-2462.990) (-2461.373) [-2459.219] * [-2469.217] (-2475.575) (-2476.506) (-2465.257) -- 0:00:12
Average standard deviation of split frequencies: 0.009592
970500 -- (-2464.656) (-2462.736) (-2466.251) [-2466.747] * [-2468.365] (-2478.719) (-2464.398) (-2476.660) -- 0:00:12
971000 -- (-2477.375) [-2460.413] (-2460.468) (-2458.739) * (-2460.495) (-2469.482) [-2464.044] (-2469.072) -- 0:00:12
971500 -- (-2479.002) [-2464.151] (-2467.249) (-2467.154) * [-2464.238] (-2459.229) (-2471.698) (-2474.857) -- 0:00:12
972000 -- [-2470.763] (-2468.844) (-2463.653) (-2467.636) * [-2462.185] (-2471.342) (-2472.338) (-2468.985) -- 0:00:12
972500 -- [-2470.474] (-2462.356) (-2469.588) (-2463.238) * [-2463.801] (-2474.434) (-2464.550) (-2474.989) -- 0:00:11
973000 -- [-2464.656] (-2475.709) (-2468.687) (-2462.827) * (-2463.582) (-2482.267) (-2472.033) [-2469.726] -- 0:00:11
973500 -- (-2464.938) (-2463.346) (-2459.185) [-2463.002] * [-2464.943] (-2478.776) (-2465.865) (-2470.007) -- 0:00:11
974000 -- (-2471.485) [-2463.990] (-2457.263) (-2464.028) * (-2470.541) (-2474.587) [-2465.726] (-2463.619) -- 0:00:11
974500 -- [-2466.430] (-2460.841) (-2464.413) (-2467.713) * (-2463.658) (-2466.883) [-2461.672] (-2464.681) -- 0:00:11
975000 -- (-2465.931) (-2465.683) [-2461.665] (-2467.418) * (-2471.732) (-2480.540) [-2463.112] (-2470.789) -- 0:00:10
Average standard deviation of split frequencies: 0.009700
975500 -- (-2470.207) [-2465.822] (-2463.328) (-2459.528) * (-2465.727) (-2469.783) [-2463.099] (-2478.071) -- 0:00:10
976000 -- (-2464.209) [-2462.227] (-2467.881) (-2470.069) * [-2461.258] (-2469.188) (-2464.591) (-2467.638) -- 0:00:10
976500 -- [-2466.585] (-2466.513) (-2463.806) (-2466.783) * (-2462.305) (-2464.280) [-2461.651] (-2464.046) -- 0:00:10
977000 -- (-2461.781) [-2466.491] (-2471.069) (-2480.364) * (-2460.912) (-2466.174) (-2469.442) [-2461.633] -- 0:00:09
977500 -- (-2467.256) [-2465.973] (-2471.665) (-2473.246) * (-2468.673) [-2468.514] (-2461.935) (-2461.750) -- 0:00:09
978000 -- (-2463.552) (-2460.970) (-2470.243) [-2466.331] * (-2469.080) [-2468.169] (-2465.568) (-2464.856) -- 0:00:09
978500 -- (-2465.043) (-2478.869) (-2459.399) [-2460.285] * (-2463.670) (-2473.095) [-2466.938] (-2473.972) -- 0:00:09
979000 -- [-2462.442] (-2465.116) (-2470.356) (-2461.104) * (-2465.793) [-2470.778] (-2469.014) (-2460.725) -- 0:00:09
979500 -- (-2473.196) (-2462.194) (-2465.337) [-2474.343] * (-2474.156) (-2468.004) [-2467.692] (-2471.296) -- 0:00:08
980000 -- (-2463.271) (-2472.247) (-2464.462) [-2467.220] * (-2471.388) (-2481.000) (-2461.816) [-2464.803] -- 0:00:08
Average standard deviation of split frequencies: 0.009694
980500 -- [-2464.632] (-2471.751) (-2469.524) (-2475.724) * (-2466.592) [-2462.928] (-2468.229) (-2467.485) -- 0:00:08
981000 -- (-2466.494) [-2461.196] (-2470.038) (-2463.793) * (-2463.756) [-2467.499] (-2470.965) (-2463.753) -- 0:00:08
981500 -- (-2459.351) (-2462.980) [-2460.980] (-2471.332) * [-2464.388] (-2468.954) (-2469.431) (-2472.916) -- 0:00:07
982000 -- (-2463.478) [-2473.496] (-2461.308) (-2462.176) * (-2478.429) (-2462.063) [-2461.580] (-2462.277) -- 0:00:07
982500 -- (-2460.794) (-2466.307) [-2462.571] (-2459.443) * (-2461.428) (-2470.849) (-2468.109) [-2465.607] -- 0:00:07
983000 -- (-2469.822) (-2465.334) [-2465.451] (-2463.789) * (-2463.634) [-2469.666] (-2472.206) (-2467.560) -- 0:00:07
983500 -- [-2466.489] (-2463.262) (-2461.908) (-2467.971) * [-2464.731] (-2475.802) (-2465.272) (-2469.850) -- 0:00:07
984000 -- (-2470.559) (-2471.353) (-2468.161) [-2464.030] * (-2456.694) [-2466.407] (-2467.502) (-2481.441) -- 0:00:06
984500 -- (-2471.216) (-2478.813) [-2468.737] (-2474.023) * (-2463.368) [-2466.707] (-2469.320) (-2463.050) -- 0:00:06
985000 -- (-2467.741) (-2468.141) (-2462.456) [-2466.741] * [-2458.709] (-2470.207) (-2472.849) (-2472.677) -- 0:00:06
Average standard deviation of split frequencies: 0.009602
985500 -- (-2468.646) [-2460.966] (-2461.576) (-2460.437) * (-2459.239) (-2469.018) [-2464.883] (-2470.303) -- 0:00:06
986000 -- (-2468.396) (-2471.740) (-2472.687) [-2459.156] * (-2461.101) (-2467.929) (-2470.094) [-2466.711] -- 0:00:06
986500 -- [-2479.385] (-2465.454) (-2464.187) (-2468.110) * (-2468.099) (-2465.859) [-2460.777] (-2473.539) -- 0:00:05
987000 -- [-2466.388] (-2467.150) (-2468.903) (-2459.192) * (-2467.584) (-2467.096) [-2463.772] (-2466.975) -- 0:00:05
987500 -- (-2465.401) [-2458.980] (-2471.307) (-2458.509) * (-2468.057) [-2465.007] (-2464.365) (-2476.180) -- 0:00:05
988000 -- (-2469.343) (-2461.488) [-2466.893] (-2460.584) * (-2469.490) [-2462.356] (-2460.363) (-2469.853) -- 0:00:05
988500 -- (-2464.949) [-2459.130] (-2470.570) (-2473.389) * (-2465.824) [-2461.375] (-2459.360) (-2472.591) -- 0:00:04
989000 -- [-2459.911] (-2463.377) (-2474.665) (-2472.480) * [-2456.008] (-2479.169) (-2466.771) (-2475.417) -- 0:00:04
989500 -- (-2470.553) [-2468.221] (-2474.659) (-2465.157) * (-2462.738) (-2465.458) (-2460.654) [-2462.708] -- 0:00:04
990000 -- (-2478.893) [-2466.910] (-2468.988) (-2463.351) * (-2471.655) [-2464.350] (-2459.993) (-2469.999) -- 0:00:04
Average standard deviation of split frequencies: 0.010032
990500 -- (-2479.301) (-2472.361) (-2465.404) [-2460.458] * (-2469.394) (-2472.306) (-2466.764) [-2467.480] -- 0:00:04
991000 -- (-2466.631) [-2465.107] (-2466.649) (-2466.898) * (-2468.116) (-2467.476) (-2476.283) [-2464.438] -- 0:00:03
991500 -- (-2467.784) [-2464.576] (-2463.061) (-2473.204) * (-2472.670) (-2460.020) [-2465.347] (-2460.600) -- 0:00:03
992000 -- (-2470.779) [-2458.479] (-2462.983) (-2468.627) * (-2468.877) (-2466.034) [-2460.506] (-2465.350) -- 0:00:03
992500 -- (-2473.741) (-2463.090) (-2462.076) [-2464.632] * (-2467.702) (-2464.415) (-2466.109) [-2458.847] -- 0:00:03
993000 -- (-2467.526) (-2465.619) (-2472.227) [-2466.491] * (-2465.582) (-2469.166) (-2466.938) [-2461.675] -- 0:00:03
993500 -- (-2471.212) (-2463.161) (-2461.159) [-2460.956] * (-2475.909) (-2465.218) (-2464.494) [-2464.963] -- 0:00:02
994000 -- (-2469.571) (-2471.328) (-2466.180) [-2469.427] * (-2469.881) (-2467.787) [-2466.847] (-2463.893) -- 0:00:02
994500 -- [-2466.530] (-2473.514) (-2469.266) (-2463.225) * [-2461.231] (-2464.887) (-2474.261) (-2473.824) -- 0:00:02
995000 -- (-2469.331) (-2464.435) (-2468.185) [-2461.594] * (-2468.708) (-2463.967) (-2473.224) [-2463.877] -- 0:00:02
Average standard deviation of split frequencies: 0.010215
995500 -- (-2463.624) [-2458.441] (-2468.260) (-2467.780) * [-2461.043] (-2467.244) (-2469.096) (-2470.956) -- 0:00:01
996000 -- (-2463.082) (-2465.880) (-2465.642) [-2460.365] * (-2465.744) (-2462.743) (-2462.421) [-2465.125] -- 0:00:01
996500 -- (-2475.454) [-2466.098] (-2457.044) (-2469.944) * (-2465.046) (-2466.464) [-2458.835] (-2460.469) -- 0:00:01
997000 -- [-2462.952] (-2469.092) (-2458.787) (-2471.117) * [-2460.173] (-2471.450) (-2475.734) (-2463.932) -- 0:00:01
997500 -- (-2467.111) [-2461.974] (-2477.411) (-2470.821) * (-2462.021) (-2468.861) (-2472.657) [-2458.164] -- 0:00:01
998000 -- (-2474.830) (-2472.485) [-2467.462] (-2467.447) * [-2463.367] (-2470.054) (-2466.177) (-2460.625) -- 0:00:00
998500 -- (-2464.833) (-2464.544) (-2460.789) [-2460.905] * [-2466.854] (-2471.596) (-2462.807) (-2472.905) -- 0:00:00
999000 -- (-2473.709) [-2460.309] (-2461.241) (-2459.458) * (-2467.973) [-2461.742] (-2469.850) (-2470.069) -- 0:00:00
999500 -- (-2473.359) [-2465.247] (-2468.455) (-2463.249) * [-2471.787] (-2469.842) (-2468.354) (-2473.569) -- 0:00:00
1000000 -- (-2470.979) (-2464.870) [-2463.422] (-2469.875) * (-2480.179) (-2470.237) [-2459.491] (-2468.565) -- 0:00:00
Average standard deviation of split frequencies: 0.010874
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -2470.979185 -- 19.860667
Chain 1 -- -2470.979185 -- 19.860667
Chain 2 -- -2464.869798 -- 17.467231
Chain 2 -- -2464.869793 -- 17.467231
Chain 3 -- -2463.421960 -- 20.769209
Chain 3 -- -2463.421955 -- 20.769209
Chain 4 -- -2469.875180 -- 18.135519
Chain 4 -- -2469.875198 -- 18.135519
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -2480.178644 -- 18.299449
Chain 1 -- -2480.178647 -- 18.299449
Chain 2 -- -2470.237217 -- 19.458404
Chain 2 -- -2470.237217 -- 19.458404
Chain 3 -- -2459.490771 -- 14.201906
Chain 3 -- -2459.490758 -- 14.201906
Chain 4 -- -2468.565296 -- 19.298274
Chain 4 -- -2468.565280 -- 19.298274
Analysis completed in 7 mins 12 seconds
Analysis used 431.87 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -2452.69
Likelihood of best state for "cold" chain of run 2 was -2452.97
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
40.5 % ( 27 %) Dirichlet(Revmat{all})
57.1 % ( 36 %) Slider(Revmat{all})
26.5 % ( 32 %) Dirichlet(Pi{all})
28.1 % ( 38 %) Slider(Pi{all})
29.9 % ( 26 %) Multiplier(Alpha{1,2})
41.4 % ( 27 %) Multiplier(Alpha{3})
52.8 % ( 22 %) Slider(Pinvar{all})
15.0 % ( 12 %) ExtSPR(Tau{all},V{all})
4.9 % ( 2 %) ExtTBR(Tau{all},V{all})
19.1 % ( 16 %) NNI(Tau{all},V{all})
23.5 % ( 22 %) ParsSPR(Tau{all},V{all})
26.2 % ( 27 %) Multiplier(V{all})
33.9 % ( 32 %) Nodeslider(V{all})
25.1 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
40.4 % ( 32 %) Dirichlet(Revmat{all})
56.2 % ( 40 %) Slider(Revmat{all})
26.2 % ( 30 %) Dirichlet(Pi{all})
27.9 % ( 30 %) Slider(Pi{all})
29.8 % ( 26 %) Multiplier(Alpha{1,2})
41.5 % ( 27 %) Multiplier(Alpha{3})
52.8 % ( 28 %) Slider(Pinvar{all})
15.2 % ( 15 %) ExtSPR(Tau{all},V{all})
4.9 % ( 9 %) ExtTBR(Tau{all},V{all})
19.1 % ( 24 %) NNI(Tau{all},V{all})
23.7 % ( 22 %) ParsSPR(Tau{all},V{all})
26.1 % ( 31 %) Multiplier(V{all})
33.5 % ( 32 %) Nodeslider(V{all})
25.3 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.78 0.59 0.43
2 | 167086 0.80 0.62
3 | 166463 167281 0.81
4 | 166038 166254 166878
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.77 0.58 0.43
2 | 166384 0.79 0.61
3 | 167056 166867 0.80
4 | 166410 166866 166417
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -2462.54
| 1 2 1 2|
| 11 1 2 |
| 1 1 2 2 1 1 1|
| 2 2 1 1 1 2 2 11 |
|2 * 1 1 1 1 2 *1 2 2 1 21 |
| 222 *2 1 1 2 1 *21 1 1 |
| 1*2 2 1 * 2 1 2 22 |
| 1 12 2 2 22 * 1 22 1 1 12 2 * 2 |
| 2 1 1 2 22 11 2 1 22 1 1 |
| 1 2 1 2 1 |
|12 1 2 1 2 1 |
| 1 2 |
| 2 |
| 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2467.32
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2459.47 -2472.90
2 -2459.62 -2478.33
--------------------------------------
TOTAL -2459.54 -2477.64
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.963388 0.009720 0.787559 1.161425 0.958353 1347.98 1414.00 1.000
r(A<->C){all} 0.115419 0.000552 0.072784 0.162498 0.113530 984.13 998.77 1.000
r(A<->G){all} 0.256849 0.001367 0.183967 0.327682 0.256045 744.41 783.71 1.000
r(A<->T){all} 0.103790 0.001050 0.044508 0.168039 0.102144 693.30 739.19 1.000
r(C<->G){all} 0.053756 0.000169 0.029781 0.080154 0.052941 1060.13 1133.34 1.000
r(C<->T){all} 0.351131 0.001884 0.264480 0.431829 0.350429 550.13 681.33 1.000
r(G<->T){all} 0.119055 0.000603 0.071022 0.164801 0.118510 891.44 984.00 1.000
pi(A){all} 0.233629 0.000246 0.201508 0.263316 0.232983 898.07 1022.71 1.000
pi(C){all} 0.287858 0.000295 0.255101 0.320856 0.287342 1088.96 1182.47 1.000
pi(G){all} 0.295100 0.000265 0.265512 0.327326 0.295080 1191.07 1226.48 1.000
pi(T){all} 0.183414 0.000208 0.155771 0.210337 0.183008 1072.52 1092.26 1.000
alpha{1,2} 0.165480 0.000828 0.111057 0.220057 0.162381 1305.87 1332.15 1.000
alpha{3} 2.392486 0.609610 1.117551 3.998864 2.277428 1393.41 1401.77 1.000
pinvar{all} 0.255745 0.005058 0.110622 0.379742 0.261562 1176.26 1289.74 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
Key to taxon bipartitions (saved to file "/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------------
1 -- .*********
2 -- .*........
