--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Wed Dec 07 00:30:32 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/392/sisA-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1737.20 -1749.67
2 -1737.25 -1749.06
--------------------------------------
TOTAL -1737.22 -1749.41
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.974883 0.018990 0.730584 1.259222 0.963939 1237.42 1369.21 1.000
r(A<->C){all} 0.099225 0.001052 0.039730 0.164490 0.096083 766.85 768.33 1.000
r(A<->G){all} 0.227105 0.001991 0.136875 0.311234 0.224785 653.38 678.63 1.001
r(A<->T){all} 0.222824 0.003058 0.123912 0.332708 0.219796 743.96 762.23 1.001
r(C<->G){all} 0.041914 0.000228 0.016191 0.074489 0.040591 879.78 1047.09 1.001
r(C<->T){all} 0.347358 0.003564 0.233241 0.465493 0.344458 317.59 477.79 1.002
r(G<->T){all} 0.061574 0.000735 0.012014 0.113350 0.058505 675.95 846.20 1.000
pi(A){all} 0.226813 0.000254 0.195399 0.257554 0.226252 1252.18 1319.69 1.000
pi(C){all} 0.305857 0.000323 0.271720 0.342168 0.305104 1054.36 1165.88 1.000
pi(G){all} 0.304103 0.000329 0.268566 0.339939 0.303865 923.59 1067.70 1.000
pi(T){all} 0.163226 0.000193 0.136876 0.191399 0.162807 882.02 948.42 1.001
alpha{1,2} 0.153694 0.001078 0.098619 0.220248 0.149927 1175.40 1289.94 1.000
alpha{3} 2.175489 0.679605 0.787195 3.804765 2.036216 1350.46 1375.04 1.000
pinvar{all} 0.434473 0.004640 0.299847 0.562677 0.438950 833.40 1167.20 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1529.141433
Model 2: PositiveSelection -1529.141433
Model 0: one-ratio -1549.059066
Model 3: discrete -1526.342164
Model 7: beta -1527.734591
Model 8: beta&w>1 -1526.6238
Model 0 vs 1 39.83526600000005
Model 2 vs 1 0.0
Model 8 vs 7 2.221581999999671
>C1
MERSHLYLPTLSYAAMGHVYAPYRGSSSPALSTASSTSSKPEQIEELVSQ
QLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRGSGSG
SGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLKKSAV
MLDTMRDVIAQAERQLLERGYPAATLERMRATFGLEMEQ
>C2
MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSTASSTSSKPEQIEELVSQ
QLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRGSGSG
SGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLKKSAV
MLDTMRDVIAQAEKQLLERGFPAATLERMRATFGLEMEQ
>C3
MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSTASSTSSKPEQIEELVSQ
QLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRGSGSG
SGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLKKSAV
MLDTMRDVIAQAERQLLERGFPAATLERMRATFGLEMEQ
>C4
MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSAVSSTSSSKPEQIEELVS
QQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTEIAMERGSGSG
SGSCSGSEVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLKKSAV
MLDTMRDVIAQAERQLLERGFPAATLERMRATFGLEMEQ
>C5
MERSHLYLPTLSYAAMGHVYAPYRGSSSPALSAASSSSSKPEQIEELVSQ
QLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMERASGSGS
GSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLKKSAVM
LDTMRDVIAQAERQLLERGLSAATLERMRATFGLEMEQo
>C6
MERSHLYLPTLSYAAMGHLYAPYHGSSSPALSSASSSSASSSSRPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKVEAEQGSGS
GSGSDMKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLKKSALMLD
TMRDVIAQAERQLLERGFPADALERMRSTFGLGMEQooo
>C7
MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSSSSSASSSRPEQIEELVS
QQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMEQGSGSG
SGSGSDMKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLKKSAVML
DTMRDVIAQAERQLLERGFPADALERMRTTFGLAMEQoo
>C8
MERSHLYLPNLSYAAMGHVYAPYHGSSSTASATSSKPEHIEELVSQQLHH
LKMHYADEEQRYVDQMLLENPIVVERRAPPTLKTEIAVDTGSVSGSGSGS
DIKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLKKSAVMLDTMRD
VIAQAERQLLERGFPAAAIERMRTTFGLEMEQooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=8, Len=200
C1 MERSHLYLPTLSYAAMGHVYAPYRGSSSPALSTASS---TSS-KPEQIEE
C2 MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSTASS---TSS-KPEQIEE
C3 MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSTASS---TSS-KPEQIEE
C4 MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSAVSS---TSSSKPEQIEE
C5 MERSHLYLPTLSYAAMGHVYAPYRGSSSPALSAASS---SSS-KPEQIEE
C6 MERSHLYLPTLSYAAMGHLYAPYHGSSSPALSSASSSSASSSSRPEQIEE
C7 MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSSSSS---ASSSRPEQIEE
C8 MERSHLYLPNLSYAAMGHVYAPYHGSSS----TASA---TSS-KPEHIEE
*********.********:****:**** : *: :** :**:***
C1 LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRG
C2 LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRG
C3 LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRG
C4 LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTEIAME-RG
C5 LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAME-RA
C6 LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKVEAEQ----
C7 LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAME---
C8 LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPTLKTEIAVD---
**************************************.**.*
C1 SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
C2 SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
C3 SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
C4 SGSGSGSCSGSEVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
C5 SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
C6 ---GSGSGSGSDMKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
C7 QGSGSGSGSGSDMKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
C8 TGSVSGSGSGSDIKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
*** ***::*************************************
C1 KSAVMLDTMRDVIAQAERQLLERGYPAATLERMRATFGLEMEQ-------
C2 KSAVMLDTMRDVIAQAEKQLLERGFPAATLERMRATFGLEMEQ-------
C3 KSAVMLDTMRDVIAQAERQLLERGFPAATLERMRATFGLEMEQ-------
C4 KSAVMLDTMRDVIAQAERQLLERGFPAATLERMRATFGLEMEQ-------
C5 KSAVMLDTMRDVIAQAERQLLERGLSAATLERMRATFGLEMEQo------
C6 KSALMLDTMRDVIAQAERQLLERGFPADALERMRSTFGLGMEQooo----
C7 KSAVMLDTMRDVIAQAERQLLERGFPADALERMRTTFGLAMEQoo-----
C8 KSAVMLDTMRDVIAQAERQLLERGFPAAAIERMRTTFGLEMEQooooooo
***:*************:****** .* ::****:**** ***
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 189 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 189 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12200]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [12200]--->[11927]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/392/sisA-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.433 Mb, Max= 30.799 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MERSHLYLPTLSYAAMGHVYAPYRGSSSPALSTASS---TSS-KPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRG
SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAERQLLERGYPAATLERMRATFGLEMEQ-------
>C2
MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSTASS---TSS-KPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRG
SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAEKQLLERGFPAATLERMRATFGLEMEQ-------
>C3
MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSTASS---TSS-KPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRG
SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAERQLLERGFPAATLERMRATFGLEMEQ-------
>C4
MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSAVSS---TSSSKPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTEIAME-RG
SGSGSGSCSGSEVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAERQLLERGFPAATLERMRATFGLEMEQ-------
>C5
MERSHLYLPTLSYAAMGHVYAPYRGSSSPALSAASS---SSS-KPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAME-RA
SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAERQLLERGLSAATLERMRATFGLEMEQo------
>C6
MERSHLYLPTLSYAAMGHLYAPYHGSSSPALSSASSSSASSSSRPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKVEAEQ----
---GSGSGSGSDMKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSALMLDTMRDVIAQAERQLLERGFPADALERMRSTFGLGMEQooo----
>C7
MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSSSSS---ASSSRPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAME---
QGSGSGSGSGSDMKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAERQLLERGFPADALERMRTTFGLAMEQoo-----
>C8
MERSHLYLPNLSYAAMGHVYAPYHGSSS----TASA---TSS-KPEHIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPTLKTEIAVD---
TGSVSGSGSGSDIKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAERQLLERGFPAAAIERMRTTFGLEMEQooooooo
FORMAT of file /tmp/tmp2770874569189127747aln Not Supported[FATAL:T-COFFEE]
>C1
MERSHLYLPTLSYAAMGHVYAPYRGSSSPALSTASS---TSS-KPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRG
SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAERQLLERGYPAATLERMRATFGLEMEQ-------
>C2
MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSTASS---TSS-KPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRG
SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAEKQLLERGFPAATLERMRATFGLEMEQ-------
>C3
MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSTASS---TSS-KPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRG
SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAERQLLERGFPAATLERMRATFGLEMEQ-------
>C4
MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSAVSS---TSSSKPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTEIAME-RG
SGSGSGSCSGSEVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAERQLLERGFPAATLERMRATFGLEMEQ-------
>C5
MERSHLYLPTLSYAAMGHVYAPYRGSSSPALSAASS---SSS-KPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAME-RA
SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAERQLLERGLSAATLERMRATFGLEMEQo------
>C6
MERSHLYLPTLSYAAMGHLYAPYHGSSSPALSSASSSSASSSSRPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKVEAEQ----
---GSGSGSGSDMKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSALMLDTMRDVIAQAERQLLERGFPADALERMRSTFGLGMEQooo----
>C7
MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSSSSS---ASSSRPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAME---
QGSGSGSGSGSDMKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAERQLLERGFPADALERMRTTFGLAMEQoo-----
>C8
MERSHLYLPNLSYAAMGHVYAPYHGSSS----TASA---TSS-KPEHIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPTLKTEIAVD---
TGSVSGSGSGSDIKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAERQLLERGFPAAAIERMRTTFGLEMEQooooooo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:200 S:96 BS:200