3 -- ..*.......
4 -- ...*......
5 -- ....*.....
6 -- .....*....
7 -- ......*...
8 -- .......*..
9 -- ........*.
10 -- .........*
11 -- .....*****
12 -- ...*******
13 -- .**.......
14 -- ........**
15 -- ...**.....
16 -- .....*.***
17 -- .......***
18 -- ...*.*****
19 -- .....*.*..
20 -- .....**...
21 -- ......****
22 -- ......*.**
----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
11 3002 1.000000 0.000000 1.000000 1.000000 2
12 3002 1.000000 0.000000 1.000000 1.000000 2
13 2996 0.998001 0.000942 0.997335 0.998668 2
14 2846 0.948035 0.007537 0.942705 0.953364 2
15 1914 0.637575 0.013191 0.628248 0.646902 2
16 1785 0.594604 0.028737 0.574284 0.614923 2
17 1670 0.556296 0.004711 0.552965 0.559627 2
18 954 0.317788 0.012248 0.309127 0.326449 2
19 634 0.211193 0.016959 0.199201 0.223185 2
20 506 0.168554 0.006595 0.163891 0.173218 2
21 462 0.153897 0.022612 0.137908 0.169887 2
22 346 0.115256 0.016959 0.103264 0.127249 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.058501 0.000263 0.029021 0.092057 0.056935 1.000 2
length{all}[2] 0.027262 0.000088 0.010678 0.045935 0.026492 1.000 2
length{all}[3] 0.037337 0.000117 0.017713 0.058376 0.036411 1.000 2
length{all}[4] 0.022017 0.000101 0.004134 0.041535 0.020763 1.000 2
length{all}[5] 0.071431 0.000299 0.039941 0.105760 0.069565 1.000 2
length{all}[6] 0.174145 0.001108 0.111790 0.238747 0.171818 1.001 2
length{all}[7] 0.124091 0.000658 0.077210 0.175761 0.121787 1.001 2
length{all}[8] 0.092487 0.000414 0.055668 0.133532 0.090446 1.000 2
length{all}[9] 0.056477 0.000215 0.031069 0.086366 0.055288 1.001 2
length{all}[10] 0.049306 0.000184 0.023178 0.074883 0.048014 1.000 2
length{all}[11] 0.065829 0.000360 0.030286 0.102591 0.063801 1.000 2
length{all}[12] 0.095561 0.000528 0.054319 0.140797 0.093787 1.000 2
length{all}[13] 0.032070 0.000161 0.009755 0.058101 0.030798 1.000 2
length{all}[14] 0.017594 0.000095 0.000309 0.035738 0.016231 1.000 2
length{all}[15] 0.015328 0.000100 0.000006 0.033252 0.013658 0.999 2
length{all}[16] 0.015522 0.000082 0.000065 0.032332 0.013951 1.000 2
length{all}[17] 0.013489 0.000089 0.000099 0.031393 0.011699 1.000 2
length{all}[18] 0.012432 0.000079 0.000055 0.028558 0.010835 1.000 2
length{all}[19] 0.009807 0.000066 0.000006 0.026017 0.007814 1.002 2
length{all}[20] 0.012937 0.000098 0.000002 0.030886 0.011142 1.000 2
length{all}[21] 0.012119 0.000076 0.000003 0.029734 0.010773 0.998 2
length{all}[22] 0.012009 0.000069 0.000152 0.027120 0.010448 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.010874
Maximum standard deviation of split frequencies = 0.028737
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
| /------------ C4 (4)
| /----------------------64---------------------+
| | \------------ C5 (5)
| |
| | /----------------------------------- C6 (6)
|----100----+ |
| | /-----59----+ /----------------------- C8 (8)
+ | | | |
| | | \-----56----+ /------------ C9 (9)
| \----100---+ \----95----+
| | \------------ C10 (10)
| |
| \----------------------------------------------- C7 (7)
|
| /------------ C2 (2)
\---------------------------100---------------------------+
\------------ C3 (3)
Phylogram (based on average branch lengths):
/------------ C1 (1)
|
| /---- C4 (4)
| /--+
| | \-------------- C5 (5)
| |
| | /------------------------------------ C6 (6)
|-------------------+ |
| | /--+ /------------------- C8 (8)
+ | | | |
| | | \-+ /----------- C9 (9)
| \------------+ \---+
| | \---------- C10 (10)
| |
| \-------------------------- C7 (7)
|
| /------ C2 (2)
\-----+
\-------- C3 (3)
|---------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (97 trees sampled):
50 % credible set contains 5 trees
90 % credible set contains 21 trees
95 % credible set contains 33 trees
99 % credible set contains 67 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 10 ls = 669
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Sequences read..
Counting site patterns.. 0:00
179 patterns at 223 / 223 sites (100.0%), 0:00
Counting codons..
360 bytes for distance
174704 bytes for conP
24344 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, ((4, 5), ((6, (8, (9, 10))), 7)), (2, 3)); MP score: 287
698816 bytes for conP, adjusted
0.078553 0.096682 0.038439 0.040803 0.115907 0.092885 0.000000 0.239830 0.022470 0.128143 0.045352 0.099387 0.062937 0.202041 0.043120 0.047454 0.070707 0.300000 1.300000
ntime & nrate & np: 17 2 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 19
lnL0 = -2806.975934
Iterating by ming2
Initial: fx= 2806.975934
x= 0.07855 0.09668 0.03844 0.04080 0.11591 0.09288 0.00000 0.23983 0.02247 0.12814 0.04535 0.09939 0.06294 0.20204 0.04312 0.04745 0.07071 0.30000 1.30000
1 h-m-p 0.0000 0.0010 3228.4818 YYCYCCC 2800.319526 6 0.0000 33 | 0/19
2 h-m-p 0.0001 0.0009 457.9260 ++YYYCCC 2704.712895 5 0.0009 64 | 0/19
3 h-m-p 0.0000 0.0001 4287.4793 ++ 2653.819940 m 0.0001 86 | 0/19
4 h-m-p 0.0000 0.0002 8939.5740 ++ 2603.383245 m 0.0002 108 | 0/19
5 h-m-p 0.0001 0.0003 2256.2850 +YYYYCYCYCC 2464.080481 10 0.0002 145 | 0/19
6 h-m-p 0.0001 0.0004 240.9046 YCCCCC 2461.748169 5 0.0001 176 | 0/19
7 h-m-p 0.0000 0.0004 598.8331 ++ 2436.160193 m 0.0004 198 | 0/19
8 h-m-p 0.0000 0.0000 3222.9015 YCCC 2433.917105 3 0.0000 225 | 0/19
9 h-m-p 0.0001 0.0004 440.8208 +YCYCCC 2420.500788 5 0.0003 256 | 0/19
10 h-m-p 0.0002 0.0012 279.3012 YCYCCC 2410.531923 5 0.0006 286 | 0/19
11 h-m-p 0.0010 0.0051 39.4701 YYC 2409.956060 2 0.0008 310 | 0/19
12 h-m-p 0.0010 0.0050 23.7356 YC 2409.844188 1 0.0005 333 | 0/19
13 h-m-p 0.0009 0.0162 13.3922 CCC 2409.789963 2 0.0007 359 | 0/19
14 h-m-p 0.0011 0.0157 8.7693 YC 2409.769960 1 0.0006 382 | 0/19
15 h-m-p 0.0022 0.1554 2.2466 YC 2409.713714 1 0.0044 405 | 0/19
16 h-m-p 0.0014 0.0746 6.8839 +CCC 2409.213256 2 0.0067 432 | 0/19
17 h-m-p 0.0027 0.0433 16.7390 +YYC 2406.320792 2 0.0089 457 | 0/19
18 h-m-p 0.0029 0.0144 33.3632 YCCCC 2400.586853 4 0.0072 486 | 0/19
19 h-m-p 0.0013 0.0066 48.2315 YYCCC 2399.543682 4 0.0013 514 | 0/19
20 h-m-p 0.0046 0.0231 7.9867 CC 2399.487900 1 0.0013 538 | 0/19
21 h-m-p 0.0113 0.8345 0.9035 +++YCCCC 2377.992529 4 0.7737 570 | 0/19
22 h-m-p 0.1514 0.7571 1.6100 +YYYYC 2351.723313 4 0.5948 616 | 0/19
23 h-m-p 0.9729 4.8644 0.0890 YCCCC 2339.588252 4 1.9320 645 | 0/19
24 h-m-p 0.2566 1.2831 0.3430 +YYCCC 2332.646675 4 0.8030 693 | 0/19
25 h-m-p 0.3050 1.5251 0.2605 CCCC 2330.784455 3 0.3959 740 | 0/19
26 h-m-p 0.6217 3.1083 0.0591 CCCCC 2328.766517 4 0.8748 789 | 0/19
27 h-m-p 0.8526 4.5882 0.0606 YYC 2328.189221 2 0.6839 832 | 0/19
28 h-m-p 1.1574 8.0000 0.0358 +YC 2326.807434 1 3.1991 875 | 0/19
29 h-m-p 0.9267 8.0000 0.1237 +YC 2324.851249 1 2.3242 918 | 0/19
30 h-m-p 1.6000 8.0000 0.0953 YCCC 2324.495276 3 0.8041 964 | 0/19
31 h-m-p 1.6000 8.0000 0.0355 YCC 2324.387623 2 1.0468 1008 | 0/19
32 h-m-p 1.6000 8.0000 0.0126 CC 2324.341946 1 1.7946 1051 | 0/19
33 h-m-p 1.6000 8.0000 0.0046 YC 2324.318951 1 1.1504 1093 | 0/19
34 h-m-p 0.4185 8.0000 0.0125 YC 2324.311219 1 0.8029 1135 | 0/19
35 h-m-p 1.5592 8.0000 0.0065 C 2324.306679 0 1.5194 1176 | 0/19
36 h-m-p 1.6000 8.0000 0.0008 CC 2324.303445 1 2.5426 1219 | 0/19
37 h-m-p 1.6000 8.0000 0.0010 CC 2324.301765 1 2.0462 1262 | 0/19
38 h-m-p 1.6000 8.0000 0.0012 CC 2324.300902 1 2.1217 1305 | 0/19
39 h-m-p 1.6000 8.0000 0.0003 +C 2324.299321 0 5.8306 1347 | 0/19
40 h-m-p 1.3426 8.0000 0.0013 CC 2324.298410 1 1.6159 1390 | 0/19
41 h-m-p 1.6000 8.0000 0.0006 C 2324.298311 0 1.3969 1431 | 0/19
42 h-m-p 1.6000 8.0000 0.0002 Y 2324.298257 0 3.6092 1472 | 0/19
43 h-m-p 1.6000 8.0000 0.0002 +Y 2324.298162 0 5.1795 1514 | 0/19
44 h-m-p 1.6000 8.0000 0.0004 Y 2324.298070 0 3.0939 1555 | 0/19
45 h-m-p 1.6000 8.0000 0.0001 C 2324.298065 0 1.3345 1596 | 0/19
46 h-m-p 1.6000 8.0000 0.0000 Y 2324.298065 0 1.1479 1637 | 0/19
47 h-m-p 1.6000 8.0000 0.0000 C 2324.298065 0 1.2817 1678 | 0/19
48 h-m-p 1.6000 8.0000 0.0000 Y 2324.298065 0 1.6000 1719 | 0/19
49 h-m-p 1.6000 8.0000 0.0000 Y 2324.298065 0 1.6000 1760 | 0/19
50 h-m-p 1.6000 8.0000 0.0000 ---------------N 2324.298065 0 0.0000 1816
Out..
lnL = -2324.298065
1817 lfun, 1817 eigenQcodon, 30889 P(t)
Time used: 0:13
Model 1: NearlyNeutral
TREE # 1
(1, ((4, 5), ((6, (8, (9, 10))), 7)), (2, 3)); MP score: 287
0.078466 0.102184 0.033609 0.060779 0.100836 0.071001 0.000000 0.206313 0.031995 0.125486 0.042190 0.112640 0.055451 0.183164 0.040331 0.052409 0.053891 2.029581 0.718247 0.265678
ntime & nrate & np: 17 2 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 7.744403
np = 20
lnL0 = -2451.456794
Iterating by ming2
Initial: fx= 2451.456794
x= 0.07847 0.10218 0.03361 0.06078 0.10084 0.07100 0.00000 0.20631 0.03200 0.12549 0.04219 0.11264 0.05545 0.18316 0.04033 0.05241 0.05389 2.02958 0.71825 0.26568
1 h-m-p 0.0000 0.0009 1115.4326 +++YYCYYYCCC 2392.973429 8 0.0007 39 | 0/20
2 h-m-p 0.0000 0.0002 289.5694 CYCCC 2390.886965 4 0.0000 69 | 0/20
3 h-m-p 0.0001 0.0015 96.3164 +CYCCC 2387.125628 4 0.0009 100 | 0/20
4 h-m-p 0.0002 0.0009 75.1753 ++ 2385.183582 m 0.0009 123 | 1/20
5 h-m-p 0.0012 0.0060 49.7503 CCC 2384.491153 2 0.0011 150 | 1/20
6 h-m-p 0.0013 0.0168 41.3426 YCCC 2384.134034 3 0.0009 178 | 1/20
7 h-m-p 0.0023 0.0208 15.6742 YCC 2383.945221 2 0.0016 204 | 1/20
8 h-m-p 0.0018 0.0193 13.4592 CC 2383.722592 1 0.0021 229 | 1/20
9 h-m-p 0.0011 0.0095 25.7748 YCCC 2383.233627 3 0.0020 257 | 1/20
10 h-m-p 0.0010 0.0148 53.7858 +YYC 2381.519459 2 0.0032 283 | 1/20
11 h-m-p 0.0010 0.0049 154.3799 +YCCCC 2376.606443 4 0.0028 314 | 1/20
12 h-m-p 0.0010 0.0051 282.8354 YCCC 2370.438281 3 0.0021 342 | 1/20
13 h-m-p 0.0011 0.0054 365.9200 YCCC 2362.094062 3 0.0022 370 | 1/20
14 h-m-p 0.0006 0.0030 370.8974 +YYCCCC 2352.114039 5 0.0019 402 | 1/20
15 h-m-p 0.0010 0.0050 81.4217 YYYC 2351.164562 3 0.0010 428 | 0/20
16 h-m-p 0.0003 0.0014 306.1158 YCYCCC 2349.759681 5 0.0001 459 | 0/20
17 h-m-p 0.0032 0.0230 10.0061 YYC 2349.276774 2 0.0029 484 | 0/20
18 h-m-p 0.0012 0.0060 24.0547 +YCYCCC 2347.334675 5 0.0035 516 | 0/20
19 h-m-p 0.0017 0.0085 20.7651 YCC 2347.110686 2 0.0012 542 | 0/20
20 h-m-p 0.0034 0.0290 7.2729 YC 2347.029297 1 0.0019 566 | 0/20
21 h-m-p 0.0021 0.6295 6.4431 +++YCYCCCC 2328.774596 6 0.2901 602 | 0/20
22 h-m-p 0.0003 0.0016 812.6773 YCCCCC 2323.472103 5 0.0007 634 | 0/20
23 h-m-p 0.2271 1.1357 0.3368 YCCCC 2319.022198 4 0.5119 664 | 0/20
24 h-m-p 0.4672 4.4835 0.3691 CCC 2317.714906 2 0.5504 711 | 0/20
25 h-m-p 0.7326 7.3241 0.2773 YYC 2317.323868 2 0.6086 756 | 0/20
26 h-m-p 1.6000 8.0000 0.0141 YC 2317.269668 1 0.8893 800 | 0/20
27 h-m-p 1.6000 8.0000 0.0059 CC 2317.262838 1 0.5382 845 | 0/20
28 h-m-p 1.6000 8.0000 0.0020 CC 2317.262033 1 0.5911 890 | 0/20
29 h-m-p 1.5145 8.0000 0.0008 YC 2317.261873 1 0.9441 934 | 0/20
30 h-m-p 1.6000 8.0000 0.0004 YC 2317.261840 1 0.8632 978 | 0/20
31 h-m-p 1.5972 8.0000 0.0002 Y 2317.261834 0 1.1176 1021 | 0/20
32 h-m-p 1.6000 8.0000 0.0001 C 2317.261832 0 1.2859 1064 | 0/20
33 h-m-p 1.0255 8.0000 0.0001 Y 2317.261831 0 0.7605 1107 | 0/20
34 h-m-p 1.6000 8.0000 0.0000 Y 2317.261831 0 0.7515 1150 | 0/20
35 h-m-p 1.6000 8.0000 0.0000 Y 2317.261831 0 0.8046 1193 | 0/20
36 h-m-p 1.6000 8.0000 0.0000 Y 2317.261831 0 0.4000 1236 | 0/20
37 h-m-p 0.8971 8.0000 0.0000 ------Y 2317.261831 0 0.0001 1285
Out..
lnL = -2317.261831
1286 lfun, 3858 eigenQcodon, 43724 P(t)
Time used: 0:31
Model 2: PositiveSelection
TREE # 1
(1, ((4, 5), ((6, (8, (9, 10))), 7)), (2, 3)); MP score: 287
initial w for M2:NSpselection reset.
0.084750 0.108997 0.040538 0.057098 0.096811 0.076219 0.000000 0.229809 0.016661 0.128595 0.049868 0.101881 0.068496 0.211406 0.045132 0.052146 0.074730 2.162616 1.659473 0.574115 0.238709 2.403915
ntime & nrate & np: 17 3 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.807924
np = 22
lnL0 = -2474.696708
Iterating by ming2
Initial: fx= 2474.696708
x= 0.08475 0.10900 0.04054 0.05710 0.09681 0.07622 0.00000 0.22981 0.01666 0.12860 0.04987 0.10188 0.06850 0.21141 0.04513 0.05215 0.07473 2.16262 1.65947 0.57412 0.23871 2.40392
1 h-m-p 0.0000 0.0009 1824.6225 +YYYCCC 2463.886614 5 0.0000 35 | 0/22
2 h-m-p 0.0002 0.0008 367.0924 +YCYCCC 2377.356607 5 0.0008 70 | 0/22
3 h-m-p 0.0016 0.0255 177.2030 YCCCC 2367.052341 4 0.0009 102 | 0/22
4 h-m-p 0.0005 0.0024 162.6767 +YYCCCC 2354.207118 5 0.0015 136 | 0/22
5 h-m-p 0.0005 0.0023 143.4803 +CCC 2346.883542 2 0.0017 166 | 0/22
6 h-m-p 0.0019 0.0093 93.5678 CCC 2341.617143 2 0.0025 195 | 0/22
7 h-m-p 0.0006 0.0030 90.3121 +YCCC 2338.204967 3 0.0020 226 | 0/22
8 h-m-p 0.0011 0.0054 115.4262 YCCCC 2334.389010 4 0.0020 258 | 0/22
9 h-m-p 0.0012 0.0060 81.7442 CCCC 2332.946428 3 0.0014 289 | 0/22
10 h-m-p 0.0011 0.0053 39.9038 CCCC 2332.374222 3 0.0015 320 | 0/22
11 h-m-p 0.0018 0.0222 32.5631 CCC 2332.224206 2 0.0007 349 | 0/22
12 h-m-p 0.0017 0.0160 12.8858 CCC 2332.144095 2 0.0014 378 | 0/22
13 h-m-p 0.0017 0.0211 10.3886 CC 2332.081573 1 0.0017 405 | 0/22
14 h-m-p 0.0022 0.0241 8.1092 CYC 2332.030646 2 0.0020 433 | 0/22
15 h-m-p 0.0011 0.0511 15.5101 ++CCCC 2330.792295 3 0.0248 466 | 0/22
16 h-m-p 0.0014 0.0071 222.3023 YCCCC 2328.823584 4 0.0028 498 | 0/22
17 h-m-p 0.0009 0.0043 325.9022 YCCC 2327.265094 3 0.0015 528 | 0/22
18 h-m-p 0.0025 0.0125 111.0091 YCCC 2326.734436 3 0.0016 558 | 0/22
19 h-m-p 0.0083 0.0414 17.6612 CC 2326.628533 1 0.0023 585 | 0/22
20 h-m-p 0.0034 0.3530 12.1084 ++CCCCC 2324.588300 4 0.0731 620 | 0/22
21 h-m-p 0.0022 0.0110 175.4675 YCCC 2324.036016 3 0.0014 650 | 0/22
22 h-m-p 0.2909 2.6391 0.8720 +CYC 2322.018499 2 1.0794 679 | 0/22
23 h-m-p 0.4246 8.0000 2.2170 CYCC 2321.319067 3 0.3017 731 | 0/22
24 h-m-p 0.7407 6.8527 0.9030 CCCC 2320.393339 3 1.0454 762 | 0/22
25 h-m-p 0.4383 5.0528 2.1537 YCCC 2319.341966 3 1.0200 814 | 0/22
26 h-m-p 0.5103 2.5516 2.9277 YCCCC 2317.927054 4 0.9732 846 | 0/22
27 h-m-p 0.4502 2.2511 1.8088 CCC 2317.418156 2 0.6292 875 | 0/22
28 h-m-p 1.4847 7.4235 0.3426 YC 2317.315598 1 0.6726 901 | 0/22
29 h-m-p 1.6000 8.0000 0.0844 YC 2317.299018 1 0.6551 949 | 0/22
30 h-m-p 1.6000 8.0000 0.0282 YC 2317.297963 1 0.8765 997 | 0/22
31 h-m-p 1.6000 8.0000 0.0139 CC 2317.297038 1 2.5328 1046 | 0/22
32 h-m-p 0.2365 8.0000 0.1484 +++ 2317.290066 m 8.0000 1094 | 0/22
33 h-m-p 1.6000 8.0000 0.5598 CC 2317.275768 1 1.9561 1143 | 0/22
34 h-m-p 1.2130 8.0000 0.9027 CC 2317.270217 1 1.0603 1192 | 0/22
35 h-m-p 0.9308 8.0000 1.0283 YC 2317.266373 1 1.4706 1240 | 0/22
36 h-m-p 1.2994 8.0000 1.1638 CC 2317.264153 1 1.0951 1267 | 0/22
37 h-m-p 1.4992 8.0000 0.8502 C 2317.263095 0 1.4992 1292 | 0/22
38 h-m-p 1.1572 8.0000 1.1014 C 2317.262520 0 1.1572 1339 | 0/22
39 h-m-p 1.5037 8.0000 0.8476 C 2317.262191 0 1.5037 1364 | 0/22
40 h-m-p 1.1596 8.0000 1.0991 C 2317.262039 0 1.1596 1411 | 0/22
41 h-m-p 1.6000 8.0000 0.6021 C 2317.261953 0 1.4899 1436 | 0/22
42 h-m-p 0.8915 8.0000 1.0062 Y 2317.261905 0 1.5569 1483 | 0/22
43 h-m-p 1.6000 8.0000 0.1667 Y 2317.261888 0 0.9260 1508 | 0/22
44 h-m-p 0.2264 8.0000 0.6817 +C 2317.261877 0 1.0467 1556 | 0/22
45 h-m-p 1.4847 8.0000 0.4806 +Y 2317.261853 0 3.8059 1604 | 0/22
46 h-m-p 1.6000 8.0000 0.9636 C 2317.261841 0 1.6000 1651 | 0/22
47 h-m-p 1.6000 8.0000 0.7904 C 2317.261837 0 1.6000 1698 | 0/22
48 h-m-p 1.3026 8.0000 0.9709 C 2317.261834 0 1.5118 1745 | 0/22
49 h-m-p 1.4964 8.0000 0.9809 C 2317.261833 0 1.3230 1792 | 0/22
50 h-m-p 1.3335 8.0000 0.9732 C 2317.261832 0 1.6414 1839 | 0/22
51 h-m-p 1.6000 8.0000 0.9338 C 2317.261832 0 2.1101 1886 | 0/22
52 h-m-p 1.6000 8.0000 1.1524 C 2317.261832 0 1.2956 1933 | 0/22
53 h-m-p 0.9997 8.0000 1.4934 ------Y 2317.261832 0 0.0001 1964 | 0/22
54 h-m-p 0.0160 8.0000 0.9966 -------C 2317.261832 0 0.0000 1996 | 0/22
55 h-m-p 0.0160 8.0000 0.0001 ++Y 2317.261832 0 0.4618 2045 | 0/22
56 h-m-p 1.6000 8.0000 0.0000 Y 2317.261832 0 0.8366 2092 | 0/22
57 h-m-p 1.6000 8.0000 0.0000 Y 2317.261832 0 1.6000 2139 | 0/22
58 h-m-p 1.1484 8.0000 0.0000 -C 2317.261832 0 0.0718 2187
Out..
lnL = -2317.261832
2188 lfun, 8752 eigenQcodon, 111588 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2331.184028 S = -2237.401413 -84.772776
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 179 patterns 1:17
did 20 / 179 patterns 1:17
did 30 / 179 patterns 1:17
did 40 / 179 patterns 1:17
did 50 / 179 patterns 1:18
did 60 / 179 patterns 1:18
did 70 / 179 patterns 1:18
did 80 / 179 patterns 1:18
did 90 / 179 patterns 1:18
did 100 / 179 patterns 1:18
did 110 / 179 patterns 1:18
did 120 / 179 patterns 1:18
did 130 / 179 patterns 1:18
did 140 / 179 patterns 1:18
did 150 / 179 patterns 1:18
did 160 / 179 patterns 1:18
did 170 / 179 patterns 1:18
did 179 / 179 patterns 1:18
Time used: 1:18
Model 3: discrete
TREE # 1
(1, ((4, 5), ((6, (8, (9, 10))), 7)), (2, 3)); MP score: 287
0.085225 0.103226 0.025671 0.046560 0.112944 0.091522 0.000000 0.256470 0.006804 0.138688 0.039187 0.111928 0.073281 0.227469 0.049507 0.039996 0.070795 2.162620 0.339697 0.499728 0.029148 0.061285 0.119258
ntime & nrate & np: 17 4 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 17.907850
np = 23
lnL0 = -2325.531869
Iterating by ming2
Initial: fx= 2325.531869
x= 0.08523 0.10323 0.02567 0.04656 0.11294 0.09152 0.00000 0.25647 0.00680 0.13869 0.03919 0.11193 0.07328 0.22747 0.04951 0.04000 0.07079 2.16262 0.33970 0.49973 0.02915 0.06129 0.11926
1 h-m-p 0.0000 0.0002 624.8556 ++ 2315.829386 m 0.0002 28 | 1/23
2 h-m-p 0.0001 0.0006 156.2370 ++ 2306.450075 m 0.0006 54 | 0/23
3 h-m-p 0.0003 0.0013 183.5320 CYCCC 2305.095434 4 0.0002 87 | 0/23
4 h-m-p 0.0001 0.0003 62.1794 ++ 2304.659024 m 0.0003 113 | 0/23
5 h-m-p 0.0003 0.0013 27.1970 CCC 2304.543924 2 0.0004 143 | 0/23
6 h-m-p 0.0009 0.0047 11.5525 YC 2304.508430 1 0.0007 170 | 0/23
7 h-m-p 0.0008 0.0043 9.1857 YC 2304.491453 1 0.0006 197 | 0/23
8 h-m-p 0.0009 0.0046 6.1229 YC 2304.484540 1 0.0006 224 | 0/23
9 h-m-p 0.0005 0.0025 5.3338 YC 2304.477974 1 0.0009 251 | 0/23
10 h-m-p 0.0008 0.0209 6.1494 +CC 2304.455731 1 0.0028 280 | 0/23
11 h-m-p 0.0005 0.0026 23.4243 YC 2304.423833 1 0.0011 307 | 0/23
12 h-m-p 0.0008 0.0129 30.1833 YC 2304.354152 1 0.0018 334 | 0/23
13 h-m-p 0.0012 0.0065 47.4605 CCC 2304.268993 2 0.0014 364 | 0/23
14 h-m-p 0.0023 0.0171 29.1845 CC 2304.241995 1 0.0008 392 | 0/23
15 h-m-p 0.0037 0.0255 5.8683 CC 2304.233952 1 0.0012 420 | 0/23
16 h-m-p 0.0033 0.0548 2.0169 YC 2304.228575 1 0.0020 447 | 0/23
17 h-m-p 0.0020 0.0474 1.9823 YC 2304.210832 1 0.0045 474 | 0/23
18 h-m-p 0.0006 0.0104 15.0144 ++YCC 2303.936612 2 0.0079 505 | 0/23
19 h-m-p 0.0000 0.0002 149.7849 ++ 2303.777165 m 0.0002 531 | 1/23
20 h-m-p 0.0008 0.0041 36.4623 YYC 2303.715187 2 0.0007 559 | 1/23
21 h-m-p 0.0171 0.1848 1.5400 CCC 2303.512625 2 0.0187 589 | 1/23
22 h-m-p 0.0017 0.0096 17.2582 ++ 2301.017633 m 0.0096 615 | 0/23
23 h-m-p 0.0000 0.0000 359.0250
h-m-p: 2.36394883e-21 1.18197441e-20 3.59024995e+02 2301.017633
.. | 0/23
24 h-m-p 0.0000 0.0008 118.3085 +CYC 2300.785406 2 0.0000 668 | 0/23
25 h-m-p 0.0001 0.0007 60.9002 +CCCCC 2300.221005 4 0.0003 703 | 0/23
26 h-m-p 0.0008 0.0137 24.6870 YCCC 2300.126864 3 0.0004 734 | 0/23
27 h-m-p 0.0008 0.0079 12.4440 CC 2300.089006 1 0.0006 762 | 0/23
28 h-m-p 0.0020 0.0151 3.9476 YC 2300.086682 1 0.0003 789 | 0/23
29 h-m-p 0.0007 0.0387 1.9312 C 2300.085704 0 0.0007 815 | 0/23
30 h-m-p 0.0010 0.0400 1.3160 YC 2300.085301 1 0.0007 842 | 0/23
31 h-m-p 0.0009 0.0357 1.0462 CC 2300.084900 1 0.0013 870 | 0/23
32 h-m-p 0.0008 0.0373 1.6969 C 2300.084542 0 0.0008 896 | 0/23
33 h-m-p 0.0007 0.0654 2.0293 +C 2300.083327 0 0.0027 923 | 0/23
34 h-m-p 0.0006 0.0272 8.5913 YC 2300.080960 1 0.0013 950 | 0/23
35 h-m-p 0.0009 0.1939 11.6319 +YC 2300.073501 1 0.0030 978 | 0/23
36 h-m-p 0.0017 0.1854 20.3710 YC 2300.068796 1 0.0011 1005 | 0/23
37 h-m-p 0.0030 0.0150 5.0898 C 2300.068081 0 0.0007 1031 | 0/23
38 h-m-p 0.0024 0.0149 1.4493 YC 2300.067605 1 0.0018 1058 | 0/23
39 h-m-p 0.0013 0.0096 2.0224 YC 2300.066616 1 0.0030 1085 | 0/23
40 h-m-p 0.0013 0.0066 4.2537 YC 2300.064458 1 0.0032 1112 | 0/23
41 h-m-p 0.0012 0.0082 11.6711 YC 2300.060692 1 0.0020 1139 | 0/23
42 h-m-p 0.0014 0.0334 17.1413 C 2300.056853 0 0.0014 1165 | 0/23
43 h-m-p 0.0011 0.0083 22.4608 CC 2300.051766 1 0.0015 1193 | 0/23
44 h-m-p 0.1889 3.9806 0.1745 --Y 2300.051743 0 0.0017 1221 | 0/23
45 h-m-p 0.0100 5.0037 0.0435 C 2300.051738 0 0.0021 1270 | 0/23
46 h-m-p 0.0088 4.3762 0.0275 ++YC 2300.050624 1 0.3353 1322 | 0/23
47 h-m-p 1.6000 8.0000 0.0015 YC 2300.050518 1 1.0897 1372 | 0/23
48 h-m-p 1.6000 8.0000 0.0007 Y 2300.050517 0 0.9888 1421 | 0/23
49 h-m-p 1.6000 8.0000 0.0000 Y 2300.050517 0 0.9885 1470 | 0/23
50 h-m-p 1.6000 8.0000 0.0000 -Y 2300.050517 0 0.1000 1520 | 0/23
51 h-m-p 0.1656 8.0000 0.0000 --Y 2300.050517 0 0.0026 1571
Out..