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# PW_SEQ_DISTANCES
BOT 0 1 98.41 C1 C2 98.41
TOP 1 0 98.41 C2 C1 98.41
BOT 0 2 98.94 C1 C3 98.94
TOP 2 0 98.94 C3 C1 98.94
BOT 0 3 95.74 C1 C4 95.74
TOP 3 0 95.74 C4 C1 95.74
BOT 0 4 96.81 C1 C5 96.81
TOP 4 0 96.81 C5 C1 96.81
BOT 0 5 91.21 C1 C6 91.21
TOP 5 0 91.21 C6 C1 91.21
BOT 0 6 93.01 C1 C7 93.01
TOP 6 0 93.01 C7 C1 93.01
BOT 0 7 92.31 C1 C8 92.31
TOP 7 0 92.31 C8 C1 92.31
BOT 1 2 99.47 C2 C3 99.47
TOP 2 1 99.47 C3 C2 99.47
BOT 1 3 96.28 C2 C4 96.28
TOP 3 1 96.28 C4 C2 96.28
BOT 1 4 95.74 C2 C5 95.74
TOP 4 1 95.74 C5 C2 95.74
BOT 1 5 91.76 C2 C6 91.76
TOP 5 1 91.76 C6 C2 91.76
BOT 1 6 93.55 C2 C7 93.55
TOP 6 1 93.55 C7 C2 93.55
BOT 1 7 92.86 C2 C8 92.86
TOP 7 1 92.86 C8 C2 92.86
BOT 2 3 96.81 C3 C4 96.81
TOP 3 2 96.81 C4 C3 96.81
BOT 2 4 96.28 C3 C5 96.28
TOP 4 2 96.28 C5 C3 96.28
BOT 2 5 92.31 C3 C6 92.31
TOP 5 2 92.31 C6 C3 92.31
BOT 2 6 94.09 C3 C7 94.09
TOP 6 2 94.09 C7 C3 94.09
BOT 2 7 93.41 C3 C8 93.41
TOP 7 2 93.41 C8 C3 93.41
BOT 3 4 95.21 C4 C5 95.21
TOP 4 3 95.21 C5 C4 95.21
BOT 3 5 90.71 C4 C6 90.71
TOP 5 3 90.71 C6 C4 90.71
BOT 3 6 93.05 C4 C7 93.05
TOP 6 3 93.05 C7 C4 93.05
BOT 3 7 91.21 C4 C8 91.21
TOP 7 3 91.21 C8 C4 91.21
BOT 4 5 91.26 C5 C6 91.26
TOP 5 4 91.26 C6 C5 91.26
BOT 4 6 93.05 C5 C7 93.05
TOP 6 4 93.05 C7 C5 93.05
BOT 4 7 90.16 C5 C8 90.16
TOP 7 4 90.16 C8 C5 90.16
BOT 5 6 94.59 C6 C7 94.59
TOP 6 5 94.59 C7 C6 94.59
BOT 5 7 89.50 C6 C8 89.50
TOP 7 5 89.50 C8 C6 89.50
BOT 6 7 90.76 C7 C8 90.76
TOP 7 6 90.76 C8 C7 90.76
AVG 0 C1 * 95.20
AVG 1 C2 * 95.44
AVG 2 C3 * 95.90
AVG 3 C4 * 94.14
AVG 4 C5 * 94.07
AVG 5 C6 * 91.62
AVG 6 C7 * 93.16
AVG 7 C8 * 91.46
TOT TOT * 93.87
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGAACGGAGTCATCTTTACTTGCCCACTCTGAGCTACGCGGCCATGGG
C2 ATGGAACGGAGTCATCTTTATTTGCCCACCCTGAGCTACGCGGCCATGGG
C3 ATGGAACGGAGTCATCTTTATTTGCCCACCCTGAGCTACGCGGCCATGGG
C4 ATGGAACGGAGTCATCTATACTTGCCTACCCTGAGCTATGCGGCCATGGG
C5 ATGGAACGGAGTCATCTTTACTTGCCCACCCTGAGCTACGCGGCCATGGG
C6 ATGGAACGGAGCCATCTTTATCTGCCCACTCTGAGCTACGCGGCCATGGG
C7 ATGGAACGGAGCCATCTTTATTTGCCCACTCTGAGCTACGCGGCCATGGG
C8 ATGGAACGGAGTCATCTGTATTTGCCTAACCTGAGCTACGCGGCCATGGG
*********** ***** ** **** *. ******** ***********
C1 TCACGTATACGCACCGTATCGCGGAAGCAGTTCACCCGCACTATCGACAG
C2 TCACGTATACGCACCGTATCACGGAAGCAGCTCACCCGCACTATCAACAG
C3 TCACGTATACGCACCGTATCACGGAAGCAGCTCACCCGCACTATCAACAG
C4 TCACGTATACGCCCCGTATCACGGGAGCAGCTCACCCGCTCTATCAGCAG
C5 TCACGTATACGCGCCGTATCGCGGCAGCAGCTCACCCGCTCTATCAGCAG
C6 TCACCTATACGCCCCGTACCACGGCAGCAGCTCGCCCGCCCTATCATCAG
C7 TCACGTATACGCCCCGTATCACGGAAGCAGCTCACCCGCATTGTCATCAT
C8 TCACGTATACGCCCCGTATCACGGAAGCAGTTCA------------ACCG
**** ******* ***** *.*** ***** **. *.
C1 CATCGTCA---------ACATCATCG---AAGCCGGAGCAGATCGAGGAG
C2 CATCGTCA---------ACATCATCG---AAGCCGGAGCAGATCGAGGAG
C3 CATCGTCA---------ACATCATCG---AAGCCGGAGCAGATCGAGGAG
C4 TATCGTCA---------ACATCATCATCGAAGCCGGAGCAAATCGAGGAG
C5 CTTCGTCG---------TCATCGTCG---AAGCCGGAGCAGATCGAGGAG
C6 CGTCGTCCTCCTCCGCATCGTCGTCCTCGAGGCCGGAACAGATCGAGGAG
C7 CATCCTCT---------GCATCGTCATCGAGGCCAGAACAGATCGAGGAG
C8 CTTCGGCA---------ACATCATCG---AAACCCGAACATATCGAGGAG
** * *.**.** *..** **.** *********
C1 CTGGTGTCCCAGCAGCTGCATCATCTCAAAATGCACTACGCCGACGAGGA
C2 CTGGTGTCCCAGCAGCTGCATCATCTCAAGATGCACTACGCCGACGAGGA
C3 CTGGTGTCCCAGCAGCTGCATCATCTCAAGATGCACTACGCCGACGAGGA
C4 CTGGTGTCCCAGCAGCTGCATCATCTCAAGATGCACTACGCCGACGAGGA
C5 CTGGTGTCCCAGCAGCTGCACCATCTCAAGATGCACTACGCCGACGAGGA
C6 CTGGTGTCCCAGCAGCTGCACCACCTCAAGATGCACTACGCCGACGAGGA
C7 CTGGTGTCCCAGCAGTTGCACCATCTCAAGATGCACTACGCCGACGAGGA
C8 CTAGTGTCCCAGCAACTGCATCATCTCAAGATGCACTACGCCGACGAAGA
**.***********. **** ** *****.*****************.**
C1 GCAACGCTACGTAGACCAGATGCTCCTGGAGAATCCCATTGTTGTGGAGC
C2 GCAACGCTACGTGGACCAGATGCTCCTCGAGAATCCCATTGTTGTGGAGC
C3 GCAACGCTACGTGGACCAGATGCTCCTCGAGAATCCCATTGTTGTGGAAC
C4 GCAACGCTATGTGGACCAGATGCTCCTGGAGAATCCCATTGTTGTGGAGC
C5 GCAACGCTATGTGGACCAGATGCTCCTCGAGAATCCCATTGTTGTGGAGC
C6 GCAGCGCTACGTGGACCAGATGCTGCTGGAGAATCCCATTGTGGTGGAGC
C7 GCAGCGCTACGTGGACCAGATGCTGCTGGAGAATCCCATTGTTGTGGAAC
C8 GCAGCGCTACGTGGACCAGATGCTGCTGGAGAATCCCATTGTTGTGGAAC
***.***** **.*********** ** ************** *****.*
C1 GCCGTGCACCGCCGCCGCTGAAAACGGAGCTTGCTATGGATTGCCGCGGA
C2 GCCGTGCACCGCCGCCGCTGAAAACGGAGCTTGCCATGGATTGCCGCGGA
C3 GCCGTGCACCGCCGCCGCTGAAAACGGAGCTTGCCATGGATTGCCGCGGA
C4 GCCGTGCACCGCCGCCGCTGAAAACGGAGATCGCCATGGAA---CGGGGA
C5 GCCGCGCACCGCCGCCGCTGAAAACGGAGCTTGCCATGGAA---CGGGCA
C6 GCCGGGCACCGCCGCCGCTGAAAGTAGAGGCGGAGCAA------------
C7 GCCGAGCACCGCCACCGTTGAAAACAGAGTTGGCCATGGAA---------
C8 GCCGAGCACCGCCTACGCTGAAAACAGAGATTGCCGTTGAC---------
**** ******** .** *****. .*** *. :
C1 TCGGGTTCCGGATCAGGTTCCGGTTCTGGTTCGGATGTCAAGGATGCCCA
C2 TCGGGTTCCGGATCAGGTTCCGGTTCTGGTTCGGATGTCAAGGATGCCCA
C3 TCGGGTTCCGGATCAGGTTCCGGTTCTGGTTCGGATGTCAAGGATGCCCA
C4 TCGGGTTCCGGATCAGGTTCCTGCTCTGGATCGGAGGTGAAGGATGCCCA
C5 TCGGGTTCTGGATCAGGTTCCGGCTCTGGATCGGATGTGAAGGATGCACA
C6 ---------GGATCGGGATCCGGATCCGGTTCGGACATGAAGGATGCCCA
C7 CAGGGATCGGGTTCTGGATCAGGTTCCGGATCGGACATGAAGGATGCCCA
C8 ACCGGATCAGTTTCTGGATCCGGTTCCGGATCGGACATCAAGGATGCACA
* :** **:**. * ** **:***** .* ********.**
C1 GCGTCAGAGGGCCGAGTCGTGCCGCAAATCCCGCTACAACAACAAGATCA
C2 GCGCCAGAGGGCCGAGTCGTGCCGCAAATCCCGCTACAACAACAAGATCA
C3 GCGCCAGAGGGCCGAGTCGTGCCGCAAATCCCGCTACAACAACAAGATCA
C4 GCGCCAGAGGGCCGAGTCCTGCCGCAAGTCCCGCTACAACAACAAGATCA
C5 GCGCCAGAGGGCCGAGTCCTGCCGCAAGTCCCGCTACAACAACAAGATCA
C6 GCGGCAGCGGGCCGAGTCCTGCCGCAAGTCGCGCTACAACAACAAGATCA
C7 ACGTCAGCGGGCCGAGTCCTGCCGCAAGTCCCGATACAACAACAAGATCA
C8 GCGTCAGCGGGCAGAGTCATGCCGCAAGTCGCGGTACAACAACAAGATCA
.** ***.****.***** ********.** ** ****************
C1 AGAAGGCCAAGCTGCGCTTCCGGCACAAATTCGTCAGCGGGCAGCTGAAG
C2 AGAAGGCCAAGCTGCGCTTCCGGCACAAATTCGTCAGCGGGCAGCTGAAG
C3 AGAAGGCCAAGCTGCGCTTCCGGCACAAATTCGTCAGCGGGCAGCTGAAG
C4 AGAAGGCCAAGCTGCGCTTCCGGCACAAATTCGTTAGCGGACAGCTGAAG
C5 AGAAGGCCAAGCTGCGCTTCCGGCACAAATTCGTCAGCGGGCAGCTGAAG
C6 AGAAGGCCAAGCTGCGCTTCCGGCACAAGTTCGTCAGCGGGCAGCTGAAG
C7 AGAAGGCCAAGCTGCGCTTCCGGCACAAGTTCGTCAGCGGTCAGCTGAAG
C8 AGAAGGCCAAGCTGCGTTTCCGACACAAATTCGTCAGCGGACAGCTAAAG
**************** *****.*****.***** ***** *****.***
C1 AAGAGCGCCGTCATGTTGGACACGATGCGGGATGTGATTGCCCAGGCGGA
C2 AAGAGCGCCGTCATGTTGGACACGATGCGGGATGTGATTGCCCAGGCGGA
C3 AAGAGCGCCGTCATGTTGGACACGATGCGGGATGTGATTGCCCAGGCGGA
C4 AAGAGCGCCGTCATGTTGGACACGATGCGGGATGTGATAGCGCAGGCGGA
C5 AAGAGCGCCGTCATGTTGGACACGATGCGGGATGTGATCGCGCAGGCGGA
C6 AAGAGCGCCCTGATGTTGGACACGATGCGGGATGTGATTGCGCAGGCGGA
C7 AAGAGCGCCGTAATGTTGGACACGATGCGGGATGTGATTGCGCAGGCGGA
C8 AAGAGCGCCGTTATGTTGGACACGATGCGGGATGTGATCGCGCAGGCGGA
********* * ************************** ** ********
C1 GAGGCAGCTGCTCGAGCGGGGATATCCCGCCGCCACACTCGAGCGGATGC
C2 GAAGCAGCTGCTCGAGCGGGGATTCCCCGCCGCCACCCTCGAGCGGATGC
C3 GAGGCAGCTGCTCGAGCGGGGATTCCCCGCCGCCACCCTCGAGCGGATGC
C4 GCGGCAGCTACTCGAGCGGGGATTCCCCGCCGCCACCCTAGAGCGCATGC
C5 GCGGCAGCTGCTCGAGCGGGGATTATCCGCCGCCACCCTCGAGCGCATGC
C6 GCGGCAGCTCCTCGAGCGGGGCTTCCCCGCCGACGCGCTCGAGCGCATGC
C7 GCGGCAGCTCCTCGAACGGGGATTCCCCGCCGACGCCCTCGAGCGCATGC
C8 GAGGCAACTACTCGAACGGGGCTTTCCCGCCGCTGCTATCGAGCGCATGC
*..***.** *****.*****.*: ******. .* .*.***** ****
C1 GGGCCACTTTCGGCCTGGAAATGGAGCAG---------------------
C2 GGGCCACCTTCGGCCTGGAAATGGAGCAG---------------------
C3 GGGCCACCTTCGGCCTGGAAATGGAGCAG---------------------
C4 GTGCCACCTTTGGCCTGGAAATGGAGCAG---------------------
C5 GTGCCACCTTTGGCCTGGAAATGGAGCAG---------------------
C6 GCAGCACCTTCGGCCTGGGAATGGAGCAG---------------------
C7 GCACCACTTTCGGCTTGGCCATGGAACAG---------------------
C8 GCACCACCTTCGGCCTGGAAATGGAGCAG---------------------
* . *** ** *** *** .*****.***
>C1
ATGGAACGGAGTCATCTTTACTTGCCCACTCTGAGCTACGCGGCCATGGG
TCACGTATACGCACCGTATCGCGGAAGCAGTTCACCCGCACTATCGACAG
CATCGTCA---------ACATCATCG---AAGCCGGAGCAGATCGAGGAG
CTGGTGTCCCAGCAGCTGCATCATCTCAAAATGCACTACGCCGACGAGGA
GCAACGCTACGTAGACCAGATGCTCCTGGAGAATCCCATTGTTGTGGAGC
GCCGTGCACCGCCGCCGCTGAAAACGGAGCTTGCTATGGATTGCCGCGGA
TCGGGTTCCGGATCAGGTTCCGGTTCTGGTTCGGATGTCAAGGATGCCCA
GCGTCAGAGGGCCGAGTCGTGCCGCAAATCCCGCTACAACAACAAGATCA
AGAAGGCCAAGCTGCGCTTCCGGCACAAATTCGTCAGCGGGCAGCTGAAG
AAGAGCGCCGTCATGTTGGACACGATGCGGGATGTGATTGCCCAGGCGGA
GAGGCAGCTGCTCGAGCGGGGATATCCCGCCGCCACACTCGAGCGGATGC
GGGCCACTTTCGGCCTGGAAATGGAGCAG---------------------
>C2
ATGGAACGGAGTCATCTTTATTTGCCCACCCTGAGCTACGCGGCCATGGG
TCACGTATACGCACCGTATCACGGAAGCAGCTCACCCGCACTATCAACAG
CATCGTCA---------ACATCATCG---AAGCCGGAGCAGATCGAGGAG
CTGGTGTCCCAGCAGCTGCATCATCTCAAGATGCACTACGCCGACGAGGA
GCAACGCTACGTGGACCAGATGCTCCTCGAGAATCCCATTGTTGTGGAGC
GCCGTGCACCGCCGCCGCTGAAAACGGAGCTTGCCATGGATTGCCGCGGA
TCGGGTTCCGGATCAGGTTCCGGTTCTGGTTCGGATGTCAAGGATGCCCA
GCGCCAGAGGGCCGAGTCGTGCCGCAAATCCCGCTACAACAACAAGATCA
AGAAGGCCAAGCTGCGCTTCCGGCACAAATTCGTCAGCGGGCAGCTGAAG
AAGAGCGCCGTCATGTTGGACACGATGCGGGATGTGATTGCCCAGGCGGA
GAAGCAGCTGCTCGAGCGGGGATTCCCCGCCGCCACCCTCGAGCGGATGC
GGGCCACCTTCGGCCTGGAAATGGAGCAG---------------------
>C3
ATGGAACGGAGTCATCTTTATTTGCCCACCCTGAGCTACGCGGCCATGGG
TCACGTATACGCACCGTATCACGGAAGCAGCTCACCCGCACTATCAACAG
CATCGTCA---------ACATCATCG---AAGCCGGAGCAGATCGAGGAG
CTGGTGTCCCAGCAGCTGCATCATCTCAAGATGCACTACGCCGACGAGGA
GCAACGCTACGTGGACCAGATGCTCCTCGAGAATCCCATTGTTGTGGAAC
GCCGTGCACCGCCGCCGCTGAAAACGGAGCTTGCCATGGATTGCCGCGGA
TCGGGTTCCGGATCAGGTTCCGGTTCTGGTTCGGATGTCAAGGATGCCCA
GCGCCAGAGGGCCGAGTCGTGCCGCAAATCCCGCTACAACAACAAGATCA
AGAAGGCCAAGCTGCGCTTCCGGCACAAATTCGTCAGCGGGCAGCTGAAG
AAGAGCGCCGTCATGTTGGACACGATGCGGGATGTGATTGCCCAGGCGGA
GAGGCAGCTGCTCGAGCGGGGATTCCCCGCCGCCACCCTCGAGCGGATGC
GGGCCACCTTCGGCCTGGAAATGGAGCAG---------------------
>C4
ATGGAACGGAGTCATCTATACTTGCCTACCCTGAGCTATGCGGCCATGGG
TCACGTATACGCCCCGTATCACGGGAGCAGCTCACCCGCTCTATCAGCAG
TATCGTCA---------ACATCATCATCGAAGCCGGAGCAAATCGAGGAG
CTGGTGTCCCAGCAGCTGCATCATCTCAAGATGCACTACGCCGACGAGGA
GCAACGCTATGTGGACCAGATGCTCCTGGAGAATCCCATTGTTGTGGAGC
GCCGTGCACCGCCGCCGCTGAAAACGGAGATCGCCATGGAA---CGGGGA
TCGGGTTCCGGATCAGGTTCCTGCTCTGGATCGGAGGTGAAGGATGCCCA
GCGCCAGAGGGCCGAGTCCTGCCGCAAGTCCCGCTACAACAACAAGATCA
AGAAGGCCAAGCTGCGCTTCCGGCACAAATTCGTTAGCGGACAGCTGAAG
AAGAGCGCCGTCATGTTGGACACGATGCGGGATGTGATAGCGCAGGCGGA
GCGGCAGCTACTCGAGCGGGGATTCCCCGCCGCCACCCTAGAGCGCATGC
GTGCCACCTTTGGCCTGGAAATGGAGCAG---------------------
>C5
ATGGAACGGAGTCATCTTTACTTGCCCACCCTGAGCTACGCGGCCATGGG
TCACGTATACGCGCCGTATCGCGGCAGCAGCTCACCCGCTCTATCAGCAG
CTTCGTCG---------TCATCGTCG---AAGCCGGAGCAGATCGAGGAG
CTGGTGTCCCAGCAGCTGCACCATCTCAAGATGCACTACGCCGACGAGGA
GCAACGCTATGTGGACCAGATGCTCCTCGAGAATCCCATTGTTGTGGAGC
GCCGCGCACCGCCGCCGCTGAAAACGGAGCTTGCCATGGAA---CGGGCA
TCGGGTTCTGGATCAGGTTCCGGCTCTGGATCGGATGTGAAGGATGCACA
GCGCCAGAGGGCCGAGTCCTGCCGCAAGTCCCGCTACAACAACAAGATCA
AGAAGGCCAAGCTGCGCTTCCGGCACAAATTCGTCAGCGGGCAGCTGAAG
AAGAGCGCCGTCATGTTGGACACGATGCGGGATGTGATCGCGCAGGCGGA
GCGGCAGCTGCTCGAGCGGGGATTATCCGCCGCCACCCTCGAGCGCATGC
GTGCCACCTTTGGCCTGGAAATGGAGCAG---------------------
>C6
ATGGAACGGAGCCATCTTTATCTGCCCACTCTGAGCTACGCGGCCATGGG
TCACCTATACGCCCCGTACCACGGCAGCAGCTCGCCCGCCCTATCATCAG
CGTCGTCCTCCTCCGCATCGTCGTCCTCGAGGCCGGAACAGATCGAGGAG
CTGGTGTCCCAGCAGCTGCACCACCTCAAGATGCACTACGCCGACGAGGA
GCAGCGCTACGTGGACCAGATGCTGCTGGAGAATCCCATTGTGGTGGAGC
GCCGGGCACCGCCGCCGCTGAAAGTAGAGGCGGAGCAA------------
---------GGATCGGGATCCGGATCCGGTTCGGACATGAAGGATGCCCA
GCGGCAGCGGGCCGAGTCCTGCCGCAAGTCGCGCTACAACAACAAGATCA
AGAAGGCCAAGCTGCGCTTCCGGCACAAGTTCGTCAGCGGGCAGCTGAAG
AAGAGCGCCCTGATGTTGGACACGATGCGGGATGTGATTGCGCAGGCGGA
GCGGCAGCTCCTCGAGCGGGGCTTCCCCGCCGACGCGCTCGAGCGCATGC
GCAGCACCTTCGGCCTGGGAATGGAGCAG---------------------
>C7
ATGGAACGGAGCCATCTTTATTTGCCCACTCTGAGCTACGCGGCCATGGG
TCACGTATACGCCCCGTATCACGGAAGCAGCTCACCCGCATTGTCATCAT
CATCCTCT---------GCATCGTCATCGAGGCCAGAACAGATCGAGGAG
CTGGTGTCCCAGCAGTTGCACCATCTCAAGATGCACTACGCCGACGAGGA
GCAGCGCTACGTGGACCAGATGCTGCTGGAGAATCCCATTGTTGTGGAAC
GCCGAGCACCGCCACCGTTGAAAACAGAGTTGGCCATGGAA---------
CAGGGATCGGGTTCTGGATCAGGTTCCGGATCGGACATGAAGGATGCCCA
ACGTCAGCGGGCCGAGTCCTGCCGCAAGTCCCGATACAACAACAAGATCA
AGAAGGCCAAGCTGCGCTTCCGGCACAAGTTCGTCAGCGGTCAGCTGAAG
AAGAGCGCCGTAATGTTGGACACGATGCGGGATGTGATTGCGCAGGCGGA
GCGGCAGCTCCTCGAACGGGGATTCCCCGCCGACGCCCTCGAGCGCATGC
GCACCACTTTCGGCTTGGCCATGGAACAG---------------------
>C8
ATGGAACGGAGTCATCTGTATTTGCCTAACCTGAGCTACGCGGCCATGGG
TCACGTATACGCCCCGTATCACGGAAGCAGTTCA------------ACCG
CTTCGGCA---------ACATCATCG---AAACCCGAACATATCGAGGAG
CTAGTGTCCCAGCAACTGCATCATCTCAAGATGCACTACGCCGACGAAGA
GCAGCGCTACGTGGACCAGATGCTGCTGGAGAATCCCATTGTTGTGGAAC
GCCGAGCACCGCCTACGCTGAAAACAGAGATTGCCGTTGAC---------
ACCGGATCAGTTTCTGGATCCGGTTCCGGATCGGACATCAAGGATGCACA
GCGTCAGCGGGCAGAGTCATGCCGCAAGTCGCGGTACAACAACAAGATCA
AGAAGGCCAAGCTGCGTTTCCGACACAAATTCGTCAGCGGACAGCTAAAG
AAGAGCGCCGTTATGTTGGACACGATGCGGGATGTGATCGCGCAGGCGGA
GAGGCAACTACTCGAACGGGGCTTTCCCGCCGCTGCTATCGAGCGCATGC
GCACCACCTTCGGCCTGGAAATGGAGCAG---------------------
>C1
MERSHLYLPTLSYAAMGHVYAPYRGSSSPALSTASSoooTSSoKPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRG
SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAERQLLERGYPAATLERMRATFGLEMEQ
>C2
MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSTASSoooTSSoKPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRG
SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAEKQLLERGFPAATLERMRATFGLEMEQ
>C3
MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSTASSoooTSSoKPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRG
SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAERQLLERGFPAATLERMRATFGLEMEQ
>C4
MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSAVSSoooTSSSKPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTEIAMEoRG
SGSGSGSCSGSEVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAERQLLERGFPAATLERMRATFGLEMEQ
>C5
MERSHLYLPTLSYAAMGHVYAPYRGSSSPALSAASSoooSSSoKPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMEoRA
SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAERQLLERGLSAATLERMRATFGLEMEQ
>C6
MERSHLYLPTLSYAAMGHLYAPYHGSSSPALSSASSSSASSSSRPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKVEAEQoooo
oooGSGSGSGSDMKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSALMLDTMRDVIAQAERQLLERGFPADALERMRSTFGLGMEQ
>C7
MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSSSSSoooASSSRPEQIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMEooo
QGSGSGSGSGSDMKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAERQLLERGFPADALERMRTTFGLAMEQ
>C8
MERSHLYLPNLSYAAMGHVYAPYHGSSSooooTASAoooTSSoKPEHIEE
LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPTLKTEIAVDooo
TGSVSGSGSGSDIKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
KSAVMLDTMRDVIAQAERQLLERGFPAAAIERMRTTFGLEMEQ
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 8 taxa and 600 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1481070081
Setting output file names to "/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1383055923
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4570485281
Seed = 122795817
Swapseed = 1481070081
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 35 unique site patterns
Division 2 has 30 unique site patterns
Division 3 has 86 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2333.918559 -- -24.349928
Chain 2 -- -2330.250654 -- -24.349928
Chain 3 -- -2262.303242 -- -24.349928
Chain 4 -- -2175.765381 -- -24.349928
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2312.033874 -- -24.349928
Chain 2 -- -2329.536289 -- -24.349928
Chain 3 -- -2271.960294 -- -24.349928
Chain 4 -- -2315.730813 -- -24.349928
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2333.919] (-2330.251) (-2262.303) (-2175.765) * [-2312.034] (-2329.536) (-2271.960) (-2315.731)
500 -- (-1818.506) (-1815.335) [-1815.731] (-1807.810) * (-1821.849) (-1839.240) (-1820.003) [-1812.497] -- 0:33:19
1000 -- [-1798.567] (-1800.315) (-1781.424) (-1788.300) * (-1795.748) (-1800.316) (-1786.302) [-1792.027] -- 0:16:39
1500 -- (-1766.987) (-1776.455) [-1745.257] (-1760.175) * (-1787.187) (-1771.721) [-1751.383] (-1784.717) -- 0:11:05
2000 -- [-1760.536] (-1764.201) (-1743.812) (-1750.026) * (-1759.728) (-1752.749) [-1748.652] (-1763.426) -- 0:08:19
2500 -- (-1745.920) (-1748.828) (-1749.146) [-1740.638] * (-1751.495) [-1741.130] (-1748.652) (-1766.318) -- 0:13:18
3000 -- [-1748.900] (-1752.360) (-1751.001) (-1739.990) * (-1742.966) (-1746.170) [-1745.689] (-1752.461) -- 0:11:04
3500 -- [-1741.362] (-1751.571) (-1745.400) (-1740.858) * (-1744.396) (-1740.792) [-1744.788] (-1742.379) -- 0:09:29
4000 -- (-1741.041) (-1746.292) (-1751.999) [-1748.357] * (-1744.903) (-1746.575) (-1750.037) [-1736.480] -- 0:08:18
4500 -- (-1743.140) [-1744.425] (-1744.992) (-1738.037) * (-1737.803) (-1747.746) [-1744.601] (-1739.768) -- 0:07:22
5000 -- [-1742.416] (-1743.009) (-1746.891) (-1739.396) * (-1738.401) (-1749.396) [-1746.250] (-1743.114) -- 0:09:57
Average standard deviation of split frequencies: 0.062854
5500 -- (-1746.492) (-1748.351) (-1749.877) [-1739.038] * (-1742.716) (-1738.433) (-1746.658) [-1740.586] -- 0:09:02
6000 -- [-1743.360] (-1743.598) (-1745.302) (-1740.171) * (-1740.035) (-1747.496) [-1737.547] (-1736.044) -- 0:08:17
6500 -- (-1740.008) (-1749.314) [-1750.268] (-1743.945) * (-1740.723) (-1744.874) [-1739.987] (-1735.924) -- 0:07:38
7000 -- (-1745.555) [-1746.002] (-1742.751) (-1742.866) * (-1742.126) (-1744.758) (-1740.419) [-1741.849] -- 0:07:05
7500 -- (-1745.241) (-1741.560) (-1743.633) [-1744.248] * (-1743.797) (-1750.457) (-1742.514) [-1741.016] -- 0:08:49
8000 -- (-1746.952) (-1744.221) (-1743.795) [-1738.046] * (-1740.815) (-1746.279) (-1744.368) [-1738.642] -- 0:08:16
8500 -- (-1741.975) (-1740.397) (-1743.526) [-1738.863] * [-1743.572] (-1741.358) (-1744.181) (-1745.693) -- 0:07:46
9000 -- (-1739.031) (-1735.956) [-1739.718] (-1753.625) * (-1745.606) (-1740.811) (-1742.394) [-1743.714] -- 0:07:20
9500 -- (-1754.560) (-1736.776) (-1739.131) [-1738.514] * (-1744.214) (-1745.414) [-1739.426] (-1743.118) -- 0:08:41
10000 -- (-1742.204) (-1736.284) (-1739.637) [-1743.657] * (-1738.250) (-1758.834) [-1739.256] (-1743.453) -- 0:08:15
Average standard deviation of split frequencies: 0.057452
10500 -- (-1745.560) [-1738.552] (-1741.288) (-1736.454) * (-1743.500) [-1740.715] (-1738.991) (-1739.587) -- 0:07:51
11000 -- [-1740.010] (-1749.935) (-1738.880) (-1740.204) * (-1745.157) [-1741.874] (-1743.914) (-1743.616) -- 0:07:29
11500 -- (-1746.881) (-1744.683) (-1739.172) [-1738.502] * (-1753.515) (-1740.515) (-1738.458) [-1744.034] -- 0:08:35
12000 -- (-1740.099) (-1739.080) [-1735.355] (-1740.978) * (-1747.788) (-1739.309) [-1739.212] (-1743.129) -- 0:08:14
12500 -- (-1741.074) (-1746.739) (-1740.874) [-1738.349] * (-1742.281) [-1738.287] (-1751.707) (-1738.420) -- 0:07:54
13000 -- [-1745.250] (-1747.228) (-1746.929) (-1745.224) * (-1738.658) (-1753.374) (-1739.825) [-1739.765] -- 0:08:51
13500 -- (-1742.874) [-1736.855] (-1752.447) (-1751.460) * (-1750.174) (-1745.672) (-1743.898) [-1738.231] -- 0:08:31
14000 -- (-1753.053) (-1735.593) (-1744.211) [-1747.987] * (-1747.361) (-1736.516) [-1738.227] (-1742.289) -- 0:08:13
14500 -- (-1751.635) [-1733.948] (-1744.272) (-1755.680) * (-1744.509) [-1743.776] (-1742.538) (-1748.614) -- 0:09:03
15000 -- [-1739.469] (-1755.976) (-1742.398) (-1743.875) * (-1738.903) (-1743.637) (-1744.732) [-1740.079] -- 0:08:45
Average standard deviation of split frequencies: 0.044194
15500 -- (-1750.954) (-1739.958) [-1750.215] (-1745.744) * [-1738.424] (-1741.472) (-1745.593) (-1740.901) -- 0:08:28
16000 -- [-1742.713] (-1743.878) (-1744.596) (-1746.616) * (-1734.490) (-1738.146) (-1744.311) [-1737.727] -- 0:09:13
16500 -- (-1739.116) (-1742.549) [-1743.797] (-1751.054) * (-1737.714) (-1747.359) [-1738.594] (-1738.519) -- 0:08:56
17000 -- (-1737.999) [-1742.385] (-1756.924) (-1745.024) * [-1741.137] (-1736.542) (-1739.118) (-1738.412) -- 0:08:40
17500 -- [-1746.321] (-1744.939) (-1741.745) (-1747.789) * (-1746.022) [-1746.304] (-1739.842) (-1739.521) -- 0:08:25
18000 -- [-1742.658] (-1745.026) (-1737.686) (-1742.664) * [-1739.027] (-1741.769) (-1741.748) (-1742.832) -- 0:08:11
18500 -- [-1738.896] (-1742.241) (-1744.239) (-1746.820) * (-1739.638) (-1738.699) [-1742.737] (-1755.616) -- 0:07:57
19000 -- (-1744.491) (-1748.606) (-1740.655) [-1745.721] * (-1746.401) (-1742.768) [-1742.146] (-1743.468) -- 0:08:36
19500 -- (-1738.695) (-1745.508) (-1748.279) [-1741.985] * (-1738.136) (-1750.322) [-1747.053] (-1745.501) -- 0:08:22
20000 -- (-1738.493) (-1746.707) [-1740.049] (-1741.943) * (-1745.089) (-1744.643) [-1743.299] (-1741.670) -- 0:08:10
Average standard deviation of split frequencies: 0.052463
20500 -- (-1742.068) (-1745.103) [-1739.390] (-1734.947) * [-1740.831] (-1743.314) (-1748.468) (-1741.267) -- 0:07:57