lnL = -2300.050517
1572 lfun, 6288 eigenQcodon, 80172 P(t)
Time used: 1:51
Model 7: beta
TREE # 1
(1, ((4, 5), ((6, (8, (9, 10))), 7)), (2, 3)); MP score: 287
0.086278 0.103997 0.029399 0.043729 0.117050 0.092429 0.000000 0.259410 0.006208 0.138338 0.045311 0.107362 0.072349 0.221931 0.046836 0.044728 0.068146 2.008899 0.309823 1.349954
ntime & nrate & np: 17 1 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 13.249667
np = 20
lnL0 = -2338.519619
Iterating by ming2
Initial: fx= 2338.519619
x= 0.08628 0.10400 0.02940 0.04373 0.11705 0.09243 0.00000 0.25941 0.00621 0.13834 0.04531 0.10736 0.07235 0.22193 0.04684 0.04473 0.06815 2.00890 0.30982 1.34995
1 h-m-p 0.0000 0.0017 903.6888 +YYCCCC 2330.026488 5 0.0001 34 | 0/20
2 h-m-p 0.0003 0.0016 233.1885 +YYCCCC 2308.244795 5 0.0008 66 | 0/20
3 h-m-p 0.0002 0.0010 123.7679 YCCCC 2305.069700 4 0.0005 96 | 0/20
4 h-m-p 0.0011 0.0056 33.2487 YC 2304.797102 1 0.0006 120 | 0/20
5 h-m-p 0.0008 0.0057 23.7416 CCC 2304.600394 2 0.0010 147 | 0/20
6 h-m-p 0.0013 0.0109 17.6271 YCC 2304.505315 2 0.0010 173 | 0/20
7 h-m-p 0.0006 0.0113 28.7467 +YCC 2304.277812 2 0.0017 200 | 0/20
8 h-m-p 0.0007 0.0121 71.2048 +YYC 2303.524224 2 0.0024 226 | 0/20
9 h-m-p 0.0011 0.0054 140.6632 CCCC 2302.838224 3 0.0011 255 | 0/20
10 h-m-p 0.0017 0.0085 71.3889 YCCC 2302.540742 3 0.0011 283 | 0/20
11 h-m-p 0.0030 0.0148 23.6512 CC 2302.476799 1 0.0008 308 | 0/20
12 h-m-p 0.0013 0.0106 15.2263 YC 2302.450297 1 0.0006 332 | 0/20
13 h-m-p 0.0017 0.0486 5.8738 YC 2302.442515 1 0.0008 356 | 0/20
14 h-m-p 0.0016 0.0419 2.8522 YC 2302.439443 1 0.0010 380 | 0/20
15 h-m-p 0.0018 0.2797 1.6216 C 2302.437309 0 0.0017 403 | 0/20
16 h-m-p 0.0006 0.3055 4.8324 +YC 2302.415849 1 0.0060 428 | 0/20
17 h-m-p 0.0011 0.0250 26.7090 YC 2302.379384 1 0.0018 452 | 0/20
18 h-m-p 0.0016 0.0377 30.8132 YC 2302.355081 1 0.0011 476 | 0/20
19 h-m-p 0.0111 0.0870 2.9247 -CC 2302.353105 1 0.0009 502 | 0/20
20 h-m-p 0.0085 4.1013 0.3044 ++CCC 2302.203029 2 0.2019 531 | 0/20
21 h-m-p 0.0011 0.0167 56.7030 +CCC 2301.530128 2 0.0046 579 | 0/20
22 h-m-p 0.8547 4.2736 0.2089 CCCC 2301.023050 3 1.4945 608 | 0/20
23 h-m-p 1.6000 8.0000 0.0224 YC 2300.976091 1 1.1696 652 | 0/20
24 h-m-p 1.1890 8.0000 0.0220 CC 2300.965878 1 1.3764 697 | 0/20
25 h-m-p 1.6000 8.0000 0.0120 C 2300.964475 0 1.5265 740 | 0/20
26 h-m-p 1.6000 8.0000 0.0104 +YC 2300.962437 1 4.0629 785 | 0/20
27 h-m-p 1.6000 8.0000 0.0034 YC 2300.962242 1 1.0146 829 | 0/20
28 h-m-p 1.6000 8.0000 0.0008 Y 2300.962239 0 0.8139 872 | 0/20
29 h-m-p 1.6000 8.0000 0.0001 Y 2300.962239 0 0.8429 915 | 0/20
30 h-m-p 1.6000 8.0000 0.0000 Y 2300.962239 0 0.8993 958 | 0/20
31 h-m-p 1.6000 8.0000 0.0000 Y 2300.962239 0 0.9336 1001 | 0/20
32 h-m-p 1.6000 8.0000 0.0000 C 2300.962239 0 0.4000 1044 | 0/20
33 h-m-p 1.6000 8.0000 0.0000 --------C 2300.962239 0 0.0000 1095
Out..
lnL = -2300.962239
1096 lfun, 12056 eigenQcodon, 186320 P(t)
Time used: 3:08
Model 8: beta&w>1
TREE # 1
(1, ((4, 5), ((6, (8, (9, 10))), 7)), (2, 3)); MP score: 287
initial w for M8:NSbetaw>1 reset.
0.102308 0.069572 0.034128 0.049545 0.097995 0.060983 0.000000 0.160030 0.030238 0.090742 0.038245 0.066226 0.078294 0.166564 0.040414 0.066518 0.041202 2.020440 0.900000 0.966220 1.075304 2.140227
ntime & nrate & np: 17 2 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.264719
np = 22
lnL0 = -2500.469544
Iterating by ming2
Initial: fx= 2500.469544
x= 0.10231 0.06957 0.03413 0.04955 0.09799 0.06098 0.00000 0.16003 0.03024 0.09074 0.03825 0.06623 0.07829 0.16656 0.04041 0.06652 0.04120 2.02044 0.90000 0.96622 1.07530 2.14023
1 h-m-p 0.0000 0.0003 1895.7094 ++YCCCC 2483.649505 4 0.0001 36 | 0/22
2 h-m-p 0.0000 0.0002 427.6391 ++ 2451.029755 m 0.0002 61 | 1/22
3 h-m-p 0.0002 0.0010 232.9132 ++ 2428.034299 m 0.0010 86 | 1/22
4 h-m-p -0.0000 -0.0000 1559.4490
h-m-p: -9.12625589e-21 -4.56312794e-20 1.55944896e+03 2428.034299
.. | 1/22
5 h-m-p 0.0000 0.0018 664.7734 ++CCYCC 2414.756972 4 0.0002 142 | 1/22
6 h-m-p 0.0003 0.0014 222.2968 ++ 2375.004133 m 0.0014 167 | 1/22
7 h-m-p 0.0002 0.0012 459.3865 +YYCCCC 2341.756865 5 0.0008 201 | 0/22
8 h-m-p 0.0001 0.0003 1036.5464 YCYCCC 2332.795158 5 0.0001 234 | 0/22
9 h-m-p 0.0004 0.0021 70.8068 CCCC 2331.179157 3 0.0007 265 | 0/22
10 h-m-p 0.0006 0.0029 76.6457 ++ 2325.011642 m 0.0029 290 | 0/22
11 h-m-p 0.0010 0.0049 139.2632 YCCC 2320.335205 3 0.0019 320 | 0/22
12 h-m-p 0.0000 0.0002 91.8548 ++ 2319.788194 m 0.0002 345 | 0/22
13 h-m-p -0.0000 -0.0000 104.7806
h-m-p: -3.00641187e-22 -1.50320594e-21 1.04780634e+02 2319.788194
.. | 0/22
14 h-m-p 0.0000 0.0015 163.0359 ++CYCC 2317.172159 3 0.0002 399 | 0/22
15 h-m-p 0.0003 0.0013 122.5155 YCCCC 2314.133884 4 0.0005 431 | 0/22
16 h-m-p 0.0002 0.0011 120.9023 YCCCC 2311.969353 4 0.0005 463 | 0/22
17 h-m-p 0.0002 0.0011 125.0508 +CYC 2308.838651 2 0.0009 492 | 0/22
18 h-m-p 0.0000 0.0001 273.1739 ++ 2307.341715 m 0.0001 517 | 1/22
19 h-m-p 0.0001 0.0005 263.8794 YCCC 2306.434894 3 0.0002 547 | 1/22
20 h-m-p 0.0006 0.0029 57.3438 YYC 2306.016910 2 0.0005 574 | 1/22
21 h-m-p 0.0003 0.0013 36.2575 CCCC 2305.876804 3 0.0004 605 | 1/22
22 h-m-p 0.0004 0.0046 37.3775 CY 2305.774003 1 0.0004 632 | 1/22
23 h-m-p 0.0006 0.0093 23.3784 CC 2305.703225 1 0.0005 659 | 1/22
24 h-m-p 0.0006 0.0043 18.7287 YCC 2305.660044 2 0.0005 687 | 1/22
25 h-m-p 0.0008 0.0101 10.7186 CCC 2305.616321 2 0.0010 716 | 1/22
26 h-m-p 0.0005 0.0163 23.7622 +YC 2305.510864 1 0.0012 743 | 1/22
27 h-m-p 0.0007 0.0299 38.1635 +CC 2305.130418 1 0.0027 771 | 1/22
28 h-m-p 0.0010 0.0289 101.8108 +YCCC 2304.114818 3 0.0028 802 | 1/22
29 h-m-p 0.0015 0.0120 190.2562 CCCC 2302.635243 3 0.0021 833 | 1/22
30 h-m-p 0.0050 0.0251 17.3239 YC 2302.584205 1 0.0009 859 | 1/22
31 h-m-p 0.0027 0.1360 6.0121 +YC 2302.462232 1 0.0083 886 | 1/22
32 h-m-p 0.0009 0.0585 57.1729 +CCCC 2301.767080 3 0.0053 918 | 1/22
33 h-m-p 0.0036 0.0181 31.7408 CC 2301.695284 1 0.0010 945 | 1/22
34 h-m-p 0.0118 0.0908 2.6713 -YC 2301.688960 1 0.0015 972 | 1/22
35 h-m-p 0.0115 0.5630 0.3391 ++CCCC 2301.181376 3 0.2082 1005 | 1/22
36 h-m-p 0.2766 4.1460 0.2553 YCC 2301.019279 2 0.5163 1054 | 1/22
37 h-m-p 1.6000 8.0000 0.0210 YC 2300.979367 1 0.7405 1101 | 1/22
38 h-m-p 0.2936 8.0000 0.0530 +YC 2300.965399 1 0.9839 1149 | 1/22
39 h-m-p 1.6000 8.0000 0.0170 YC 2300.964641 1 1.1826 1196 | 1/22
40 h-m-p 1.6000 8.0000 0.0063 C 2300.964437 0 1.3689 1242 | 1/22
41 h-m-p 1.6000 8.0000 0.0013 Y 2300.964412 0 1.2242 1288 | 1/22
42 h-m-p 1.6000 8.0000 0.0002 C 2300.964409 0 1.2830 1334 | 1/22
43 h-m-p 1.6000 8.0000 0.0001 Y 2300.964409 0 1.1503 1380 | 1/22
44 h-m-p 1.6000 8.0000 0.0000 C 2300.964409 0 1.5398 1426 | 1/22
45 h-m-p 0.9373 8.0000 0.0000 +C 2300.964409 0 4.0385 1473 | 1/22
46 h-m-p 1.3465 8.0000 0.0001 ++ 2300.964409 m 8.0000 1519 | 1/22
47 h-m-p 0.1104 8.0000 0.0073 ++C 2300.964408 0 2.6229 1567 | 1/22
48 h-m-p 1.6000 8.0000 0.0111 ++ 2300.964402 m 8.0000 1613 | 1/22
49 h-m-p 0.1125 8.0000 0.7919 ----------Y 2300.964402 0 0.0000 1669 | 1/22
50 h-m-p 0.0160 8.0000 0.0193 +++C 2300.964400 0 1.0527 1718 | 1/22
51 h-m-p 1.6000 8.0000 0.0002 ++ 2300.964400 m 8.0000 1764 | 1/22
52 h-m-p 0.6519 8.0000 0.0019 ++ 2300.964399 m 8.0000 1810 | 1/22
53 h-m-p 0.1732 8.0000 0.0891 ++Y 2300.964388 0 4.4267 1858 | 1/22
54 h-m-p 1.2271 6.1355 0.2989 ++ 2300.963402 m 6.1355 1904 | 2/22
55 h-m-p 0.6744 8.0000 0.0095 CC 2300.963138 1 0.9968 1952 | 2/22
56 h-m-p 1.6000 8.0000 0.0002 Y 2300.963136 0 1.0469 1997 | 2/22
57 h-m-p 1.6000 8.0000 0.0000 Y 2300.963136 0 1.0183 2042 | 2/22
58 h-m-p 1.6000 8.0000 0.0000 C 2300.963136 0 1.6000 2087 | 2/22
59 h-m-p 1.6000 8.0000 0.0000 --Y 2300.963136 0 0.0250 2134
Out..
lnL = -2300.963136
2135 lfun, 25620 eigenQcodon, 399245 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2331.466258 S = -2241.979604 -81.425009
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 179 patterns 5:53
did 20 / 179 patterns 5:54
did 30 / 179 patterns 5:54
did 40 / 179 patterns 5:54
did 50 / 179 patterns 5:54
did 60 / 179 patterns 5:54
did 70 / 179 patterns 5:55
did 80 / 179 patterns 5:55
did 90 / 179 patterns 5:55
did 100 / 179 patterns 5:55
did 110 / 179 patterns 5:55
did 120 / 179 patterns 5:55
did 130 / 179 patterns 5:56
did 140 / 179 patterns 5:56
did 150 / 179 patterns 5:56
did 160 / 179 patterns 5:56
did 170 / 179 patterns 5:56
did 179 / 179 patterns 5:57
Time used: 5:57
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=223
D_melanogaster_Snp-PG MQPYSYVIAVDFEATCWEKQAPPEWREAEIIEFPAVLVNLKTGKIEAEFH
D_sechellia_Snp-PG MQPYSYVIAVDFEATCWENQAPPHWREAEIIEFPAVLVNLKTGKIEAEFH
D_simulans_Snp-PG MQPYSYVIAVDFEATCWENQAPPHWREAEIIEFPAVLVNLKTGKIESEFH
D_yakuba_Snp-PG MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
D_erecta_Snp-PG MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
D_takahashii_Snp-PG MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNVKTGKIEAEFH
D_eugracilis_Snp-PG MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLNTGKIEAEFH
D_ficusphila_Snp-PG MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
D_rhopaloa_Snp-PG MQPYTYVISVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
D_elegans_Snp-PG MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH
****:***:*********:****.***************::*****:***
D_melanogaster_Snp-PG QYILPFESPRLSAYCTELTGIQQKTVDSGMPLRTAIVMFNEWLRNEMRAR
D_sechellia_Snp-PG QYILPIESPRLSTYCTELTGIQQKTVDSGIPLQTAMVMFHEWLRNEMRAR
D_simulans_Snp-PG QYILPIESPRLSTYCTELTGIQQKTVDSGIPLTTAIVMFNEWLRHEIRTR
D_yakuba_Snp-PG KYILPFESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
D_erecta_Snp-PG KYILPIESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
D_takahashii_Snp-PG KYILPIESPRLSAYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
D_eugracilis_Snp-PG KYILPIESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
D_ficusphila_Snp-PG KYILPVESPRLSSYCTELTGIQQKTVDSGMPLQTAMMMFHEWLRKELRAR
D_rhopaloa_Snp-PG QYILPIESPRLSSYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
D_elegans_Snp-PG QYILPIESPRLSSYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR
:****.******:****************:** **::**:****:*:*:*
D_melanogaster_Snp-PG NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECSRKGIRKPAYFNQWID
D_sechellia_Snp-PG NLTLPKTNKSNILGNCAFVTWTDWDFGICLAKECNRKGIRKAAYFNQWID
D_simulans_Snp-PG NLTLPKMNKSNVLGNCAFVTWTDWDFGICLAKECNRKGIRKPAYFNQWID
D_yakuba_Snp-PG NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
D_erecta_Snp-PG NLTLPKMNKSNIMGNCAFVTWTDWDFGICLSKECTRKRMRKAAYFNQWID
D_takahashii_Snp-PG NLTLPKMNKSNILGNCAFATWTDWDFGICLAKECTRKRMRKGAYFNQWID
D_eugracilis_Snp-PG NLVLPKMSKSNILGNVAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
D_ficusphila_Snp-PG NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
D_rhopaloa_Snp-PG NLTLPKMSKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
D_elegans_Snp-PG NLTLPKMSKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID
**.*** .***::** **.***********:***.** :** ********
D_melanogaster_Snp-PG VRAIYRSWYKYRPCNFTDALSHVGLAFEGKAHSGIDDAKNLGALMCKMVR
D_sechellia_Snp-PG VRAIYRSWYKYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMMR
D_simulans_Snp-PG VRAIYRSWYKYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMMR
D_yakuba_Snp-PG VRAIYRSWYQYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
D_erecta_Snp-PG VRAVYRSWYQYRPCNFTDALEHVGLAFEGRAHSGIDDAKNLGALMCKMVR
D_takahashii_Snp-PG VRAVYRSWYKYKPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALICKMVR
D_eugracilis_Snp-PG VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
D_ficusphila_Snp-PG VRAIYWSWYKYRPCNFSDALSHVGLSFEGRAHSGIDDAKNLGALMCKMVR
D_rhopaloa_Snp-PG VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
D_elegans_Snp-PG VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR
***:* ***:*:****:***.****:***:**************:***:*
D_melanogaster_Snp-PG DGALFSITKDLTPYQQLNPRFVL
D_sechellia_Snp-PG DGALFSITKDLTPYQQLNPNIAL
D_simulans_Snp-PG DGALFSITKDLTPYQQLNPNFSL
D_yakuba_Snp-PG DGALFSITKDLTPYQQLNPNCVL
D_erecta_Snp-PG DGALFSITKDLTPYQQLNPNCVL
D_takahashii_Snp-PG DGALFSITKDLTPYQQLNPNCVL
D_eugracilis_Snp-PG DGALFSITKDLTPYQQLNPNCVL
D_ficusphila_Snp-PG DGALFSITKDLTPYQQLNPNCGL
D_rhopaloa_Snp-PG DGALFSITKDLTPYQQLNPNCVL
D_elegans_Snp-PG DGALFSITKDLTPYQQLNPNCVL
*******************. *
>D_melanogaster_Snp-PG ATGCAACCCTACTCATATGTGATTGCCGTGGACTTTGAGGCAACCTGCTG GGAAAAGCAGGCTCCGCCAGAGTGGCGAGAAGCGGAGATAATTGAATTCC CAGCAGTGCTTGTTAACCTTAAGACAGGAAAGATCGAGGCGGAATTCCAC CAGTACATCCTTCCCTTCGAGTCGCCGCGCTTGAGCGCCTACTGCACGGA GCTGACGGGCATCCAGCAGAAGACTGTGGACAGCGGAATGCCGCTGCGGA CGGCGATCGTGATGTTTAACGAATGGCTGCGCAATGAGATGCGAGCCCGC AACCTTACCTTGCCCAAGATGAACAAGTCAAACATACTGGGCAACTGTGC ATTCGTCACCTGGACGGACTGGGACTTCGGCATCTGCTTGGCGAAGGAGT GCAGCCGCAAAGGGATACGCAAGCCGGCCTACTTTAATCAGTGGATCGAC GTGCGGGCCATTTATCGGTCGTGGTACAAGTACCGTCCGTGCAACTTCAC GGATGCCCTGTCGCACGTGGGTCTGGCATTCGAGGGCAAGGCCCACTCGG GGATCGACGATGCCAAGAATCTGGGCGCACTCATGTGCAAGATGGTGCGC GACGGGGCGCTATTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT TAATCCCAGGTTCGTGTTG >D_sechellia_Snp-PG ATGCAGCCCTACTCGTATGTGATTGCCGTGGACTTTGAGGCAACCTGCTG GGAAAATCAGGCACCACCACATTGGCGAGAAGCGGAGATAATTGAATTCC CAGCAGTGCTCGTTAACCTTAAGACAGGAAAGATCGAGGCGGAGTTCCAC CAGTACATACTTCCCATCGAGTCGCCGCGCTTGAGCACCTACTGCACGGA GCTGACGGGCATCCAGCAGAAAACTGTGGACAGCGGAATACCGCTGCAGA CGGCGATGGTGATGTTTCATGAGTGGCTGCGCAATGAGATGCGCGCCCGG AACCTCACCTTGCCCAAGACGAACAAGTCAAACATACTGGGTAACTGTGC ATTCGTCACCTGGACGGACTGGGACTTCGGCATCTGTTTGGCGAAGGAGT GCAACCGGAAAGGGATACGCAAGGCGGCCTACTTTAATCAGTGGATCGAC GTGAGGGCCATTTATCGGTCGTGGTACAAGTACCGCCCGTGCAACTTCAC GGATGCCCTGTCGCACGTGGGTCTGGCATTCGAGGGCAGGGCCCACTCCG GGATCGACGATGCCAAGAATCTTGGCGCCCTCATGTGCAAGATGATGCGC GACGGGGCGCTATTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT CAATCCCAACATCGCGTTG >D_simulans_Snp-PG ATGCAGCCCTACTCGTATGTGATTGCCGTGGACTTTGAGGCTACCTGCTG GGAAAATCAGGCTCCACCACATTGGCGAGAAGCGGAGATAATTGAATTCC CAGCAGTGCTCGTTAACCTTAAGACAGGAAAGATCGAGTCGGAGTTCCAC CAGTACATCCTTCCCATCGAGTCGCCGCGCTTGAGCACCTACTGCACGGA GCTGACGGGCATCCAGCAGAAGACTGTGGACAGCGGAATACCGCTGACGA CGGCGATTGTGATGTTTAACGAGTGGCTGCGCCATGAGATACGCACCAGG AACCTCACCTTGCCCAAGATGAACAAGTCAAACGTACTGGGTAACTGTGC ATTCGTCACCTGGACGGATTGGGACTTCGGCATCTGCTTGGCCAAGGAGT GCAACCGGAAAGGGATACGCAAGCCGGCCTACTTTAATCAGTGGATCGAC GTGAGGGCCATTTATCGGTCGTGGTACAAGTACCGCCCGTGCAACTTCAC GGATGCCCTGTCGCACGTGGGTCTGGCATTCGAGGGCAGGGCCCACTCCG GGATCGACGATGCCAAGAATCTGGGCGCCCTCATGTGCAAGATGATGCGC GACGGGGCGCTATTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT CAATCCCAACTTCTCGTTG >D_yakuba_Snp-PG ATGCAGCCCTACACCTATGTGATTGCCGTGGACTTTGAGGCAACCTGCTG GGAGAAGCAGGCACCACCACAATGGCGAGAAGCGGAGATCATTGAATTCC CAGCAGTGCTTGTTAACCTGAAGACAGGAAAGATCGAAGCGGAGTTTCAC AAGTATATCCTACCCTTCGAGTCGCCGCGCTTGAGCACCTACTGTACGGA GCTGACGGGCATCCAGCAGAAGACTGTGGACAGCGGAGTGCCGCTGCAGA CGGCGCTAATGATGTTTCACGAGTGGCTGCGCAAGGAGCTGCGTGCCCGG AACCTCACCTTGCCCAAGATGAACAAGTCCAACATACTGGGCAACTGTGC ATTCGTCACCTGGACGGACTGGGACTTTGGCATCTGCTTGGCGAAGGAGT GCACTCGCAAGCGGATGCGCAAGGCGGCCTACTTCAATCAGTGGATCGAT GTGCGGGCCATCTATCGATCGTGGTACCAGTACCGTCCGTGCAACTTCAC CGATGCCCTGTCGCACGTGGGCTTGGCCTTCGAGGGCAGGGCCCACTCGG GGATCGACGATGCCAAGAATCTGGGCGCCCTCATGTGCAAGATGGTGCGC GACGGGGCGCTCTTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT CAATCCCAACTGCGTGTTG >D_erecta_Snp-PG ATGCAGCCCTACTCCTATGTGATTGCCGTGGACTTTGAGGCAACCTGCTG GGAGAAACAGGCTCCACCACAATGGCGTGAGGCGGAGATTATTGAGTTCC CAGCAGTGCTTGTGAACCTTAAGACAGGAAAGATCGAGGCGGAGTTCCAC AAGTATATTCTACCCATAGAGTCGCCCCGCTTGAGCACCTACTGTACGGA GCTGACGGGCATCCAGCAGAAGACTGTGGACAGCGGAGTGCCGCTGCAGA CGGCGCTAATGATGTTTCACGAGTGGTTGCGCAAGGAGCTGCGCGCCCGG AACCTCACCTTGCCCAAGATGAACAAGTCCAACATAATGGGCAACTGTGC ATTCGTCACCTGGACGGACTGGGACTTTGGCATCTGCTTGTCGAAGGAGT GCACACGCAAACGGATGCGCAAGGCAGCCTACTTCAATCAGTGGATCGAC GTGCGGGCCGTCTATCGGTCGTGGTATCAGTACCGCCCGTGCAACTTCAC CGATGCCCTGGAGCACGTGGGCTTGGCCTTCGAGGGCAGGGCCCACTCGG GGATCGACGATGCCAAGAATCTGGGCGCCCTTATGTGCAAGATGGTGCGC GACGGTGCACTCTTCTCGATCACCAAAGACCTGACGCCATATCAGCAGCT CAATCCCAACTGCGTGTTG >D_takahashii_Snp-PG ATGCAGCCCTATACATATGTAATTGCAGTGGATTTTGAGGCCACCTGCTG GGAGAAGCAGGCGCCACCGCAATGGCGAGAGGCGGAGATTATTGAATTCC CAGCTGTCCTGGTCAACGTTAAGACAGGCAAAATTGAGGCCGAATTCCAC AAGTACATCCTGCCCATCGAGTCGCCCCGCCTGAGTGCCTACTGTACAGA GCTGACGGGCATCCAGCAGAAGACGGTGGACAGCGGAGTGCCACTGCAGA CGGCGCTAATGATGTTCCACGAGTGGCTGCGCAAGGAGCTGCGTGCCCGC AACCTGACCTTGCCGAAGATGAACAAGTCAAACATATTAGGGAACTGCGC CTTCGCCACCTGGACGGACTGGGACTTTGGGATCTGCCTGGCGAAGGAGT GCACCCGCAAGCGGATGCGTAAGGGAGCCTACTTCAATCAATGGATCGAT GTGAGGGCAGTGTATAGGTCGTGGTACAAGTACAAGCCGTGCAACTTCAC CGACGCCCTGTCGCACGTGGGCCTGGCGTTCGAGGGAAGGGCTCACTCCG GTATCGACGATGCCAAGAACCTGGGCGCCCTCATTTGCAAAATGGTGCGC GACGGAGCGCTCTTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT CAATCCCAACTGCGTGTTG >D_eugracilis_Snp-PG ATGCAACCATACTCCTATGTGATTGCCGTGGATTTTGAGGCCACCTGCTG GGAGAAGCAGGCTCCACCACAGTGGCGAGAAGCGGAGATTATTGAATTCC CAGCAGTGCTTGTCAACCTGAATACAGGCAAGATCGAGGCGGAGTTCCAC AAGTATATCCTGCCCATCGAGTCGCCACGCTTAAGTACCTACTGTACGGA GCTGACAGGCATCCAACAGAAGACTGTTGACAGCGGAGTGCCACTGCAGA CGGCGCTGATGATGTTCCATGAGTGGCTGCGTAAGGAGCTGCGCGCCCGC AACCTAGTCTTGCCGAAGATGAGCAAGTCAAACATACTTGGCAACGTCGC CTTCGTCACCTGGACAGACTGGGACTTTGGCATCTGCTTGGCGAAGGAGT GCACTCGGAAGCGGATGCGCAAGGCAGCCTACTTCAATCAGTGGATTGAT GTACGTGCGATTTATCGATCGTGGTACAAGTACCGCCCGTGTAATTTCAG CGATGCCCTGTCCCATGTAGGACTGGCCTTCGAGGGCAGGGCTCATTCCG GGATTGACGATGCCAAGAACCTGGGCGCCCTCATGTGCAAAATGGTGCGT GATGGAGCGCTCTTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT CAATCCCAACTGCGTGTTG >D_ficusphila_Snp-PG ATGCAGCCCTATTCGTATGTGATCGCTGTGGACTTTGAGGCAACCTGCTG GGAGAAACAGGCGCCACCGCAATGGCGAGAAGCGGAGATCATTGAATTTC CAGCCGTGCTGGTCAACCTGAAGACTGGCAAGATCGAGGCCGAGTTTCAC