21000 -- (-1737.116) (-1743.156) (-1735.901) [-1736.408] * (-1752.651) (-1748.342) [-1746.945] (-1745.065) -- 0:07:46
21500 -- (-1739.466) (-1748.683) (-1735.178) [-1739.870] * (-1738.442) (-1748.622) (-1745.580) [-1737.905] -- 0:08:20
22000 -- (-1744.459) (-1741.174) [-1737.455] (-1743.578) * (-1738.309) [-1738.036] (-1751.714) (-1741.836) -- 0:08:09
22500 -- (-1740.178) (-1744.574) (-1744.748) [-1746.640] * (-1738.531) (-1739.965) [-1745.885] (-1738.145) -- 0:07:57
23000 -- (-1739.152) (-1739.146) [-1736.789] (-1744.863) * (-1739.777) (-1743.958) (-1739.886) [-1739.966] -- 0:07:47
23500 -- (-1739.487) (-1738.249) [-1737.020] (-1737.820) * [-1737.005] (-1741.310) (-1741.705) (-1740.979) -- 0:07:37
24000 -- (-1745.186) (-1745.111) (-1746.744) [-1743.230] * [-1749.246] (-1736.200) (-1740.673) (-1740.191) -- 0:07:27
24500 -- [-1738.535] (-1747.502) (-1744.422) (-1739.555) * [-1745.510] (-1739.613) (-1742.136) (-1740.077) -- 0:07:57
25000 -- (-1743.113) (-1739.726) (-1744.159) [-1740.305] * (-1746.850) [-1733.301] (-1747.240) (-1751.812) -- 0:07:48
Average standard deviation of split frequencies: 0.036262
25500 -- (-1749.258) (-1744.243) [-1740.729] (-1741.357) * [-1737.027] (-1740.322) (-1742.925) (-1741.853) -- 0:07:38
26000 -- (-1750.884) (-1744.239) (-1738.370) [-1735.825] * (-1747.930) (-1745.587) (-1737.175) [-1737.768] -- 0:07:29
26500 -- (-1744.080) [-1744.187] (-1743.980) (-1748.497) * (-1746.400) (-1744.552) [-1736.140] (-1735.391) -- 0:07:20
27000 -- (-1743.732) (-1744.881) (-1743.093) [-1742.232] * (-1751.788) (-1744.046) [-1738.437] (-1743.716) -- 0:07:12
27500 -- (-1745.818) (-1746.019) (-1742.954) [-1753.065] * (-1741.728) (-1748.986) (-1741.918) [-1738.114] -- 0:07:39
28000 -- (-1747.297) (-1736.713) (-1742.212) [-1742.280] * [-1738.679] (-1741.420) (-1740.045) (-1743.460) -- 0:07:31
28500 -- (-1747.316) [-1748.203] (-1745.032) (-1738.350) * [-1736.377] (-1743.462) (-1739.009) (-1740.144) -- 0:07:23
29000 -- (-1745.037) (-1746.896) [-1738.954] (-1745.932) * (-1742.074) (-1744.402) [-1741.155] (-1737.646) -- 0:07:15
29500 -- (-1741.842) (-1745.928) [-1740.679] (-1740.925) * [-1736.758] (-1738.445) (-1748.575) (-1742.873) -- 0:07:07
30000 -- [-1742.070] (-1747.638) (-1743.972) (-1740.073) * (-1746.133) [-1742.093] (-1742.851) (-1739.454) -- 0:07:32
Average standard deviation of split frequencies: 0.053802
30500 -- (-1745.203) (-1752.098) (-1745.170) [-1739.293] * (-1740.075) [-1749.789] (-1756.859) (-1739.744) -- 0:07:25
31000 -- (-1741.643) (-1745.469) [-1739.221] (-1742.367) * (-1739.450) (-1746.544) (-1740.864) [-1737.873] -- 0:07:17
31500 -- [-1739.770] (-1747.887) (-1744.716) (-1747.078) * (-1747.354) (-1742.143) (-1745.377) [-1734.804] -- 0:07:10
32000 -- (-1744.343) (-1744.825) [-1741.854] (-1742.947) * [-1740.883] (-1745.766) (-1749.954) (-1746.201) -- 0:07:03
32500 -- (-1746.740) (-1742.784) [-1748.221] (-1738.039) * (-1740.708) [-1740.658] (-1747.207) (-1738.094) -- 0:07:26
33000 -- (-1739.856) (-1743.348) [-1740.171] (-1745.568) * [-1742.327] (-1739.693) (-1742.328) (-1739.957) -- 0:07:19
33500 -- (-1747.490) (-1742.797) [-1745.025] (-1740.769) * (-1739.113) (-1748.809) [-1738.191] (-1747.242) -- 0:07:12
34000 -- (-1742.476) [-1742.849] (-1745.400) (-1749.667) * (-1744.768) (-1744.366) [-1743.902] (-1743.237) -- 0:07:06
34500 -- [-1741.598] (-1743.010) (-1760.204) (-1744.481) * (-1745.055) (-1742.861) (-1741.064) [-1742.856] -- 0:06:59
35000 -- [-1742.167] (-1744.688) (-1740.928) (-1745.279) * (-1742.300) (-1743.616) (-1742.686) [-1743.051] -- 0:06:53
Average standard deviation of split frequencies: 0.036665
35500 -- (-1740.050) [-1740.509] (-1740.373) (-1737.634) * [-1739.768] (-1739.653) (-1740.551) (-1743.388) -- 0:07:14
36000 -- [-1742.162] (-1742.230) (-1749.404) (-1740.787) * (-1746.650) (-1743.455) [-1744.002] (-1741.279) -- 0:07:08
36500 -- (-1743.417) (-1753.012) (-1745.011) [-1737.070] * (-1743.136) (-1751.304) [-1739.323] (-1745.109) -- 0:07:02
37000 -- [-1745.997] (-1743.242) (-1743.643) (-1746.570) * [-1744.314] (-1750.576) (-1741.004) (-1742.875) -- 0:06:56
37500 -- (-1741.645) (-1742.892) (-1743.082) [-1745.419] * (-1742.125) (-1745.545) [-1741.258] (-1738.492) -- 0:06:50
38000 -- (-1748.306) (-1742.914) [-1745.338] (-1739.480) * (-1742.494) (-1739.802) [-1742.322] (-1738.922) -- 0:07:10
38500 -- (-1740.915) (-1742.011) (-1741.398) [-1737.636] * (-1741.609) (-1740.716) (-1745.613) [-1736.292] -- 0:07:04
39000 -- [-1742.751] (-1739.320) (-1747.946) (-1738.494) * (-1740.770) (-1752.754) [-1746.652] (-1740.055) -- 0:06:58
39500 -- (-1747.261) [-1738.113] (-1753.014) (-1741.183) * [-1739.060] (-1743.210) (-1738.912) (-1736.054) -- 0:06:53
40000 -- (-1749.968) [-1747.532] (-1746.538) (-1744.031) * (-1746.227) (-1745.798) (-1738.829) [-1738.599] -- 0:06:48
Average standard deviation of split frequencies: 0.037094
40500 -- [-1742.701] (-1737.489) (-1735.912) (-1742.747) * [-1739.506] (-1749.802) (-1737.298) (-1739.068) -- 0:06:42
41000 -- (-1740.586) (-1743.691) [-1740.696] (-1737.709) * (-1745.112) (-1737.070) [-1736.363] (-1747.638) -- 0:07:01
41500 -- [-1743.516] (-1741.864) (-1747.009) (-1742.646) * (-1747.386) [-1739.085] (-1741.946) (-1743.434) -- 0:06:55
42000 -- [-1739.758] (-1747.483) (-1744.295) (-1744.726) * (-1741.402) (-1744.757) (-1740.811) [-1740.519] -- 0:06:50
42500 -- (-1739.397) (-1746.096) (-1741.616) [-1746.263] * (-1738.171) (-1740.646) [-1738.421] (-1741.084) -- 0:06:45
43000 -- (-1748.462) (-1747.438) [-1745.827] (-1746.482) * (-1737.076) (-1743.008) [-1734.987] (-1742.901) -- 0:06:40
43500 -- (-1744.941) (-1743.028) [-1740.002] (-1744.732) * (-1738.642) (-1738.781) (-1743.822) [-1742.357] -- 0:06:57
44000 -- [-1735.947] (-1757.774) (-1738.603) (-1742.150) * (-1740.222) (-1741.081) (-1743.190) [-1743.643] -- 0:06:52
44500 -- (-1742.420) [-1745.606] (-1738.746) (-1742.240) * [-1735.415] (-1744.288) (-1742.459) (-1736.400) -- 0:06:47
45000 -- (-1743.514) [-1742.119] (-1740.708) (-1749.396) * [-1741.493] (-1744.308) (-1738.777) (-1736.635) -- 0:06:43
Average standard deviation of split frequencies: 0.033818
45500 -- (-1744.891) (-1743.832) (-1735.760) [-1738.002] * (-1742.098) (-1753.275) (-1748.288) [-1734.755] -- 0:06:38
46000 -- (-1750.088) (-1745.571) (-1749.594) [-1737.414] * (-1748.287) (-1752.571) [-1744.381] (-1753.744) -- 0:06:34
46500 -- (-1748.418) (-1743.271) (-1741.236) [-1742.241] * (-1744.960) [-1738.638] (-1741.233) (-1744.054) -- 0:06:50
47000 -- (-1737.665) (-1746.781) (-1746.617) [-1750.892] * (-1742.784) [-1745.477] (-1742.042) (-1746.937) -- 0:06:45
47500 -- (-1741.861) (-1740.863) (-1745.986) [-1743.642] * (-1742.312) (-1737.024) [-1739.653] (-1735.595) -- 0:06:41
48000 -- [-1740.866] (-1744.751) (-1744.108) (-1739.334) * (-1744.997) (-1742.205) [-1739.117] (-1738.406) -- 0:06:36
48500 -- (-1744.619) (-1743.791) (-1743.417) [-1742.337] * (-1749.139) (-1743.390) [-1737.646] (-1735.762) -- 0:06:32
49000 -- (-1749.207) (-1744.204) [-1744.514] (-1744.551) * [-1743.215] (-1736.815) (-1745.483) (-1743.363) -- 0:06:28
49500 -- [-1739.178] (-1737.036) (-1745.995) (-1740.995) * [-1739.352] (-1738.757) (-1750.445) (-1738.906) -- 0:06:43
50000 -- (-1746.773) (-1755.203) (-1737.131) [-1738.280] * (-1754.535) (-1751.164) (-1747.681) [-1742.422] -- 0:06:39
Average standard deviation of split frequencies: 0.028843
50500 -- [-1736.439] (-1743.491) (-1743.770) (-1748.418) * (-1742.879) (-1745.779) [-1745.035] (-1739.502) -- 0:06:34
51000 -- [-1738.415] (-1752.456) (-1742.462) (-1748.270) * [-1739.793] (-1742.354) (-1748.505) (-1740.166) -- 0:06:30
51500 -- (-1750.179) (-1736.718) [-1743.320] (-1740.387) * (-1743.253) (-1745.785) [-1739.953] (-1740.095) -- 0:06:26
52000 -- (-1750.022) (-1740.058) [-1748.022] (-1747.027) * [-1739.988] (-1739.737) (-1738.625) (-1751.549) -- 0:06:22
52500 -- (-1745.441) (-1740.559) [-1742.683] (-1747.306) * [-1734.807] (-1741.146) (-1744.134) (-1741.206) -- 0:06:37
53000 -- (-1743.860) (-1739.970) [-1737.624] (-1741.590) * (-1742.713) (-1742.990) (-1739.503) [-1738.126] -- 0:06:33
53500 -- (-1744.153) (-1737.035) (-1743.878) [-1742.098] * (-1743.674) [-1744.283] (-1740.117) (-1741.575) -- 0:06:29
54000 -- (-1739.385) (-1742.563) [-1738.284] (-1737.739) * (-1743.554) (-1742.741) (-1740.743) [-1744.626] -- 0:06:25
54500 -- [-1750.099] (-1742.234) (-1752.542) (-1745.512) * (-1741.470) (-1745.677) (-1738.858) [-1738.556] -- 0:06:21
55000 -- (-1737.107) [-1740.048] (-1740.123) (-1738.825) * (-1742.254) [-1744.828] (-1738.316) (-1738.991) -- 0:06:35
Average standard deviation of split frequencies: 0.027779
55500 -- (-1742.436) (-1733.967) (-1752.146) [-1740.521] * (-1741.346) (-1746.583) (-1741.436) [-1740.892] -- 0:06:31
56000 -- (-1741.808) [-1735.301] (-1742.383) (-1740.840) * (-1742.551) (-1741.563) (-1737.092) [-1747.458] -- 0:06:27
56500 -- [-1736.267] (-1739.981) (-1745.584) (-1746.628) * (-1739.967) (-1750.791) [-1739.879] (-1749.488) -- 0:06:24
57000 -- [-1743.295] (-1742.571) (-1746.729) (-1738.184) * (-1740.506) (-1755.699) [-1736.943] (-1747.571) -- 0:06:20
57500 -- (-1742.824) (-1742.684) [-1739.777] (-1746.254) * (-1743.521) (-1740.160) (-1735.641) [-1740.550] -- 0:06:17
58000 -- (-1740.306) (-1748.283) [-1742.336] (-1743.203) * (-1750.184) (-1746.196) (-1743.901) [-1747.278] -- 0:06:29
58500 -- (-1742.098) [-1746.663] (-1743.407) (-1739.693) * [-1740.390] (-1741.239) (-1747.108) (-1746.587) -- 0:06:26
59000 -- [-1734.888] (-1741.169) (-1740.979) (-1739.716) * [-1737.983] (-1748.419) (-1741.327) (-1745.099) -- 0:06:22
59500 -- (-1748.487) [-1737.379] (-1741.507) (-1747.252) * (-1745.803) [-1743.145] (-1744.563) (-1747.312) -- 0:06:19
60000 -- (-1739.271) (-1738.028) [-1736.791] (-1732.699) * [-1742.947] (-1748.297) (-1740.540) (-1742.805) -- 0:06:16
Average standard deviation of split frequencies: 0.020203
60500 -- (-1743.473) [-1740.449] (-1746.771) (-1736.781) * (-1753.717) (-1746.434) (-1741.742) [-1745.923] -- 0:06:12
61000 -- [-1742.414] (-1740.608) (-1736.232) (-1743.250) * (-1750.688) [-1739.272] (-1742.903) (-1740.190) -- 0:06:24
61500 -- [-1737.004] (-1748.082) (-1735.771) (-1746.822) * (-1752.977) (-1747.829) [-1737.263] (-1750.043) -- 0:06:21