AAGTATATCCTGCCCGTTGAGTCGCCGCGCTTGAGTAGCTACTGTACGGA ACTGACTGGCATCCAGCAGAAGACTGTGGACAGCGGAATGCCGCTGCAGA CGGCGATGATGATGTTCCACGAGTGGCTGCGCAAGGAGCTGCGCGCCCGC AACCTCACCTTGCCGAAGATGAACAAGTCGAATATACTGGGCAACTGCGC CTTTGTCACCTGGACGGACTGGGACTTTGGCATCTGCTTGGCGAAAGAGT GCACACGCAAACGGATGCGCAAGGCGGCCTACTTCAATCAGTGGATCGAC GTGCGGGCCATTTATTGGTCGTGGTACAAGTACCGTCCGTGCAACTTCAG CGATGCCCTGTCGCACGTTGGATTGAGCTTCGAGGGCAGGGCTCACTCCG GGATCGACGATGCCAAGAACCTGGGCGCCCTCATGTGCAAGATGGTGCGC GACGGAGCGCTCTTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT CAATCCCAACTGCGGATTG >D_rhopaloa_Snp-PG ATGCAGCCCTACACATATGTGATTTCCGTGGACTTTGAGGCCACCTGCTG GGAAAAGCAGGCGCCACCGCAGTGGCGAGAAGCGGAGATAATTGAATTCC CAGCCGTGCTGGTCAACCTGAAGACGGGCAAGATCGAGGCGGAGTTTCAC CAATATATACTGCCCATCGAGTCACCACGCTTGAGTAGCTACTGTACGGA GCTGACGGGCATCCAGCAGAAGACTGTGGACAGCGGAGTGCCGCTGCAGA CGGCGCTGATGATGTTCCACGAGTGGCTGCGCAAGGAGCTCCGCGCCCGC AACCTCACCTTGCCGAAGATGAGCAAATCGAACATACTGGGCAACTGCGC CTTCGTCACCTGGACAGACTGGGACTTTGGCATCTGCTTGGCGAAGGAGT GCACTCGCAAGCGAATGCGCAAAGCGGCCTACTTCAACCAGTGGATCGAC GTGCGGGCCATCTATCGGTCGTGGTACAAGTACCGCCCGTGCAACTTCAG CGATGCCCTGTCGCACGTGGGGCTGGCCTTTGAGGGCAGGGCTCATTCCG GGATCGATGATGCGAAGAACCTGGGCGCTCTCATGTGCAAGATGGTGCGC GATGGAGCGCTCTTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT CAATCCCAACTGCGTGTTG >D_elegans_Snp-PG ATGCAGCCCTACACGTATGTGATTGCCGTGGACTTTGAGGCCACTTGCTG GGAGAAGCAGGCGCCCCCGCAGTGGCGAGAAGCGGAGATTATTGAATTCC CAGCCGTGCTGGTCAACCTGAAGACGGGCAAGATCGAGGCGGAGTTCCAC CAGTACATACTGCCCATCGAGTCGCCACGCTTGAGTAGCTACTGCACGGA GCTGACGGGCATCCAGCAGAAGACTGTGGACAGCGGAGTGCCGCTGCAGA CGGCACTGATGATGTTCCACGAGTGGCTGCGCAAGGAGCTGCGAGCCCGC AACCTCACGTTGCCGAAGATGAGCAAGTCGAACATACTGGGCAACTGCGC CTTCGTCACCTGGACGGACTGGGACTTTGGCATCTGCTTGGCGAAGGAGT GCACCCGCAAGCGGATGAGGAAGGCGGCCTACTTCAACCAGTGGATCGAT GTGCGGGCCATCTATCGGTCGTGGTACAAGTACCGCCCGTGCAACTTCAG CGACGCCCTGTCGCACGTGGGACTGGCCTTCGAGGGCAGGGCCCACTCGG GGATCGACGATGCCAAGAACCTGGGCGCCCTCATGTGCAAGATGGTGCGC GACGGAGCTCTGTTCTCGATCACCAAAGATCTGACGCCATATCAGCAGCT CAATCCCAACTGCGTGTTG
>D_melanogaster_Snp-PG MQPYSYVIAVDFEATCWEKQAPPEWREAEIIEFPAVLVNLKTGKIEAEFH QYILPFESPRLSAYCTELTGIQQKTVDSGMPLRTAIVMFNEWLRNEMRAR NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECSRKGIRKPAYFNQWID VRAIYRSWYKYRPCNFTDALSHVGLAFEGKAHSGIDDAKNLGALMCKMVR DGALFSITKDLTPYQQLNPRFVL >D_sechellia_Snp-PG MQPYSYVIAVDFEATCWENQAPPHWREAEIIEFPAVLVNLKTGKIEAEFH QYILPIESPRLSTYCTELTGIQQKTVDSGIPLQTAMVMFHEWLRNEMRAR NLTLPKTNKSNILGNCAFVTWTDWDFGICLAKECNRKGIRKAAYFNQWID VRAIYRSWYKYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMMR DGALFSITKDLTPYQQLNPNIAL >D_simulans_Snp-PG MQPYSYVIAVDFEATCWENQAPPHWREAEIIEFPAVLVNLKTGKIESEFH QYILPIESPRLSTYCTELTGIQQKTVDSGIPLTTAIVMFNEWLRHEIRTR NLTLPKMNKSNVLGNCAFVTWTDWDFGICLAKECNRKGIRKPAYFNQWID VRAIYRSWYKYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMMR DGALFSITKDLTPYQQLNPNFSL >D_yakuba_Snp-PG MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH KYILPFESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID VRAIYRSWYQYRPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR DGALFSITKDLTPYQQLNPNCVL >D_erecta_Snp-PG MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH KYILPIESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR NLTLPKMNKSNIMGNCAFVTWTDWDFGICLSKECTRKRMRKAAYFNQWID VRAVYRSWYQYRPCNFTDALEHVGLAFEGRAHSGIDDAKNLGALMCKMVR DGALFSITKDLTPYQQLNPNCVL >D_takahashii_Snp-PG MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNVKTGKIEAEFH KYILPIESPRLSAYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR NLTLPKMNKSNILGNCAFATWTDWDFGICLAKECTRKRMRKGAYFNQWID VRAVYRSWYKYKPCNFTDALSHVGLAFEGRAHSGIDDAKNLGALICKMVR DGALFSITKDLTPYQQLNPNCVL >D_eugracilis_Snp-PG MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLNTGKIEAEFH KYILPIESPRLSTYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR NLVLPKMSKSNILGNVAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR DGALFSITKDLTPYQQLNPNCVL >D_ficusphila_Snp-PG MQPYSYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH KYILPVESPRLSSYCTELTGIQQKTVDSGMPLQTAMMMFHEWLRKELRAR NLTLPKMNKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID VRAIYWSWYKYRPCNFSDALSHVGLSFEGRAHSGIDDAKNLGALMCKMVR DGALFSITKDLTPYQQLNPNCGL >D_rhopaloa_Snp-PG MQPYTYVISVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH QYILPIESPRLSSYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR NLTLPKMSKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR DGALFSITKDLTPYQQLNPNCVL >D_elegans_Snp-PG MQPYTYVIAVDFEATCWEKQAPPQWREAEIIEFPAVLVNLKTGKIEAEFH QYILPIESPRLSSYCTELTGIQQKTVDSGVPLQTALMMFHEWLRKELRAR NLTLPKMSKSNILGNCAFVTWTDWDFGICLAKECTRKRMRKAAYFNQWID VRAIYRSWYKYRPCNFSDALSHVGLAFEGRAHSGIDDAKNLGALMCKMVR DGALFSITKDLTPYQQLNPNCVL
#NEXUS
[ID: 1335819125]
begin taxa;
dimensions ntax=10;
taxlabels
D_melanogaster_Snp-PG
D_sechellia_Snp-PG
D_simulans_Snp-PG
D_yakuba_Snp-PG
D_erecta_Snp-PG
D_takahashii_Snp-PG
D_eugracilis_Snp-PG
D_ficusphila_Snp-PG
D_rhopaloa_Snp-PG
D_elegans_Snp-PG
;
end;
begin trees;
translate
1 D_melanogaster_Snp-PG,
2 D_sechellia_Snp-PG,
3 D_simulans_Snp-PG,
4 D_yakuba_Snp-PG,
5 D_erecta_Snp-PG,
6 D_takahashii_Snp-PG,
7 D_eugracilis_Snp-PG,
8 D_ficusphila_Snp-PG,
9 D_rhopaloa_Snp-PG,
10 D_elegans_Snp-PG
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0569354,((4:0.02076345,5:0.06956502)0.638:0.01365798,((6:0.1718178,(8:0.09044633,(9:0.05528809,10:0.0480139)0.948:0.01623061)0.556:0.011699)0.595:0.01395122,7:0.1217866)1.000:0.063801)1.000:0.09378705,(2:0.02649207,3:0.03641146)0.998:0.03079808);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0569354,((4:0.02076345,5:0.06956502):0.01365798,((6:0.1718178,(8:0.09044633,(9:0.05528809,10:0.0480139):0.01623061):0.011699):0.01395122,7:0.1217866):0.063801):0.09378705,(2:0.02649207,3:0.03641146):0.03079808);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2459.47 -2472.90
2 -2459.62 -2478.33
--------------------------------------
TOTAL -2459.54 -2477.64
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/398/Snp-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.963388 0.009720 0.787559 1.161425 0.958353 1347.98 1414.00 1.000
r(A<->C){all} 0.115419 0.000552 0.072784 0.162498 0.113530 984.13 998.77 1.000
r(A<->G){all} 0.256849 0.001367 0.183967 0.327682 0.256045 744.41 783.71 1.000
r(A<->T){all} 0.103790 0.001050 0.044508 0.168039 0.102144 693.30 739.19 1.000
r(C<->G){all} 0.053756 0.000169 0.029781 0.080154 0.052941 1060.13 1133.34 1.000
r(C<->T){all} 0.351131 0.001884 0.264480 0.431829 0.350429 550.13 681.33 1.000
r(G<->T){all} 0.119055 0.000603 0.071022 0.164801 0.118510 891.44 984.00 1.000
pi(A){all} 0.233629 0.000246 0.201508 0.263316 0.232983 898.07 1022.71 1.000
pi(C){all} 0.287858 0.000295 0.255101 0.320856 0.287342 1088.96 1182.47 1.000
pi(G){all} 0.295100 0.000265 0.265512 0.327326 0.295080 1191.07 1226.48 1.000
pi(T){all} 0.183414 0.000208 0.155771 0.210337 0.183008 1072.52 1092.26 1.000
alpha{1,2} 0.165480 0.000828 0.111057 0.220057 0.162381 1305.87 1332.15 1.000
alpha{3} 2.392486 0.609610 1.117551 3.998864 2.277428 1393.41 1401.77 1.000
pinvar{all} 0.255745 0.005058 0.110622 0.379742 0.261562 1176.26 1289.74 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/398/Snp-PG/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 10 ls = 223
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 4 3 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 3 3 4 5 4 | Cys TGT 1 2 1 2 2 1
TTC 9 7 8 7 7 8 | TCC 0 1 1 1 2 1 | TAC 6 6 6 5 4 5 | TGC 6 5 6 6 6 7
Leu TTA 0 0 0 0 0 1 | TCA 2 1 1 0 0 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 5 6 2 | TCG 5 5 7 5 5 4 | TAG 0 0 0 0 0 0 | Trp TGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 5 3 2 1 3 0 | Pro CCT 0 0 0 0 0 0 | His CAT 0 2 2 0 0 0 | Arg CGT 1 0 0 2 1 2
CTC 1 4 4 4 3 3 | CCC 4 4 4 4 5 4 | CAC 3 3 3 4 4 4 | CGC 6 6 6 5 7 5
CTA 1 1 1 2 2 1 | CCA 3 4 4 4 4 4 | Gln CAA 1 0 0 1 1 2 | CGA 2 1 1 2 0 1
CTG 8 7 8 9 6 13 | CCG 5 3 4 3 2 3 | CAG 7 9 8 9 9 7 | CGG 3 3 2 3 4 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 4 2 4 5 | Thr ACT 1 1 1 2 1 0 | Asn AAT 4 5 4 3 3 2 | Ser AGT 0 0 0 0 0 1
ATC 8 8 8 9 6 7 | ACC 4 5 6 7 6 6 | AAC 7 8 9 7 7 8 | AGC 3 2 2 2 2 1
ATA 3 5 4 1 2 1 | ACA 1 1 1 1 2 3 | Lys AAA 2 3 2 1 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 7 7 6 7 8 6 | ACG 6 7 7 5 5 5 | AAG 12 9 10 13 11 13 | AGG 1 2 3 1 1 3
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 0 1 | Ala GCT 1 0 2 0 1 2 | Asp GAT 3 3 4 4 2 4 | Gly GGT 1 2 2 0 1 1
GTC 1 1 1 1 2 2 | GCC 8 8 8 9 9 10 | GAC 7 7 6 6 8 6 | GGC 5 4 4 6 6 4
GTA 0 0 1 0 0 1 | GCA 5 5 3 4 5 2 | Glu GAA 5 3 3 3 0 2 | GGA 2 2 2 2 2 4
GTG 9 7 7 9 10 8 | GCG 5 7 3 6 3 6 | GAG 9 10 10 10 14 11 | GGG 3 3 3 2 1 2
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------------
Phe TTT 2 5 4 2 | Ser TCT 0 0 0 0 | Tyr TAT 4 5 4 3 | Cys TGT 2 1 1 0
TTC 8 5 6 8 | TCC 3 1 2 0 | TAC 5 4 5 6 | TGC 5 7 7 8
Leu TTA 1 0 0 0 | TCA 1 0 1 0 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 3 5 4 4 | TCG 3 6 4 6 | TAG 0 0 0 0 | Trp TGG 7 8 7 7
------------------------------------------------------------------------------------------------------
Leu CTT 2 0 0 0 | Pro CCT 0 0 0 0 | His CAT 3 0 1 0 | Arg CGT 3 1 0 0
CTC 3 4 5 3 | CCC 2 3 3 4 | CAC 1 4 3 4 | CGC 5 7 8 6
CTA 1 0 0 0 | CCA 7 3 4 3 | Gln CAA 2 1 1 0 | CGA 2 1 2 2
CTG 11 11 12 14 | CCG 2 5 4 4 | CAG 7 8 9 10 | CGG 2 2 2 3
------------------------------------------------------------------------------------------------------
Ile ATT 6 2 2 3 | Thr ACT 2 3 2 2 | Asn AAT 4 3 1 1 | Ser AGT 1 1 1 1
ATC 6 9 8 8 | ACC 4 4 4 3 | AAC 6 7 8 8 | AGC 3 4 4 4
ATA 1 1 3 2 | ACA 3 1 2 0 | Lys AAA 2 4 3 1 | Arg AGA 0 0 0 0
Met ATG 7 9 7 7 | ACG 3 4 5 8 | AAG 12 11 11 13 | AGG 1 1 1 2
------------------------------------------------------------------------------------------------------
Val GTT 1 2 0 0 | Ala GCT 2 2 2 1 | Asp GAT 6 3 5 3 | Gly GGT 0 0 0 0