62000 -- (-1746.424) (-1740.776) (-1738.904) [-1738.230] * (-1751.802) (-1743.222) (-1742.151) [-1754.509] -- 0:06:18
62500 -- (-1740.722) (-1743.302) [-1743.574] (-1743.103) * (-1746.570) (-1739.532) [-1745.784] (-1745.576) -- 0:06:15
63000 -- (-1746.345) (-1744.030) [-1742.200] (-1743.043) * (-1745.191) (-1754.846) [-1741.944] (-1750.334) -- 0:06:11
63500 -- (-1742.069) (-1749.092) (-1740.337) [-1739.204] * (-1744.889) (-1753.415) (-1741.927) [-1738.352] -- 0:06:23
64000 -- [-1742.836] (-1740.537) (-1744.648) (-1740.870) * (-1741.247) (-1746.831) (-1743.820) [-1735.247] -- 0:06:20
64500 -- (-1742.095) [-1746.284] (-1751.427) (-1736.618) * (-1746.308) (-1740.725) [-1740.554] (-1739.019) -- 0:06:17
65000 -- (-1742.120) (-1741.131) (-1754.431) [-1745.684] * (-1740.349) (-1737.923) (-1750.054) [-1740.589] -- 0:06:14
Average standard deviation of split frequencies: 0.029998
65500 -- [-1741.094] (-1749.862) (-1750.342) (-1741.213) * [-1742.018] (-1742.215) (-1748.065) (-1738.075) -- 0:06:10
66000 -- (-1750.249) [-1744.745] (-1742.347) (-1743.465) * (-1742.320) (-1750.723) (-1746.079) [-1740.768] -- 0:06:07
66500 -- (-1751.433) (-1739.767) (-1737.648) [-1736.907] * [-1741.768] (-1748.425) (-1737.612) (-1747.071) -- 0:06:19
67000 -- (-1745.289) (-1744.650) (-1737.490) [-1740.602] * [-1739.910] (-1744.552) (-1744.434) (-1747.100) -- 0:06:15
67500 -- (-1745.544) (-1754.384) (-1739.908) [-1736.591] * (-1740.022) (-1742.745) [-1745.787] (-1740.622) -- 0:06:13
68000 -- [-1739.083] (-1743.886) (-1739.558) (-1748.795) * (-1739.422) (-1750.311) [-1742.553] (-1741.216) -- 0:06:10
68500 -- (-1754.032) (-1744.832) [-1743.484] (-1739.757) * [-1735.568] (-1745.361) (-1740.113) (-1752.193) -- 0:06:07
69000 -- (-1749.288) (-1751.830) (-1743.418) [-1739.695] * (-1738.709) (-1748.434) [-1743.572] (-1746.111) -- 0:06:04
69500 -- (-1740.502) (-1741.691) (-1746.586) [-1744.554] * (-1740.129) (-1737.688) [-1736.072] (-1746.275) -- 0:06:14
70000 -- (-1738.731) (-1742.087) [-1741.024] (-1735.819) * (-1749.821) (-1743.093) (-1740.827) [-1740.656] -- 0:06:12
Average standard deviation of split frequencies: 0.029352
70500 -- (-1738.639) [-1737.355] (-1743.224) (-1739.458) * (-1747.008) [-1742.119] (-1743.666) (-1742.562) -- 0:06:09
71000 -- [-1734.608] (-1744.834) (-1744.023) (-1743.781) * (-1740.738) (-1735.223) [-1749.896] (-1746.158) -- 0:06:06
71500 -- [-1741.368] (-1743.676) (-1742.356) (-1742.359) * (-1741.194) (-1740.089) [-1744.089] (-1740.962) -- 0:06:03
72000 -- [-1738.901] (-1749.468) (-1739.669) (-1751.066) * (-1739.337) (-1742.382) [-1749.810] (-1747.049) -- 0:06:13
72500 -- (-1751.615) [-1740.293] (-1745.695) (-1739.709) * (-1741.620) [-1743.210] (-1743.593) (-1739.315) -- 0:06:11
73000 -- (-1756.970) (-1745.069) (-1744.019) [-1739.187] * [-1735.422] (-1741.462) (-1742.534) (-1743.607) -- 0:06:08
73500 -- (-1752.810) (-1738.719) (-1740.991) [-1748.543] * [-1739.688] (-1734.230) (-1741.896) (-1740.909) -- 0:06:05
74000 -- [-1746.558] (-1739.743) (-1742.647) (-1758.752) * (-1735.750) (-1741.690) [-1743.419] (-1739.615) -- 0:06:02
74500 -- (-1752.457) [-1737.672] (-1744.557) (-1755.534) * (-1744.245) (-1745.244) (-1748.667) [-1741.877] -- 0:06:00
75000 -- [-1750.840] (-1740.445) (-1743.347) (-1749.394) * (-1734.289) (-1745.743) (-1749.292) [-1736.721] -- 0:06:10
Average standard deviation of split frequencies: 0.023570
75500 -- (-1741.716) [-1741.957] (-1739.554) (-1745.868) * (-1745.501) [-1738.658] (-1743.146) (-1747.187) -- 0:06:07
76000 -- (-1745.133) (-1742.756) (-1747.509) [-1741.191] * (-1742.353) (-1746.856) (-1739.642) [-1740.241] -- 0:06:04
76500 -- [-1740.514] (-1744.788) (-1744.285) (-1745.126) * (-1741.441) (-1741.670) [-1746.610] (-1739.966) -- 0:06:02
77000 -- (-1740.727) (-1741.151) (-1736.501) [-1739.842] * (-1747.140) [-1746.473] (-1742.588) (-1746.766) -- 0:05:59
77500 -- (-1739.224) (-1738.018) [-1742.686] (-1739.266) * (-1751.672) (-1740.352) (-1739.911) [-1741.143] -- 0:05:57
78000 -- (-1741.893) (-1745.917) (-1744.449) [-1738.000] * (-1742.141) (-1743.150) [-1742.362] (-1751.778) -- 0:06:06
78500 -- (-1745.042) (-1743.626) [-1743.511] (-1741.365) * (-1743.581) [-1749.552] (-1749.825) (-1750.857) -- 0:06:03
79000 -- (-1743.000) (-1737.896) (-1744.634) [-1737.070] * [-1749.956] (-1741.042) (-1745.749) (-1740.734) -- 0:06:01
79500 -- [-1741.153] (-1746.573) (-1739.814) (-1748.715) * (-1754.126) [-1737.495] (-1745.457) (-1741.440) -- 0:05:58
80000 -- [-1740.025] (-1750.162) (-1742.066) (-1741.752) * (-1746.971) (-1743.304) [-1740.206] (-1743.524) -- 0:05:56
Average standard deviation of split frequencies: 0.027466
80500 -- (-1745.682) (-1744.606) (-1734.343) [-1741.914] * (-1748.321) [-1737.212] (-1741.716) (-1738.529) -- 0:05:54
81000 -- (-1743.331) [-1743.092] (-1738.900) (-1739.599) * (-1744.525) (-1738.699) (-1743.104) [-1739.824] -- 0:06:03
81500 -- (-1746.967) [-1740.352] (-1737.171) (-1747.553) * (-1740.046) (-1743.598) [-1744.806] (-1744.534) -- 0:06:00
82000 -- (-1743.317) (-1740.131) [-1737.608] (-1739.738) * (-1740.660) (-1740.777) [-1739.932] (-1737.604) -- 0:05:58
82500 -- (-1740.062) (-1749.337) [-1742.670] (-1744.585) * (-1739.481) [-1742.013] (-1734.281) (-1742.012) -- 0:05:55
83000 -- (-1748.259) (-1745.379) [-1741.023] (-1738.299) * (-1739.341) (-1736.663) (-1739.962) [-1742.585] -- 0:05:53
83500 -- (-1744.042) (-1747.978) (-1742.620) [-1739.768] * [-1735.996] (-1736.956) (-1739.733) (-1749.713) -- 0:06:02
84000 -- [-1734.517] (-1743.621) (-1740.054) (-1739.535) * (-1737.335) (-1738.247) [-1737.481] (-1747.366) -- 0:05:59
84500 -- (-1754.479) (-1742.706) (-1736.818) [-1743.362] * (-1744.857) [-1738.670] (-1756.320) (-1742.689) -- 0:05:57
85000 -- [-1738.275] (-1749.210) (-1742.480) (-1742.783) * (-1742.693) (-1758.620) (-1744.426) [-1745.121] -- 0:05:55
Average standard deviation of split frequencies: 0.019733
85500 -- (-1741.666) (-1741.621) (-1736.001) [-1750.209] * (-1741.009) [-1742.213] (-1740.359) (-1742.748) -- 0:05:52
86000 -- (-1739.442) (-1748.141) [-1738.402] (-1749.863) * (-1742.679) (-1739.971) [-1737.435] (-1737.203) -- 0:05:50
86500 -- (-1744.634) (-1738.618) [-1738.766] (-1745.938) * (-1745.371) (-1742.226) [-1743.170] (-1739.290) -- 0:05:59
87000 -- (-1738.713) (-1752.226) [-1743.549] (-1745.214) * (-1747.139) (-1737.567) [-1738.575] (-1741.651) -- 0:05:56
87500 -- [-1749.205] (-1744.261) (-1744.432) (-1740.708) * (-1743.082) [-1743.644] (-1745.902) (-1737.907) -- 0:05:54
88000 -- (-1741.297) [-1742.583] (-1742.643) (-1742.043) * (-1739.738) (-1741.664) [-1740.619] (-1734.237) -- 0:05:52
88500 -- [-1746.510] (-1740.499) (-1740.654) (-1740.052) * (-1742.686) (-1745.722) (-1758.001) [-1735.467] -- 0:05:50
89000 -- (-1742.071) [-1742.704] (-1740.581) (-1741.011) * (-1742.751) (-1752.193) [-1742.493] (-1737.412) -- 0:05:48
89500 -- [-1739.589] (-1741.286) (-1743.289) (-1742.911) * (-1744.533) (-1752.565) [-1744.862] (-1738.451) -- 0:05:56
90000 -- [-1743.051] (-1739.013) (-1742.928) (-1748.152) * [-1740.301] (-1749.369) (-1738.434) (-1742.745) -- 0:05:53
Average standard deviation of split frequencies: 0.023397
90500 -- (-1742.289) (-1745.495) (-1744.767) [-1739.220] * (-1745.292) (-1749.221) (-1754.728) [-1738.539] -- 0:05:51
91000 -- (-1746.960) (-1743.608) (-1750.932) [-1742.054] * (-1741.840) [-1740.594] (-1749.849) (-1745.168) -- 0:05:49
91500 -- [-1742.481] (-1739.296) (-1753.515) (-1745.059) * [-1739.257] (-1743.279) (-1742.960) (-1744.513) -- 0:05:47
92000 -- [-1743.460] (-1738.073) (-1747.908) (-1743.012) * (-1749.778) (-1742.428) [-1743.391] (-1744.534) -- 0:05:55
92500 -- [-1737.001] (-1736.449) (-1746.984) (-1737.854) * (-1744.104) (-1740.743) (-1739.606) [-1738.480] -- 0:05:53
93000 -- (-1746.307) (-1744.144) (-1738.472) [-1746.549] * (-1756.108) (-1748.981) [-1743.661] (-1742.762) -- 0:05:51
93500 -- [-1743.407] (-1745.342) (-1748.035) (-1742.295) * (-1744.626) [-1740.575] (-1740.842) (-1737.831) -- 0:05:49
94000 -- (-1744.110) (-1747.157) (-1741.041) [-1747.572] * (-1742.371) (-1744.790) [-1736.880] (-1734.750) -- 0:05:46
94500 -- (-1751.565) [-1754.193] (-1743.789) (-1753.538) * (-1740.739) [-1740.962] (-1738.824) (-1746.201) -- 0:05:44
95000 -- (-1751.168) [-1744.531] (-1745.376) (-1749.571) * (-1746.434) (-1740.087) (-1742.751) [-1743.310] -- 0:05:52
Average standard deviation of split frequencies: 0.022588
95500 -- (-1745.014) (-1742.685) [-1735.108] (-1752.527) * (-1740.774) [-1743.273] (-1739.396) (-1737.049) -- 0:05:50
96000 -- [-1748.573] (-1753.671) (-1741.802) (-1747.256) * [-1741.694] (-1741.980) (-1741.766) (-1740.732) -- 0:05:48
96500 -- (-1742.943) (-1747.579) [-1738.671] (-1741.229) * [-1737.427] (-1738.877) (-1748.506) (-1745.559) -- 0:05:46
97000 -- (-1745.385) (-1743.464) (-1740.280) [-1737.032] * (-1747.385) (-1736.959) (-1748.672) [-1744.848] -- 0:05:44
97500 -- [-1740.817] (-1746.902) (-1744.806) (-1749.232) * (-1746.292) [-1736.435] (-1746.172) (-1751.093) -- 0:05:42
98000 -- (-1735.943) (-1745.169) [-1743.088] (-1746.737) * (-1745.120) (-1735.112) [-1748.264] (-1741.019) -- 0:05:49
98500 -- [-1747.581] (-1749.581) (-1742.055) (-1748.081) * (-1753.943) (-1738.661) (-1741.568) [-1741.517] -- 0:05:47
99000 -- (-1752.938) [-1747.963] (-1742.186) (-1740.806) * (-1753.707) [-1737.813] (-1746.581) (-1763.281) -- 0:05:45
99500 -- (-1751.023) [-1732.822] (-1745.303) (-1742.616) * (-1752.374) (-1739.771) (-1738.686) [-1739.277] -- 0:05:43
100000 -- (-1751.279) [-1736.956] (-1742.443) (-1761.351) * (-1748.380) (-1740.032) (-1737.602) [-1737.580] -- 0:05:42
Average standard deviation of split frequencies: 0.016390
100500 -- (-1741.788) [-1739.792] (-1741.001) (-1752.808) * (-1745.902) (-1743.199) [-1736.089] (-1738.214) -- 0:05:49
101000 -- (-1738.863) (-1744.305) [-1736.267] (-1745.723) * (-1747.001) [-1743.090] (-1741.807) (-1743.767) -- 0:05:47
101500 -- [-1741.693] (-1744.801) (-1744.390) (-1739.507) * (-1741.621) [-1745.957] (-1742.394) (-1746.556) -- 0:05:45
102000 -- (-1742.923) (-1742.489) (-1739.991) [-1739.953] * [-1744.366] (-1749.461) (-1746.218) (-1750.103) -- 0:05:43