GTC 4 2 2 2 | GCC 9 9 8 12 | GAC 4 7 5 7 | GGC 6 6 6 6
GTA 2 0 0 0 | GCA 2 1 0 1 | Glu GAA 2 3 3 2 | GGA 3 4 2 3
GTG 6 6 9 9 | GCG 6 6 8 5 | GAG 11 10 10 11 | GGG 1 1 2 1
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Snp-PG
position 1: T:0.20628 C:0.22422 A:0.27803 G:0.29148
position 2: T:0.28251 C:0.22422 A:0.30942 G:0.18386
position 3: T:0.12108 C:0.34978 A:0.12108 G:0.40807
Average T:0.20329 C:0.26607 A:0.23617 G:0.29447
#2: D_sechellia_Snp-PG
position 1: T:0.19731 C:0.22422 A:0.29596 G:0.28251
position 2: T:0.27354 C:0.23318 A:0.31839 G:0.17489
position 3: T:0.12556 C:0.35426 A:0.11659 G:0.40359
Average T:0.19880 C:0.27055 A:0.24365 G:0.28700
#3: D_simulans_Snp-PG
position 1: T:0.21076 C:0.21973 A:0.30045 G:0.26906
position 2: T:0.27803 C:0.23318 A:0.31390 G:0.17489
position 3: T:0.13004 C:0.36771 A:0.10314 G:0.39910
Average T:0.20628 C:0.27354 A:0.23916 G:0.28102
#4: D_yakuba_Snp-PG
position 1: T:0.20628 C:0.23767 A:0.27354 G:0.28251
position 2: T:0.27803 C:0.22870 A:0.31390 G:0.17937
position 3: T:0.11211 C:0.37220 A:0.09417 G:0.42152
Average T:0.19880 C:0.27952 A:0.22720 G:0.29447
#5: D_erecta_Snp-PG
position 1: T:0.21076 C:0.22870 A:0.27354 G:0.28700
position 2: T:0.27803 C:0.22422 A:0.31839 G:0.17937
position 3: T:0.11659 C:0.37668 A:0.09417 G:0.41256
Average T:0.20179 C:0.27653 A:0.22870 G:0.29297
#6: D_takahashii_Snp-PG
position 1: T:0.19283 C:0.22422 A:0.28700 G:0.29596
position 2: T:0.27354 C:0.22870 A:0.31839 G:0.17937
position 3: T:0.11211 C:0.36323 A:0.11659 G:0.40807
Average T:0.19283 C:0.27205 A:0.24066 G:0.29447
#7: D_eugracilis_Snp-PG
position 1: T:0.19731 C:0.23767 A:0.27354 G:0.29148
position 2: T:0.28700 C:0.21973 A:0.30942 G:0.18386
position 3: T:0.17040 C:0.33184 A:0.13004 G:0.36771
Average T:0.21824 C:0.26308 A:0.23767 G:0.28102
#8: D_ficusphila_Snp-PG
position 1: T:0.21076 C:0.22422 A:0.28700 G:0.27803
position 2: T:0.27354 C:0.21525 A:0.31390 G:0.19731
position 3: T:0.12556 C:0.37220 A:0.08520 G:0.41704
Average T:0.20329 C:0.27055 A:0.22870 G:0.29746
#9: D_rhopaloa_Snp-PG
position 1: T:0.20179 C:0.24215 A:0.27803 G:0.27803
position 2: T:0.27803 C:0.21973 A:0.30942 G:0.19283
position 3: T:0.10314 C:0.37668 A:0.09417 G:0.42601
Average T:0.19432 C:0.27952 A:0.22720 G:0.29895
#10: D_elegans_Snp-PG
position 1: T:0.19731 C:0.23767 A:0.28251 G:0.28251
position 2: T:0.27803 C:0.21973 A:0.30942 G:0.19283
position 3: T:0.07175 C:0.39910 A:0.06278 G:0.46637
Average T:0.18236 C:0.28550 A:0.21824 G:0.31390
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 31 | Ser S TCT 0 | Tyr Y TAT 38 | Cys C TGT 13
TTC 73 | TCC 12 | TAC 52 | TGC 63
Leu L TTA 2 | TCA 7 | *** * TAA 0 | *** * TGA 0
TTG 41 | TCG 50 | TAG 0 | Trp W TGG 71
------------------------------------------------------------------------------
Leu L CTT 16 | Pro P CCT 0 | His H CAT 8 | Arg R CGT 10
CTC 34 | CCC 37 | CAC 33 | CGC 61
CTA 9 | CCA 40 | Gln Q CAA 9 | CGA 14
CTG 99 | CCG 35 | CAG 83 | CGG 25
------------------------------------------------------------------------------
Ile I ATT 34 | Thr T ACT 15 | Asn N AAT 30 | Ser S AGT 5
ATC 77 | ACC 49 | AAC 75 | AGC 27
ATA 23 | ACA 15 | Lys K AAA 24 | Arg R AGA 0
Met M ATG 71 | ACG 55 | AAG 115 | AGG 16
------------------------------------------------------------------------------
Val V GTT 8 | Ala A GCT 13 | Asp D GAT 37 | Gly G GGT 7
GTC 18 | GCC 90 | GAC 63 | GGC 53
GTA 4 | GCA 28 | Glu E GAA 26 | GGA 26
GTG 80 | GCG 55 | GAG 106 | GGG 19
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.20314 C:0.23004 A:0.28296 G:0.28386
position 2: T:0.27803 C:0.22466 A:0.31345 G:0.18386
position 3: T:0.11883 C:0.36637 A:0.10179 G:0.41300
Average T:0.20000 C:0.27369 A:0.23274 G:0.29357
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Snp-PG
D_sechellia_Snp-PG 0.2237 (0.0357 0.1596)
D_simulans_Snp-PG 0.2775 (0.0409 0.1472) 0.3736 (0.0256 0.0685)
D_yakuba_Snp-PG 0.1528 (0.0399 0.2611) 0.1465 (0.0398 0.2719) 0.1937 (0.0543 0.2804)
D_erecta_Snp-PG 0.1523 (0.0521 0.3424) 0.1426 (0.0469 0.3290) 0.1875 (0.0615 0.3279) 0.0781 (0.0147 0.1881)
D_takahashii_Snp-PG 0.0842 (0.0544 0.6466) 0.0815 (0.0543 0.6671) 0.1125 (0.0713 0.6336) 0.0390 (0.0217 0.5573) 0.0445 (0.0277 0.6223)
D_eugracilis_Snp-PG 0.0881 (0.0544 0.6173) 0.0826 (0.0502 0.6071) 0.1171 (0.0691 0.5904) 0.0400 (0.0197 0.4930) 0.0455 (0.0277 0.6082) 0.0666 (0.0379 0.5693)
D_ficusphila_Snp-PG 0.1032 (0.0506 0.4910) 0.0947 (0.0444 0.4691) 0.1429 (0.0642 0.4492) 0.0647 (0.0226 0.3492) 0.0688 (0.0305 0.4435) 0.0779 (0.0394 0.5059) 0.0508 (0.0276 0.5439)
D_rhopaloa_Snp-PG 0.0999 (0.0491 0.4919) 0.0888 (0.0429 0.4826) 0.1238 (0.0595 0.4809) 0.0342 (0.0137 0.4017) 0.0447 (0.0236 0.5284) 0.0484 (0.0277 0.5729) 0.0397 (0.0177 0.4461) 0.0625 (0.0216 0.3450)
D_elegans_Snp-PG 0.1231 (0.0481 0.3910) 0.1035 (0.0419 0.4046) 0.1504 (0.0606 0.4032) 0.0396 (0.0137 0.3472) 0.0538 (0.0236 0.4396) 0.0625 (0.0278 0.4441) 0.0387 (0.0181 0.4663) 0.0647 (0.0216 0.3336) 0.0155 (0.0039 0.2516)
Model 0: one-ratio
TREE # 1: (1, ((4, 5), ((6, (8, (9, 10))), 7)), (2, 3)); MP score: 287
lnL(ntime: 17 np: 19): -2324.298065 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..15 15..6 15..16 16..8 16..17 17..9 17..10 14..7 11..18 18..2 18..3
0.099440 0.155066 0.021522 0.046973 0.123117 0.097195 0.021520 0.291387 0.023003 0.165205 0.041015 0.099325 0.086501 0.204681 0.059029 0.046946 0.067999 2.029581 0.058296
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.64992
(1: 0.099440, ((4: 0.046973, 5: 0.123117): 0.021522, ((6: 0.291387, (8: 0.165205, (9: 0.099325, 10: 0.086501): 0.041015): 0.023003): 0.021520, 7: 0.204681): 0.097195): 0.155066, (2: 0.046946, 3: 0.067999): 0.059029);
(D_melanogaster_Snp-PG: 0.099440, ((D_yakuba_Snp-PG: 0.046973, D_erecta_Snp-PG: 0.123117): 0.021522, ((D_takahashii_Snp-PG: 0.291387, (D_ficusphila_Snp-PG: 0.165205, (D_rhopaloa_Snp-PG: 0.099325, D_elegans_Snp-PG: 0.086501): 0.041015): 0.023003): 0.021520, D_eugracilis_Snp-PG: 0.204681): 0.097195): 0.155066, (D_sechellia_Snp-PG: 0.046946, D_simulans_Snp-PG: 0.067999): 0.059029);
Detailed output identifying parameters
kappa (ts/tv) = 2.02958
omega (dN/dS) = 0.05830
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.099 545.2 123.8 0.0583 0.0083 0.1425 4.5 17.6
11..12 0.155 545.2 123.8 0.0583 0.0130 0.2222 7.1 27.5
12..13 0.022 545.2 123.8 0.0583 0.0018 0.0308 1.0 3.8
13..4 0.047 545.2 123.8 0.0583 0.0039 0.0673 2.1 8.3
13..5 0.123 545.2 123.8 0.0583 0.0103 0.1764 5.6 21.8
12..14 0.097 545.2 123.8 0.0583 0.0081 0.1393 4.4 17.2
14..15 0.022 545.2 123.8 0.0583 0.0018 0.0308 1.0 3.8
15..6 0.291 545.2 123.8 0.0583 0.0243 0.4175 13.3 51.7
15..16 0.023 545.2 123.8 0.0583 0.0019 0.0330 1.0 4.1
16..8 0.165 545.2 123.8 0.0583 0.0138 0.2367 7.5 29.3
16..17 0.041 545.2 123.8 0.0583 0.0034 0.0588 1.9 7.3
17..9 0.099 545.2 123.8 0.0583 0.0083 0.1423 4.5 17.6
17..10 0.087 545.2 123.8 0.0583 0.0072 0.1240 3.9 15.4
14..7 0.205 545.2 123.8 0.0583 0.0171 0.2933 9.3 36.3
11..18 0.059 545.2 123.8 0.0583 0.0049 0.0846 2.7 10.5
18..2 0.047 545.2 123.8 0.0583 0.0039 0.0673 2.1 8.3
18..3 0.068 545.2 123.8 0.0583 0.0057 0.0974 3.1 12.1
tree length for dN: 0.1378
tree length for dS: 2.3642
Time used: 0:13
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, ((4, 5), ((6, (8, (9, 10))), 7)), (2, 3)); MP score: 287
lnL(ntime: 17 np: 20): -2317.261831 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..15 15..6 15..16 16..8 16..17 17..9 17..10 14..7 11..18 18..2 18..3
0.103122 0.159569 0.025984 0.046405 0.127660 0.097759 0.022600 0.293683 0.021346 0.170612 0.039761 0.097383 0.086551 0.206994 0.057521 0.045397 0.070563 2.162616 0.936692 0.037385
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.67291
(1: 0.103122, ((4: 0.046405, 5: 0.127660): 0.025984, ((6: 0.293683, (8: 0.170612, (9: 0.097383, 10: 0.086551): 0.039761): 0.021346): 0.022600, 7: 0.206994): 0.097759): 0.159569, (2: 0.045397, 3: 0.070563): 0.057521);
(D_melanogaster_Snp-PG: 0.103122, ((D_yakuba_Snp-PG: 0.046405, D_erecta_Snp-PG: 0.127660): 0.025984, ((D_takahashii_Snp-PG: 0.293683, (D_ficusphila_Snp-PG: 0.170612, (D_rhopaloa_Snp-PG: 0.097383, D_elegans_Snp-PG: 0.086551): 0.039761): 0.021346): 0.022600, D_eugracilis_Snp-PG: 0.206994): 0.097759): 0.159569, (D_sechellia_Snp-PG: 0.045397, D_simulans_Snp-PG: 0.070563): 0.057521);
Detailed output identifying parameters
kappa (ts/tv) = 2.16262
dN/dS (w) for site classes (K=2)
p: 0.93669 0.06331
w: 0.03738 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.103 544.2 124.8 0.0983 0.0127 0.1290 6.9 16.1
11..12 0.160 544.2 124.8 0.0983 0.0196 0.1995 10.7 24.9
12..13 0.026 544.2 124.8 0.0983 0.0032 0.0325 1.7 4.1
13..4 0.046 544.2 124.8 0.0983 0.0057 0.0580 3.1 7.2
13..5 0.128 544.2 124.8 0.0983 0.0157 0.1596 8.5 19.9
12..14 0.098 544.2 124.8 0.0983 0.0120 0.1223 6.5 15.3
14..15 0.023 544.2 124.8 0.0983 0.0028 0.0283 1.5 3.5
15..6 0.294 544.2 124.8 0.0983 0.0361 0.3673 19.7 45.8
15..16 0.021 544.2 124.8 0.0983 0.0026 0.0267 1.4 3.3
16..8 0.171 544.2 124.8 0.0983 0.0210 0.2134 11.4 26.6
16..17 0.040 544.2 124.8 0.0983 0.0049 0.0497 2.7 6.2
17..9 0.097 544.2 124.8 0.0983 0.0120 0.1218 6.5 15.2
17..10 0.087 544.2 124.8 0.0983 0.0106 0.1082 5.8 13.5
14..7 0.207 544.2 124.8 0.0983 0.0255 0.2589 13.9 32.3
11..18 0.058 544.2 124.8 0.0983 0.0071 0.0719 3.8 9.0
18..2 0.045 544.2 124.8 0.0983 0.0056 0.0568 3.0 7.1
18..3 0.071 544.2 124.8 0.0983 0.0087 0.0882 4.7 11.0
Time used: 0:31
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, ((4, 5), ((6, (8, (9, 10))), 7)), (2, 3)); MP score: 287
lnL(ntime: 17 np: 22): -2317.261832 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..15 15..6 15..16 16..8 16..17 17..9 17..10 14..7 11..18 18..2 18..3