102500 -- (-1753.311) (-1747.810) [-1743.142] (-1741.478) * [-1738.010] (-1752.577) (-1742.288) (-1741.514) -- 0:05:41
103000 -- [-1735.124] (-1741.402) (-1743.205) (-1738.596) * [-1737.948] (-1760.165) (-1740.277) (-1742.556) -- 0:05:39
103500 -- (-1744.319) (-1744.801) [-1740.922] (-1741.960) * (-1744.220) [-1741.242] (-1746.310) (-1750.739) -- 0:05:46
104000 -- (-1742.554) (-1741.046) [-1740.689] (-1754.908) * [-1743.491] (-1741.221) (-1748.318) (-1739.689) -- 0:05:44
104500 -- [-1747.213] (-1750.134) (-1743.652) (-1747.537) * (-1744.930) [-1738.876] (-1756.720) (-1743.481) -- 0:05:42
105000 -- (-1744.583) (-1746.046) (-1749.116) [-1747.577] * (-1738.551) (-1752.114) (-1743.381) [-1740.721] -- 0:05:40
Average standard deviation of split frequencies: 0.014231
105500 -- (-1740.088) [-1741.744] (-1743.412) (-1750.687) * (-1742.916) (-1741.414) (-1738.024) [-1740.639] -- 0:05:39
106000 -- (-1742.306) (-1743.365) [-1741.213] (-1748.564) * (-1738.867) (-1743.098) (-1747.427) [-1742.641] -- 0:05:37
106500 -- (-1748.989) (-1743.995) [-1748.377] (-1737.851) * [-1736.757] (-1740.844) (-1748.330) (-1743.964) -- 0:05:43
107000 -- [-1745.031] (-1752.676) (-1747.136) (-1738.976) * (-1737.946) (-1739.961) (-1745.031) [-1740.841] -- 0:05:42
107500 -- (-1735.690) [-1742.624] (-1747.560) (-1734.280) * [-1740.954] (-1745.478) (-1740.279) (-1736.851) -- 0:05:40
108000 -- [-1738.469] (-1741.856) (-1754.962) (-1740.708) * (-1740.617) (-1747.619) (-1741.047) [-1740.601] -- 0:05:38
108500 -- [-1744.570] (-1746.967) (-1751.714) (-1742.391) * (-1744.628) [-1742.100] (-1738.282) (-1743.201) -- 0:05:36
109000 -- (-1738.042) (-1747.225) (-1750.058) [-1734.336] * [-1741.349] (-1746.491) (-1744.993) (-1747.004) -- 0:05:43
109500 -- (-1740.513) (-1741.654) (-1748.425) [-1738.791] * (-1747.935) (-1745.549) (-1741.619) [-1736.944] -- 0:05:41
110000 -- (-1748.348) [-1737.881] (-1743.380) (-1738.929) * (-1747.519) (-1744.072) [-1736.267] (-1746.148) -- 0:05:39
Average standard deviation of split frequencies: 0.008945
110500 -- (-1740.246) (-1750.324) [-1740.981] (-1756.538) * (-1742.155) (-1745.132) [-1742.947] (-1747.020) -- 0:05:38
111000 -- (-1745.800) (-1735.822) (-1742.396) [-1739.483] * (-1743.305) (-1747.441) [-1745.065] (-1739.212) -- 0:05:44
111500 -- (-1741.555) (-1743.713) [-1738.292] (-1740.391) * (-1743.831) [-1744.690] (-1757.990) (-1741.600) -- 0:05:42
112000 -- [-1739.889] (-1751.149) (-1742.981) (-1746.979) * [-1743.535] (-1738.375) (-1743.590) (-1745.448) -- 0:05:40
112500 -- (-1741.641) (-1746.273) (-1742.301) [-1734.568] * [-1736.852] (-1740.740) (-1739.499) (-1741.121) -- 0:05:39
113000 -- (-1746.451) (-1754.147) [-1744.935] (-1741.076) * (-1750.110) [-1741.743] (-1741.996) (-1747.710) -- 0:05:37
113500 -- (-1752.859) [-1735.795] (-1755.149) (-1743.560) * (-1745.092) (-1745.780) (-1739.420) [-1744.688] -- 0:05:35
114000 -- (-1738.131) (-1741.679) (-1742.850) [-1741.612] * (-1736.492) (-1744.343) [-1739.849] (-1746.783) -- 0:05:41
114500 -- (-1743.435) [-1735.176] (-1747.948) (-1743.117) * [-1738.321] (-1749.999) (-1738.696) (-1745.668) -- 0:05:40
115000 -- [-1742.033] (-1741.147) (-1741.185) (-1745.081) * [-1739.316] (-1746.020) (-1745.631) (-1746.275) -- 0:05:38
Average standard deviation of split frequencies: 0.010160
115500 -- (-1746.451) [-1739.329] (-1741.046) (-1748.750) * (-1742.553) [-1748.525] (-1742.958) (-1737.608) -- 0:05:36
116000 -- (-1742.400) (-1743.121) [-1733.647] (-1747.027) * (-1738.603) (-1745.103) (-1748.187) [-1737.590] -- 0:05:35
116500 -- (-1737.835) (-1740.211) [-1739.808] (-1743.479) * [-1735.039] (-1739.256) (-1744.697) (-1740.510) -- 0:05:33
117000 -- (-1748.651) (-1739.321) (-1743.164) [-1741.784] * (-1739.448) (-1744.821) [-1742.751] (-1745.665) -- 0:05:39
117500 -- (-1747.490) (-1741.798) [-1739.795] (-1757.628) * (-1737.482) [-1740.899] (-1746.826) (-1749.749) -- 0:05:37
118000 -- (-1742.651) (-1739.882) [-1742.836] (-1742.987) * (-1746.827) (-1737.701) [-1739.636] (-1745.190) -- 0:05:36
118500 -- (-1740.832) (-1735.844) [-1739.980] (-1746.422) * [-1741.026] (-1739.739) (-1737.956) (-1750.521) -- 0:05:34
119000 -- (-1743.053) [-1738.459] (-1748.705) (-1742.662) * [-1737.304] (-1743.319) (-1738.723) (-1751.084) -- 0:05:33
119500 -- (-1739.132) (-1735.725) [-1739.650] (-1747.502) * (-1734.088) [-1740.333] (-1749.006) (-1742.766) -- 0:05:38
120000 -- (-1739.386) (-1745.283) [-1737.729] (-1740.618) * (-1738.065) [-1740.828] (-1736.157) (-1742.393) -- 0:05:37
Average standard deviation of split frequencies: 0.009376
120500 -- (-1743.263) [-1745.897] (-1736.570) (-1746.287) * (-1747.195) (-1742.715) (-1753.778) [-1735.905] -- 0:05:35
121000 -- (-1744.201) [-1738.635] (-1740.322) (-1742.041) * [-1739.736] (-1752.162) (-1742.092) (-1737.309) -- 0:05:34
121500 -- (-1744.417) (-1746.319) (-1737.451) [-1734.290] * (-1740.358) [-1748.361] (-1740.092) (-1738.152) -- 0:05:32
122000 -- (-1737.853) (-1745.740) [-1742.794] (-1747.860) * (-1740.785) [-1739.152] (-1754.251) (-1739.437) -- 0:05:31
122500 -- (-1743.227) [-1740.346] (-1739.559) (-1749.882) * (-1737.614) [-1743.380] (-1743.815) (-1742.312) -- 0:05:36
123000 -- (-1739.593) (-1738.872) [-1737.103] (-1744.122) * (-1737.281) (-1740.198) (-1750.859) [-1737.553] -- 0:05:35
123500 -- (-1736.745) (-1745.250) (-1741.808) [-1740.336] * (-1742.061) (-1747.992) (-1739.924) [-1741.765] -- 0:05:33
124000 -- (-1749.758) [-1739.626] (-1746.943) (-1743.828) * (-1746.485) (-1753.780) (-1741.510) [-1743.124] -- 0:05:32
124500 -- [-1748.172] (-1739.484) (-1753.354) (-1740.685) * [-1746.339] (-1738.947) (-1747.180) (-1735.965) -- 0:05:30
125000 -- [-1749.066] (-1738.262) (-1747.255) (-1741.176) * [-1744.126] (-1740.579) (-1749.002) (-1746.009) -- 0:05:36
Average standard deviation of split frequencies: 0.007483
125500 -- (-1748.084) [-1740.968] (-1742.085) (-1747.638) * (-1742.829) (-1750.945) [-1740.392] (-1741.206) -- 0:05:34
126000 -- (-1741.292) (-1744.405) [-1741.748] (-1751.378) * [-1736.850] (-1738.784) (-1735.704) (-1737.826) -- 0:05:32
126500 -- (-1747.030) (-1739.250) [-1742.768] (-1740.207) * (-1752.447) (-1735.184) [-1733.296] (-1754.350) -- 0:05:31
127000 -- (-1742.239) [-1735.583] (-1745.432) (-1743.072) * [-1742.470] (-1740.775) (-1739.372) (-1746.329) -- 0:05:29
127500 -- (-1743.055) [-1741.052] (-1750.529) (-1740.344) * [-1741.490] (-1743.240) (-1744.852) (-1745.019) -- 0:05:35
128000 -- [-1742.782] (-1737.241) (-1752.902) (-1744.790) * (-1735.306) (-1747.538) [-1741.219] (-1739.662) -- 0:05:33
128500 -- [-1740.976] (-1740.574) (-1741.222) (-1742.149) * (-1745.168) (-1740.369) [-1744.649] (-1740.831) -- 0:05:32
129000 -- (-1747.421) (-1742.483) [-1745.886] (-1738.631) * (-1741.606) (-1738.952) (-1746.066) [-1741.089] -- 0:05:30
129500 -- (-1749.950) (-1739.186) (-1749.753) [-1745.014] * (-1741.847) (-1750.836) [-1740.228] (-1739.525) -- 0:05:29
130000 -- [-1742.585] (-1745.385) (-1740.089) (-1752.515) * (-1749.418) (-1736.477) (-1743.743) [-1739.177] -- 0:05:27
Average standard deviation of split frequencies: 0.007937
130500 -- (-1734.594) (-1737.135) [-1740.870] (-1746.362) * (-1742.145) [-1738.667] (-1747.312) (-1738.221) -- 0:05:33
131000 -- (-1742.389) (-1742.947) (-1748.872) [-1742.758] * [-1738.668] (-1745.154) (-1744.762) (-1738.057) -- 0:05:31
131500 -- [-1738.377] (-1744.405) (-1746.233) (-1744.338) * (-1736.651) (-1744.964) (-1751.067) [-1737.952] -- 0:05:30
132000 -- (-1742.179) (-1748.501) [-1740.431] (-1739.577) * (-1742.910) [-1739.623] (-1752.640) (-1736.240) -- 0:05:28
132500 -- [-1743.551] (-1755.553) (-1743.371) (-1742.021) * (-1742.593) [-1739.562] (-1754.992) (-1741.591) -- 0:05:27
133000 -- [-1738.176] (-1747.909) (-1737.980) (-1741.855) * (-1747.199) (-1742.997) [-1749.986] (-1747.208) -- 0:05:25
133500 -- (-1742.641) (-1745.855) [-1739.705] (-1745.585) * [-1739.208] (-1739.376) (-1745.055) (-1742.594) -- 0:05:31
134000 -- (-1738.394) [-1747.037] (-1742.563) (-1738.953) * (-1741.452) [-1741.542] (-1743.147) (-1738.887) -- 0:05:29
134500 -- [-1742.325] (-1740.852) (-1744.946) (-1745.408) * (-1736.595) (-1738.032) [-1739.904] (-1739.310) -- 0:05:28
135000 -- [-1742.287] (-1746.130) (-1743.574) (-1743.024) * (-1743.746) [-1749.871] (-1744.913) (-1742.579) -- 0:05:26
Average standard deviation of split frequencies: 0.006586
135500 -- (-1742.893) (-1745.145) [-1736.935] (-1745.964) * (-1737.552) (-1756.646) [-1737.859] (-1742.676) -- 0:05:25
136000 -- [-1742.385] (-1741.166) (-1737.405) (-1761.946) * (-1742.860) (-1746.168) (-1747.488) [-1739.097] -- 0:05:24
136500 -- (-1751.846) (-1743.137) [-1739.402] (-1747.163) * [-1743.587] (-1738.603) (-1750.961) (-1740.629) -- 0:05:28
137000 -- (-1746.292) [-1737.935] (-1736.200) (-1748.406) * [-1743.680] (-1747.720) (-1744.657) (-1741.421) -- 0:05:27
137500 -- (-1747.937) [-1737.164] (-1743.747) (-1742.055) * (-1737.934) (-1740.795) (-1741.154) [-1746.045] -- 0:05:26
138000 -- (-1735.961) [-1740.081] (-1739.717) (-1745.339) * (-1749.228) [-1739.474] (-1745.349) (-1746.420) -- 0:05:24
138500 -- [-1736.759] (-1741.669) (-1735.258) (-1735.334) * (-1745.172) (-1743.619) (-1747.347) [-1749.641] -- 0:05:23
139000 -- [-1742.219] (-1743.317) (-1744.911) (-1743.380) * (-1744.541) (-1742.899) [-1741.730] (-1743.935) -- 0:05:28
139500 -- (-1741.330) (-1749.604) (-1750.212) [-1742.098] * (-1737.122) [-1735.266] (-1739.572) (-1745.718) -- 0:05:26
140000 -- (-1743.654) (-1751.060) (-1740.228) [-1750.056] * (-1741.747) (-1753.746) [-1743.337] (-1746.453) -- 0:05:25
Average standard deviation of split frequencies: 0.008043
140500 -- (-1742.535) (-1744.651) (-1738.330) [-1746.592] * (-1744.085) (-1741.819) [-1740.201] (-1748.137) -- 0:05:24
141000 -- [-1737.087] (-1744.071) (-1746.443) (-1748.196) * (-1739.897) [-1744.393] (-1742.417) (-1746.022) -- 0:05:22
141500 -- (-1743.046) [-1739.452] (-1744.973) (-1742.887) * (-1738.981) (-1750.201) [-1737.672] (-1744.849) -- 0:05:21
142000 -- (-1737.216) (-1752.821) (-1747.809) [-1734.142] * (-1744.465) (-1745.300) (-1741.822) [-1737.094] -- 0:05:26
142500 -- (-1740.747) (-1747.515) [-1749.640] (-1746.458) * [-1745.837] (-1744.502) (-1740.168) (-1736.395) -- 0:05:24