0.103122 0.159569 0.025984 0.046405 0.127660 0.097759 0.022600 0.293682 0.021346 0.170612 0.039761 0.097383 0.086551 0.206994 0.057521 0.045397 0.070563 2.162620 0.936692 0.063308 0.037385 29.595844
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.67291
(1: 0.103122, ((4: 0.046405, 5: 0.127660): 0.025984, ((6: 0.293682, (8: 0.170612, (9: 0.097383, 10: 0.086551): 0.039761): 0.021346): 0.022600, 7: 0.206994): 0.097759): 0.159569, (2: 0.045397, 3: 0.070563): 0.057521);
(D_melanogaster_Snp-PG: 0.103122, ((D_yakuba_Snp-PG: 0.046405, D_erecta_Snp-PG: 0.127660): 0.025984, ((D_takahashii_Snp-PG: 0.293682, (D_ficusphila_Snp-PG: 0.170612, (D_rhopaloa_Snp-PG: 0.097383, D_elegans_Snp-PG: 0.086551): 0.039761): 0.021346): 0.022600, D_eugracilis_Snp-PG: 0.206994): 0.097759): 0.159569, (D_sechellia_Snp-PG: 0.045397, D_simulans_Snp-PG: 0.070563): 0.057521);
Detailed output identifying parameters
kappa (ts/tv) = 2.16262
dN/dS (w) for site classes (K=3)
p: 0.93669 0.06331 0.00000
w: 0.03738 1.00000 29.59584
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.103 544.2 124.8 0.0983 0.0127 0.1290 6.9 16.1
11..12 0.160 544.2 124.8 0.0983 0.0196 0.1995 10.7 24.9
12..13 0.026 544.2 124.8 0.0983 0.0032 0.0325 1.7 4.1
13..4 0.046 544.2 124.8 0.0983 0.0057 0.0580 3.1 7.2
13..5 0.128 544.2 124.8 0.0983 0.0157 0.1596 8.5 19.9
12..14 0.098 544.2 124.8 0.0983 0.0120 0.1223 6.5 15.3
14..15 0.023 544.2 124.8 0.0983 0.0028 0.0283 1.5 3.5
15..6 0.294 544.2 124.8 0.0983 0.0361 0.3673 19.7 45.8
15..16 0.021 544.2 124.8 0.0983 0.0026 0.0267 1.4 3.3
16..8 0.171 544.2 124.8 0.0983 0.0210 0.2134 11.4 26.6
16..17 0.040 544.2 124.8 0.0983 0.0049 0.0497 2.7 6.2
17..9 0.097 544.2 124.8 0.0983 0.0120 0.1218 6.5 15.2
17..10 0.087 544.2 124.8 0.0983 0.0106 0.1082 5.8 13.5
14..7 0.207 544.2 124.8 0.0983 0.0255 0.2589 13.9 32.3
11..18 0.058 544.2 124.8 0.0983 0.0071 0.0719 3.8 9.0
18..2 0.045 544.2 124.8 0.0983 0.0056 0.0568 3.0 7.1
18..3 0.071 544.2 124.8 0.0983 0.0087 0.0882 4.7 11.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Snp-PG)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.819 0.047 0.022 0.018 0.016 0.016 0.016 0.016 0.016 0.016
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.999
sum of density on p0-p1 = 1.000000
Time used: 1:18
Model 3: discrete (3 categories)
TREE # 1: (1, ((4, 5), ((6, (8, (9, 10))), 7)), (2, 3)); MP score: 287
lnL(ntime: 17 np: 23): -2300.050517 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..15 15..6 15..16 16..8 16..17 17..9 17..10 14..7 11..18 18..2 18..3
0.101404 0.157272 0.022152 0.046708 0.124514 0.098867 0.021546 0.294028 0.022943 0.167910 0.038784 0.099121 0.086530 0.202774 0.058380 0.046130 0.069434 2.008899 0.253483 0.502288 0.004087 0.004089 0.238207
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.65850
(1: 0.101404, ((4: 0.046708, 5: 0.124514): 0.022152, ((6: 0.294028, (8: 0.167910, (9: 0.099121, 10: 0.086530): 0.038784): 0.022943): 0.021546, 7: 0.202774): 0.098867): 0.157272, (2: 0.046130, 3: 0.069434): 0.058380);
(D_melanogaster_Snp-PG: 0.101404, ((D_yakuba_Snp-PG: 0.046708, D_erecta_Snp-PG: 0.124514): 0.022152, ((D_takahashii_Snp-PG: 0.294028, (D_ficusphila_Snp-PG: 0.167910, (D_rhopaloa_Snp-PG: 0.099121, D_elegans_Snp-PG: 0.086530): 0.038784): 0.022943): 0.021546, D_eugracilis_Snp-PG: 0.202774): 0.098867): 0.157272, (D_sechellia_Snp-PG: 0.046130, D_simulans_Snp-PG: 0.069434): 0.058380);
Detailed output identifying parameters
kappa (ts/tv) = 2.00890
dN/dS (w) for site classes (K=3)
p: 0.25348 0.50229 0.24423
w: 0.00409 0.00409 0.23821
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.101 545.3 123.7 0.0613 0.0088 0.1439 4.8 17.8
11..12 0.157 545.3 123.7 0.0613 0.0137 0.2232 7.5 27.6
12..13 0.022 545.3 123.7 0.0613 0.0019 0.0314 1.1 3.9
13..4 0.047 545.3 123.7 0.0613 0.0041 0.0663 2.2 8.2
13..5 0.125 545.3 123.7 0.0613 0.0108 0.1767 5.9 21.9
12..14 0.099 545.3 123.7 0.0613 0.0086 0.1403 4.7 17.4
14..15 0.022 545.3 123.7 0.0613 0.0019 0.0306 1.0 3.8
15..6 0.294 545.3 123.7 0.0613 0.0256 0.4174 13.9 51.6
15..16 0.023 545.3 123.7 0.0613 0.0020 0.0326 1.1 4.0
16..8 0.168 545.3 123.7 0.0613 0.0146 0.2383 8.0 29.5
16..17 0.039 545.3 123.7 0.0613 0.0034 0.0551 1.8 6.8
17..9 0.099 545.3 123.7 0.0613 0.0086 0.1407 4.7 17.4
17..10 0.087 545.3 123.7 0.0613 0.0075 0.1228 4.1 15.2
14..7 0.203 545.3 123.7 0.0613 0.0176 0.2878 9.6 35.6
11..18 0.058 545.3 123.7 0.0613 0.0051 0.0829 2.8 10.3
18..2 0.046 545.3 123.7 0.0613 0.0040 0.0655 2.2 8.1
18..3 0.069 545.3 123.7 0.0613 0.0060 0.0986 3.3 12.2
Naive Empirical Bayes (NEB) analysis
Time used: 1:51
Model 7: beta (10 categories)
TREE # 1: (1, ((4, 5), ((6, (8, (9, 10))), 7)), (2, 3)); MP score: 287
lnL(ntime: 17 np: 20): -2300.962239 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..15 15..6 15..16 16..8 16..17 17..9 17..10 14..7 11..18 18..2 18..3
0.101197 0.156829 0.022846 0.046337 0.124537 0.098226 0.021487 0.293305 0.022728 0.167786 0.038683 0.098560 0.086378 0.202517 0.058106 0.045644 0.069364 2.020440 0.172088 2.434764
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.65453
(1: 0.101197, ((4: 0.046337, 5: 0.124537): 0.022846, ((6: 0.293305, (8: 0.167786, (9: 0.098560, 10: 0.086378): 0.038683): 0.022728): 0.021487, 7: 0.202517): 0.098226): 0.156829, (2: 0.045644, 3: 0.069364): 0.058106);
(D_melanogaster_Snp-PG: 0.101197, ((D_yakuba_Snp-PG: 0.046337, D_erecta_Snp-PG: 0.124537): 0.022846, ((D_takahashii_Snp-PG: 0.293305, (D_ficusphila_Snp-PG: 0.167786, (D_rhopaloa_Snp-PG: 0.098560, D_elegans_Snp-PG: 0.086378): 0.038683): 0.022728): 0.021487, D_eugracilis_Snp-PG: 0.202517): 0.098226): 0.156829, (D_sechellia_Snp-PG: 0.045644, D_simulans_Snp-PG: 0.069364): 0.058106);
Detailed output identifying parameters
kappa (ts/tv) = 2.02044
Parameters in M7 (beta):
p = 0.17209 q = 2.43476
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00001 0.00010 0.00070 0.00304 0.00984 0.02651 0.06373 0.14577 0.36087
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.101 545.2 123.8 0.0611 0.0088 0.1437 4.8 17.8
11..12 0.157 545.2 123.8 0.0611 0.0136 0.2227 7.4 27.6
12..13 0.023 545.2 123.8 0.0611 0.0020 0.0324 1.1 4.0
13..4 0.046 545.2 123.8 0.0611 0.0040 0.0658 2.2 8.1
13..5 0.125 545.2 123.8 0.0611 0.0108 0.1768 5.9 21.9
12..14 0.098 545.2 123.8 0.0611 0.0085 0.1395 4.6 17.3
14..15 0.021 545.2 123.8 0.0611 0.0019 0.0305 1.0 3.8
15..6 0.293 545.2 123.8 0.0611 0.0254 0.4164 13.9 51.5
15..16 0.023 545.2 123.8 0.0611 0.0020 0.0323 1.1 4.0
16..8 0.168 545.2 123.8 0.0611 0.0145 0.2382 7.9 29.5
16..17 0.039 545.2 123.8 0.0611 0.0034 0.0549 1.8 6.8
17..9 0.099 545.2 123.8 0.0611 0.0085 0.1399 4.7 17.3
17..10 0.086 545.2 123.8 0.0611 0.0075 0.1226 4.1 15.2
14..7 0.203 545.2 123.8 0.0611 0.0176 0.2875 9.6 35.6
11..18 0.058 545.2 123.8 0.0611 0.0050 0.0825 2.7 10.2
18..2 0.046 545.2 123.8 0.0611 0.0040 0.0648 2.2 8.0
18..3 0.069 545.2 123.8 0.0611 0.0060 0.0985 3.3 12.2
Time used: 3:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, ((4, 5), ((6, (8, (9, 10))), 7)), (2, 3)); MP score: 287
lnL(ntime: 17 np: 22): -2300.963136 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..15 15..6 15..16 16..8 16..17 17..9 17..10 14..7 11..18 18..2 18..3
0.101198 0.156831 0.022847 0.046337 0.124539 0.098227 0.021488 0.293309 0.022728 0.167788 0.038683 0.098561 0.086379 0.202521 0.058107 0.045645 0.069365 2.020452 0.999990 0.172091 2.434890 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.65456
(1: 0.101198, ((4: 0.046337, 5: 0.124539): 0.022847, ((6: 0.293309, (8: 0.167788, (9: 0.098561, 10: 0.086379): 0.038683): 0.022728): 0.021488, 7: 0.202521): 0.098227): 0.156831, (2: 0.045645, 3: 0.069365): 0.058107);
(D_melanogaster_Snp-PG: 0.101198, ((D_yakuba_Snp-PG: 0.046337, D_erecta_Snp-PG: 0.124539): 0.022847, ((D_takahashii_Snp-PG: 0.293309, (D_ficusphila_Snp-PG: 0.167788, (D_rhopaloa_Snp-PG: 0.098561, D_elegans_Snp-PG: 0.086379): 0.038683): 0.022728): 0.021488, D_eugracilis_Snp-PG: 0.202521): 0.098227): 0.156831, (D_sechellia_Snp-PG: 0.045645, D_simulans_Snp-PG: 0.069365): 0.058107);
Detailed output identifying parameters
kappa (ts/tv) = 2.02045
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.17209 q = 2.43489
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00001 0.00010 0.00070 0.00304 0.00984 0.02651 0.06373 0.14577 0.36086 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.101 545.2 123.8 0.0611 0.0088 0.1437 4.8 17.8
11..12 0.157 545.2 123.8 0.0611 0.0136 0.2227 7.4 27.6
12..13 0.023 545.2 123.8 0.0611 0.0020 0.0324 1.1 4.0
13..4 0.046 545.2 123.8 0.0611 0.0040 0.0658 2.2 8.1
13..5 0.125 545.2 123.8 0.0611 0.0108 0.1768 5.9 21.9
12..14 0.098 545.2 123.8 0.0611 0.0085 0.1395 4.6 17.3
14..15 0.021 545.2 123.8 0.0611 0.0019 0.0305 1.0 3.8
15..6 0.293 545.2 123.8 0.0611 0.0254 0.4164 13.9 51.5
15..16 0.023 545.2 123.8 0.0611 0.0020 0.0323 1.1 4.0
16..8 0.168 545.2 123.8 0.0611 0.0145 0.2382 7.9 29.5
16..17 0.039 545.2 123.8 0.0611 0.0034 0.0549 1.8 6.8
17..9 0.099 545.2 123.8 0.0611 0.0085 0.1399 4.7 17.3
17..10 0.086 545.2 123.8 0.0611 0.0075 0.1226 4.1 15.2
14..7 0.203 545.2 123.8 0.0611 0.0176 0.2875 9.6 35.6
11..18 0.058 545.2 123.8 0.0611 0.0050 0.0825 2.7 10.2
18..2 0.046 545.2 123.8 0.0611 0.0040 0.0648 2.2 8.0
18..3 0.069 545.2 123.8 0.0611 0.0060 0.0985 3.3 12.2
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Snp-PG)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.007 0.041 0.135 0.301 0.517
ws: 0.578 0.085 0.050 0.043 0.041 0.041 0.040 0.040 0.040 0.040
Time used: 5:57
Model 1: NearlyNeutral -2317.261831 Model 2: PositiveSelection -2317.261832 Model 0: one-ratio -2324.298065 Model 3: discrete -2300.050517 Model 7: beta -2300.962239 Model 8: beta&w>1 -2300.963136 Model 0 vs 1 14.072468000000299 Model 2 vs 1 2.0000006770715117E-6 Model 8 vs 7 0.0017939999997906853
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