143000 -- [-1736.215] (-1749.034) (-1741.213) (-1747.029) * (-1750.179) [-1742.050] (-1738.584) (-1736.131) -- 0:05:23
143500 -- [-1738.665] (-1748.892) (-1741.198) (-1744.092) * (-1745.753) [-1742.651] (-1746.991) (-1740.109) -- 0:05:22
144000 -- [-1740.656] (-1748.891) (-1751.966) (-1745.429) * (-1749.174) [-1741.176] (-1743.371) (-1746.291) -- 0:05:21
144500 -- (-1745.161) (-1753.869) (-1744.174) [-1740.911] * (-1749.324) [-1740.405] (-1745.454) (-1737.804) -- 0:05:19
145000 -- (-1737.342) (-1755.643) (-1739.114) [-1746.386] * (-1749.555) (-1741.927) (-1742.661) [-1740.689] -- 0:05:24
Average standard deviation of split frequencies: 0.011624
145500 -- (-1741.277) (-1743.273) [-1736.573] (-1746.653) * (-1750.674) (-1744.372) [-1742.303] (-1739.503) -- 0:05:23
146000 -- (-1739.746) (-1749.184) (-1742.797) [-1738.215] * [-1752.248] (-1741.500) (-1739.845) (-1738.164) -- 0:05:21
146500 -- [-1743.335] (-1746.560) (-1751.016) (-1750.059) * (-1749.336) [-1737.051] (-1738.463) (-1739.600) -- 0:05:20
147000 -- (-1742.029) [-1742.180] (-1740.372) (-1743.218) * (-1749.566) [-1741.165] (-1742.880) (-1745.791) -- 0:05:19
147500 -- (-1742.444) (-1741.498) [-1746.312] (-1740.379) * [-1746.156] (-1741.679) (-1739.505) (-1737.819) -- 0:05:23
148000 -- (-1737.811) [-1738.133] (-1747.790) (-1746.128) * (-1759.161) (-1741.207) (-1737.189) [-1738.524] -- 0:05:22
148500 -- (-1742.371) (-1744.959) (-1742.733) [-1737.384] * (-1746.348) (-1749.852) (-1740.449) [-1746.404] -- 0:05:21
149000 -- [-1740.034] (-1749.043) (-1741.716) (-1739.493) * (-1740.788) (-1738.776) [-1745.011] (-1741.164) -- 0:05:19
149500 -- [-1740.203] (-1751.502) (-1745.255) (-1744.094) * (-1743.119) [-1746.074] (-1739.597) (-1734.347) -- 0:05:18
150000 -- (-1742.483) (-1748.234) (-1741.549) [-1743.074] * (-1744.776) [-1739.147] (-1743.627) (-1741.270) -- 0:05:17
Average standard deviation of split frequencies: 0.010638
150500 -- (-1749.049) (-1745.905) (-1740.102) [-1741.769] * (-1741.061) [-1736.551] (-1741.677) (-1739.664) -- 0:05:21
151000 -- (-1751.757) (-1750.965) (-1739.866) [-1742.537] * (-1735.796) (-1745.885) (-1742.901) [-1734.627] -- 0:05:20
151500 -- [-1748.093] (-1750.067) (-1746.972) (-1749.198) * [-1742.607] (-1749.858) (-1745.103) (-1739.792) -- 0:05:19
152000 -- (-1750.591) (-1745.678) (-1746.307) [-1742.590] * (-1740.436) [-1740.364] (-1744.454) (-1733.443) -- 0:05:18
152500 -- (-1738.597) [-1742.141] (-1743.218) (-1742.685) * (-1743.435) (-1740.248) [-1743.009] (-1745.155) -- 0:05:16
153000 -- (-1744.630) (-1741.482) [-1745.722] (-1747.497) * [-1742.821] (-1737.952) (-1738.588) (-1740.562) -- 0:05:15
153500 -- (-1744.349) (-1751.682) [-1739.946] (-1749.544) * (-1740.824) [-1751.733] (-1744.205) (-1742.813) -- 0:05:19
154000 -- (-1745.860) (-1744.970) [-1736.938] (-1743.804) * [-1737.410] (-1745.116) (-1744.487) (-1753.855) -- 0:05:18
154500 -- (-1746.091) (-1751.799) [-1740.488] (-1749.246) * (-1754.515) [-1741.016] (-1740.516) (-1744.356) -- 0:05:17
155000 -- (-1740.282) (-1744.530) [-1735.613] (-1748.232) * (-1748.741) [-1740.060] (-1745.279) (-1744.128) -- 0:05:16
Average standard deviation of split frequencies: 0.012087
155500 -- (-1752.712) [-1739.360] (-1743.194) (-1751.526) * (-1740.496) [-1741.379] (-1741.884) (-1745.596) -- 0:05:14
156000 -- [-1742.500] (-1735.544) (-1748.841) (-1738.543) * (-1746.073) [-1738.288] (-1747.469) (-1743.543) -- 0:05:13
156500 -- (-1747.917) [-1743.636] (-1747.094) (-1744.692) * (-1744.573) (-1739.379) [-1739.163] (-1735.622) -- 0:05:17
157000 -- (-1747.186) [-1746.796] (-1742.128) (-1744.811) * (-1744.132) [-1744.038] (-1747.636) (-1745.365) -- 0:05:16
157500 -- [-1747.199] (-1739.446) (-1748.714) (-1752.944) * [-1740.864] (-1741.835) (-1745.367) (-1754.607) -- 0:05:15
158000 -- [-1736.334] (-1741.235) (-1743.939) (-1744.071) * (-1743.971) [-1740.627] (-1752.619) (-1744.032) -- 0:05:14
158500 -- (-1737.555) (-1747.346) (-1742.387) [-1737.952] * [-1738.569] (-1740.465) (-1752.118) (-1743.006) -- 0:05:13
159000 -- (-1748.388) [-1741.485] (-1745.967) (-1747.114) * (-1742.225) (-1753.326) [-1740.962] (-1744.836) -- 0:05:17
159500 -- (-1741.740) [-1737.987] (-1741.474) (-1736.920) * (-1745.778) (-1739.385) [-1745.166] (-1740.979) -- 0:05:16
160000 -- (-1749.260) (-1736.976) [-1739.079] (-1745.004) * (-1751.700) (-1737.878) (-1747.838) [-1744.015] -- 0:05:15
Average standard deviation of split frequencies: 0.011149
160500 -- [-1740.426] (-1741.602) (-1744.761) (-1741.162) * (-1739.185) [-1746.095] (-1745.258) (-1744.505) -- 0:05:13
161000 -- [-1742.994] (-1737.325) (-1744.287) (-1736.789) * (-1748.213) (-1742.027) [-1740.772] (-1746.855) -- 0:05:12
161500 -- (-1745.065) [-1741.132] (-1748.391) (-1744.251) * (-1744.560) (-1745.335) (-1738.719) [-1744.054] -- 0:05:11
162000 -- [-1744.930] (-1737.583) (-1742.476) (-1745.553) * (-1745.297) (-1739.781) (-1741.837) [-1746.479] -- 0:05:15
162500 -- (-1750.957) (-1740.974) (-1746.527) [-1744.056] * [-1741.736] (-1741.316) (-1740.626) (-1753.786) -- 0:05:14
163000 -- (-1740.673) [-1745.808] (-1755.381) (-1740.618) * (-1748.680) [-1742.633] (-1742.454) (-1740.166) -- 0:05:13
163500 -- [-1743.542] (-1747.504) (-1739.522) (-1749.262) * (-1742.024) [-1741.499] (-1734.230) (-1744.081) -- 0:05:12
164000 -- (-1737.027) [-1741.022] (-1743.231) (-1741.255) * (-1737.559) [-1734.640] (-1740.191) (-1741.084) -- 0:05:10
164500 -- (-1740.963) (-1758.208) (-1746.376) [-1744.161] * (-1737.767) (-1744.047) [-1748.351] (-1741.022) -- 0:05:09
165000 -- (-1738.872) [-1738.467] (-1745.296) (-1738.672) * [-1744.420] (-1743.949) (-1743.781) (-1737.195) -- 0:05:13
Average standard deviation of split frequencies: 0.015051
165500 -- (-1744.608) [-1744.755] (-1747.140) (-1737.915) * (-1746.471) (-1740.414) (-1742.514) [-1739.867] -- 0:05:12
166000 -- [-1740.885] (-1739.070) (-1751.427) (-1740.698) * (-1745.166) (-1741.731) [-1745.561] (-1741.417) -- 0:05:11
166500 -- (-1740.153) [-1735.829] (-1749.720) (-1740.913) * (-1745.940) [-1739.800] (-1741.443) (-1745.203) -- 0:05:10
167000 -- (-1742.654) (-1744.018) (-1749.446) [-1740.718] * [-1743.656] (-1740.234) (-1752.225) (-1743.745) -- 0:05:09
167500 -- (-1739.484) [-1745.906] (-1749.763) (-1744.192) * (-1750.145) (-1744.192) (-1746.394) [-1746.832] -- 0:05:08
168000 -- (-1740.917) [-1744.195] (-1745.086) (-1742.058) * [-1748.319] (-1743.333) (-1741.821) (-1740.449) -- 0:05:12
168500 -- (-1741.007) (-1759.611) (-1748.374) [-1742.309] * (-1740.966) [-1743.093] (-1738.699) (-1746.491) -- 0:05:10
169000 -- (-1746.952) (-1743.772) (-1740.486) [-1747.159] * (-1761.797) (-1750.309) (-1736.161) [-1744.135] -- 0:05:09
169500 -- (-1745.019) (-1755.907) (-1736.982) [-1748.100] * (-1747.398) [-1740.239] (-1744.437) (-1741.135) -- 0:05:08
170000 -- [-1742.471] (-1744.114) (-1742.471) (-1755.111) * [-1737.393] (-1748.854) (-1735.084) (-1741.015) -- 0:05:07
Average standard deviation of split frequencies: 0.014363
170500 -- (-1742.411) (-1742.606) [-1736.312] (-1746.393) * (-1741.934) [-1744.088] (-1738.568) (-1745.518) -- 0:05:11
171000 -- (-1741.736) [-1745.358] (-1739.045) (-1747.283) * (-1739.481) (-1739.069) (-1748.685) [-1744.450] -- 0:05:10
171500 -- (-1740.546) [-1744.106] (-1743.994) (-1744.313) * (-1742.799) (-1742.642) (-1750.840) [-1738.726] -- 0:05:09
172000 -- (-1746.044) (-1741.012) (-1750.747) [-1746.568] * [-1743.137] (-1739.187) (-1743.013) (-1749.099) -- 0:05:08
172500 -- [-1740.220] (-1743.099) (-1748.128) (-1739.075) * [-1742.427] (-1742.720) (-1739.796) (-1759.462) -- 0:05:07
173000 -- [-1748.898] (-1742.929) (-1750.177) (-1738.437) * (-1739.625) [-1737.272] (-1745.073) (-1746.636) -- 0:05:05
173500 -- (-1742.733) (-1744.597) [-1736.198] (-1738.048) * (-1739.935) [-1740.103] (-1743.192) (-1745.336) -- 0:05:09
174000 -- [-1733.447] (-1740.295) (-1742.496) (-1742.117) * (-1741.665) (-1737.821) [-1741.005] (-1742.487) -- 0:05:08
174500 -- [-1744.150] (-1753.793) (-1744.005) (-1749.517) * (-1745.689) (-1744.109) [-1743.014] (-1740.807) -- 0:05:07
175000 -- (-1744.420) (-1735.383) (-1739.448) [-1743.747] * (-1755.193) [-1741.828] (-1740.508) (-1747.393) -- 0:05:06
Average standard deviation of split frequencies: 0.013928
175500 -- (-1738.511) [-1743.375] (-1739.813) (-1744.876) * [-1752.321] (-1741.555) (-1738.430) (-1746.431) -- 0:05:05
176000 -- [-1738.702] (-1750.314) (-1739.378) (-1743.802) * [-1748.292] (-1745.279) (-1746.510) (-1741.211) -- 0:05:04
176500 -- (-1740.487) [-1740.131] (-1748.988) (-1750.234) * (-1747.602) [-1742.572] (-1739.630) (-1740.370) -- 0:05:07
177000 -- (-1747.901) [-1733.843] (-1741.574) (-1735.415) * (-1744.254) [-1747.413] (-1737.909) (-1741.622) -- 0:05:06
177500 -- (-1739.852) (-1744.172) [-1748.358] (-1746.295) * (-1743.981) (-1747.325) (-1738.855) [-1735.802] -- 0:05:05
178000 -- (-1746.388) (-1738.109) (-1746.813) [-1742.847] * (-1749.430) (-1744.177) (-1738.496) [-1743.072] -- 0:05:04
178500 -- [-1733.750] (-1746.069) (-1741.261) (-1742.234) * (-1746.584) [-1745.765] (-1752.462) (-1746.962) -- 0:05:03
179000 -- (-1741.386) [-1741.122] (-1737.637) (-1739.839) * (-1742.069) [-1734.964] (-1741.739) (-1744.319) -- 0:05:02
179500 -- (-1749.830) [-1736.687] (-1742.201) (-1737.453) * (-1740.420) (-1740.706) [-1746.987] (-1740.175) -- 0:05:06
180000 -- (-1743.697) [-1735.348] (-1746.853) (-1748.955) * [-1742.584] (-1738.010) (-1742.921) (-1739.812) -- 0:05:05
Average standard deviation of split frequencies: 0.015656
180500 -- [-1739.391] (-1742.731) (-1738.990) (-1741.020) * (-1745.332) [-1742.315] (-1743.251) (-1745.390) -- 0:05:04
181000 -- (-1763.851) (-1741.270) (-1744.353) [-1744.330] * (-1738.317) [-1740.804] (-1743.764) (-1752.526) -- 0:05:03
181500 -- (-1740.472) [-1748.261] (-1742.967) (-1743.462) * [-1738.326] (-1741.901) (-1739.021) (-1747.445) -- 0:05:02
182000 -- (-1747.126) (-1744.204) [-1739.692] (-1742.301) * [-1734.616] (-1748.385) (-1742.156) (-1747.378) -- 0:05:01
182500 -- (-1745.514) [-1747.593] (-1743.073) (-1744.598) * (-1734.363) (-1741.424) [-1741.581] (-1743.885) -- 0:05:04
183000 -- (-1741.146) (-1741.032) [-1742.170] (-1749.371) * [-1740.315] (-1743.471) (-1744.261) (-1742.244) -- 0:05:03
183500 -- (-1746.188) (-1752.541) (-1742.833) [-1744.357] * (-1736.163) [-1737.725] (-1741.268) (-1743.389) -- 0:05:02
184000 -- [-1742.019] (-1745.750) (-1747.999) (-1742.266) * [-1743.125] (-1739.877) (-1749.929) (-1743.916) -- 0:05:01
184500 -- (-1739.368) [-1744.096] (-1743.765) (-1750.161) * (-1738.943) (-1750.860) (-1744.528) [-1746.350] -- 0:05:00
185000 -- (-1746.217) [-1738.323] (-1737.854) (-1748.354) * [-1746.252] (-1745.936) (-1743.439) (-1735.481) -- 0:05:03
Average standard deviation of split frequencies: 0.018432
185500 -- (-1743.002) (-1743.445) [-1743.709] (-1743.325) * [-1738.145] (-1757.135) (-1743.952) (-1739.363) -- 0:05:02
186000 -- (-1740.861) (-1738.202) [-1741.854] (-1742.204) * (-1738.955) (-1742.124) (-1747.656) [-1747.272] -- 0:05:01
186500 -- (-1744.529) (-1743.600) (-1738.944) [-1743.255] * (-1746.458) (-1748.000) (-1738.356) [-1744.090] -- 0:05:00
187000 -- [-1745.843] (-1744.386) (-1738.210) (-1742.120) * (-1742.431) [-1746.227] (-1741.473) (-1737.882) -- 0:04:59
187500 -- (-1750.436) (-1745.191) (-1740.831) [-1751.992] * [-1736.665] (-1755.823) (-1739.113) (-1743.357) -- 0:04:59
188000 -- (-1735.755) [-1743.765] (-1746.542) (-1746.446) * (-1739.292) (-1750.799) [-1736.344] (-1745.072) -- 0:05:02
188500 -- (-1744.784) (-1745.231) (-1746.725) [-1737.428] * (-1744.166) [-1741.320] (-1743.347) (-1746.731) -- 0:05:01
189000 -- (-1744.977) (-1740.701) (-1746.368) [-1737.815] * (-1739.906) (-1740.613) (-1736.685) [-1741.143] -- 0:05:00
189500 -- (-1734.039) (-1742.536) [-1741.067] (-1743.948) * (-1747.630) (-1738.580) (-1736.051) [-1741.176] -- 0:04:59
190000 -- (-1736.633) (-1747.812) [-1742.897] (-1742.337) * (-1747.998) [-1740.337] (-1744.747) (-1744.950) -- 0:04:58
Average standard deviation of split frequencies: 0.015082
190500 -- (-1747.039) (-1748.464) (-1739.619) [-1737.800] * [-1747.761] (-1740.043) (-1740.491) (-1753.413) -- 0:04:57
191000 -- (-1739.760) (-1751.058) [-1743.777] (-1745.562) * (-1743.065) (-1745.730) (-1745.834) [-1738.935] -- 0:05:00
191500 -- (-1738.417) (-1744.140) (-1744.542) [-1740.399] * [-1738.140] (-1743.125) (-1749.548) (-1742.895) -- 0:04:59
192000 -- (-1744.089) (-1744.365) (-1745.049) [-1742.061] * (-1743.535) [-1740.980] (-1738.939) (-1740.489) -- 0:04:58
192500 -- [-1737.001] (-1745.318) (-1741.593) (-1736.374) * (-1749.375) (-1740.541) [-1748.436] (-1743.186) -- 0:04:57
193000 -- (-1739.646) [-1738.187] (-1741.760) (-1739.590) * [-1742.736] (-1746.142) (-1743.539) (-1740.469) -- 0:04:56
193500 -- (-1736.233) [-1740.677] (-1741.847) (-1746.361) * (-1752.124) [-1750.611] (-1741.042) (-1743.370) -- 0:04:55
194000 -- (-1738.756) [-1737.684] (-1743.261) (-1748.429) * (-1744.423) (-1751.748) (-1740.703) [-1737.494] -- 0:04:59
194500 -- (-1742.078) (-1749.059) [-1738.700] (-1750.371) * (-1742.504) (-1741.741) [-1743.006] (-1748.542) -- 0:04:58
195000 -- (-1743.625) [-1742.042] (-1741.987) (-1742.419) * (-1741.972) (-1747.868) (-1747.453) [-1740.192] -- 0:04:57
Average standard deviation of split frequencies: 0.015633
195500 -- (-1744.593) (-1743.971) [-1740.412] (-1744.577) * [-1740.882] (-1743.932) (-1755.549) (-1740.810) -- 0:04:56
196000 -- (-1742.218) [-1738.050] (-1738.979) (-1740.897) * (-1739.069) [-1742.292] (-1742.351) (-1739.309) -- 0:04:55
196500 -- (-1741.362) (-1741.957) (-1741.304) [-1747.406] * [-1741.487] (-1743.723) (-1746.524) (-1740.324) -- 0:04:54
197000 -- (-1745.863) (-1743.757) [-1738.840] (-1739.624) * (-1739.549) (-1743.512) (-1744.274) [-1740.495] -- 0:04:57
197500 -- (-1743.360) (-1745.673) [-1737.079] (-1740.916) * [-1735.762] (-1743.039) (-1739.239) (-1747.934) -- 0:04:56
198000 -- (-1743.319) (-1743.607) [-1739.048] (-1736.130) * [-1743.959] (-1749.363) (-1741.687) (-1741.637) -- 0:04:55
198500 -- (-1739.700) (-1742.320) [-1750.307] (-1736.882) * [-1737.387] (-1746.588) (-1735.875) (-1746.535) -- 0:04:54
199000 -- (-1740.240) [-1738.326] (-1750.943) (-1740.556) * (-1748.006) (-1745.031) [-1737.826] (-1740.012) -- 0:04:53
199500 -- (-1741.565) (-1738.041) [-1745.140] (-1746.391) * (-1740.844) (-1739.267) [-1740.302] (-1742.047) -- 0:04:56
200000 -- (-1736.563) (-1740.339) [-1747.282] (-1741.711) * [-1744.594] (-1741.489) (-1735.616) (-1746.894) -- 0:04:56
Average standard deviation of split frequencies: 0.017384
200500 -- [-1740.367] (-1738.574) (-1753.449) (-1739.589) * (-1745.819) (-1744.862) [-1746.975] (-1744.887) -- 0:04:55
201000 -- (-1742.753) [-1738.493] (-1749.979) (-1744.495) * [-1744.462] (-1742.097) (-1749.219) (-1741.224) -- 0:04:54
201500 -- (-1743.543) (-1739.050) (-1741.795) [-1746.561] * (-1737.592) [-1741.992] (-1743.590) (-1742.966) -- 0:04:53
202000 -- [-1739.450] (-1741.807) (-1743.230) (-1761.980) * (-1741.221) (-1741.969) (-1743.429) [-1741.518] -- 0:04:52
202500 -- (-1740.280) [-1737.902] (-1743.782) (-1751.697) * (-1740.021) [-1742.355] (-1740.670) (-1743.735) -- 0:04:55
203000 -- (-1745.366) (-1749.935) (-1739.539) [-1746.216] * (-1744.738) (-1740.519) [-1739.198] (-1741.409) -- 0:04:54
203500 -- (-1750.295) (-1741.591) (-1740.332) [-1742.051] * (-1747.223) (-1741.837) (-1750.955) [-1738.765] -- 0:04:53
204000 -- (-1741.452) [-1744.701] (-1745.979) (-1741.963) * (-1742.343) [-1745.344] (-1743.667) (-1743.084) -- 0:04:52
204500 -- (-1748.583) [-1737.603] (-1743.775) (-1739.116) * (-1744.922) (-1746.612) (-1745.253) [-1750.755] -- 0:04:51
205000 -- (-1754.082) (-1739.717) (-1745.924) [-1735.480] * [-1735.202] (-1741.414) (-1742.113) (-1736.339) -- 0:04:50
Average standard deviation of split frequencies: 0.022052
205500 -- [-1741.874] (-1742.479) (-1745.760) (-1745.965) * (-1740.242) (-1740.992) (-1736.418) [-1740.810] -- 0:04:53
206000 -- (-1738.469) (-1747.427) [-1742.021] (-1736.500) * [-1740.351] (-1745.615) (-1744.320) (-1749.366) -- 0:04:52
206500 -- (-1743.122) (-1744.770) [-1741.748] (-1737.589) * (-1753.306) (-1736.461) [-1747.860] (-1750.106) -- 0:04:52
207000 -- (-1747.977) (-1751.105) [-1736.836] (-1741.796) * [-1744.130] (-1740.413) (-1736.237) (-1742.099) -- 0:04:51
207500 -- (-1738.924) (-1746.953) (-1743.784) [-1739.754] * (-1742.489) [-1741.900] (-1741.639) (-1746.205) -- 0:04:50
208000 -- (-1744.716) [-1741.272] (-1738.852) (-1747.234) * (-1743.022) (-1745.011) [-1740.196] (-1743.221) -- 0:04:49
208500 -- (-1742.605) [-1744.365] (-1746.090) (-1737.623) * [-1743.762] (-1742.397) (-1750.044) (-1734.468) -- 0:04:52
209000 -- (-1744.149) (-1740.404) (-1741.807) [-1737.854] * (-1741.059) [-1744.436] (-1735.188) (-1740.486) -- 0:04:51
209500 -- (-1745.410) [-1743.786] (-1749.059) (-1739.701) * (-1748.672) [-1733.002] (-1748.791) (-1749.406) -- 0:04:50
210000 -- (-1744.518) (-1743.996) [-1741.637] (-1740.876) * (-1746.438) [-1739.146] (-1739.562) (-1738.915) -- 0:04:49
Average standard deviation of split frequencies: 0.021156
210500 -- (-1742.632) (-1740.488) [-1745.922] (-1747.179) * [-1738.606] (-1742.052) (-1742.993) (-1737.319) -- 0:04:48
211000 -- [-1744.544] (-1738.649) (-1743.120) (-1746.359) * [-1739.372] (-1741.871) (-1749.906) (-1748.434) -- 0:04:51
211500 -- (-1748.233) (-1743.005) [-1734.781] (-1750.958) * (-1744.693) (-1745.541) (-1741.716) [-1741.209] -- 0:04:50
212000 -- (-1746.060) (-1743.090) [-1744.615] (-1737.586) * (-1739.520) (-1743.520) (-1748.751) [-1735.692] -- 0:04:49
212500 -- (-1740.141) (-1747.150) (-1748.750) [-1746.078] * (-1745.773) [-1742.661] (-1742.206) (-1739.537) -- 0:04:49
213000 -- [-1748.726] (-1744.662) (-1746.102) (-1742.939) * (-1740.336) (-1743.599) [-1743.847] (-1736.766) -- 0:04:48
213500 -- (-1748.096) (-1739.564) [-1740.040] (-1745.641) * (-1740.826) (-1738.987) [-1738.650] (-1749.722) -- 0:04:47
214000 -- (-1741.793) (-1743.730) [-1738.435] (-1747.327) * (-1745.121) [-1740.212] (-1744.196) (-1738.075) -- 0:04:50
214500 -- (-1752.048) (-1757.173) [-1745.304] (-1738.033) * (-1737.125) (-1739.288) (-1745.212) [-1743.620] -- 0:04:49
215000 -- (-1737.622) (-1756.733) (-1735.828) [-1737.516] * (-1742.321) (-1741.608) [-1738.384] (-1748.237) -- 0:04:48
Average standard deviation of split frequencies: 0.021170
215500 -- (-1741.708) (-1743.864) [-1739.936] (-1744.118) * (-1739.266) [-1747.171] (-1747.717) (-1740.014) -- 0:04:47
216000 -- (-1742.121) [-1739.619] (-1739.259) (-1743.585) * (-1742.557) (-1748.644) [-1741.325] (-1738.507) -- 0:04:46
216500 -- (-1746.070) (-1743.150) (-1740.514) [-1739.209] * (-1742.345) [-1744.630] (-1741.466) (-1742.949) -- 0:04:45
217000 -- (-1744.989) (-1746.205) (-1743.166) [-1737.813] * (-1742.169) (-1737.872) [-1748.091] (-1746.745) -- 0:04:48
217500 -- [-1748.106] (-1738.675) (-1737.537) (-1751.278) * (-1748.581) (-1741.642) [-1739.967] (-1742.612) -- 0:04:47
218000 -- [-1741.724] (-1741.411) (-1750.198) (-1738.147) * [-1741.367] (-1741.289) (-1748.671) (-1741.192) -- 0:04:46
218500 -- (-1737.684) (-1739.198) [-1743.413] (-1739.946) * (-1755.072) (-1743.493) [-1743.749] (-1747.409) -- 0:04:46
219000 -- (-1739.681) (-1740.853) (-1744.665) [-1738.455] * (-1734.931) (-1745.404) [-1735.796] (-1741.932) -- 0:04:45
219500 -- (-1745.213) (-1738.922) (-1747.427) [-1744.801] * (-1739.619) (-1744.993) (-1747.859) [-1740.985] -- 0:04:44
220000 -- [-1740.887] (-1739.460) (-1737.961) (-1741.723) * (-1741.016) [-1743.476] (-1736.438) (-1745.672) -- 0:04:47
Average standard deviation of split frequencies: 0.019867
220500 -- (-1741.154) [-1736.314] (-1742.525) (-1741.633) * [-1737.393] (-1747.058) (-1745.832) (-1737.149) -- 0:04:46
221000 -- [-1739.012] (-1743.538) (-1752.907) (-1735.554) * [-1742.970] (-1744.715) (-1737.350) (-1743.574) -- 0:04:45
221500 -- (-1744.231) [-1738.763] (-1743.901) (-1738.799) * (-1743.793) (-1746.345) (-1746.765) [-1748.380] -- 0:04:44
222000 -- (-1740.928) (-1741.577) (-1734.773) [-1738.577] * [-1744.173] (-1745.767) (-1742.345) (-1747.056) -- 0:04:43
222500 -- [-1741.081] (-1746.561) (-1733.883) (-1749.965) * (-1742.669) (-1747.343) (-1742.242) [-1744.757] -- 0:04:46
223000 -- [-1737.851] (-1741.825) (-1741.479) (-1751.340) * (-1749.995) [-1750.515] (-1738.822) (-1742.067) -- 0:04:45
223500 -- (-1743.153) (-1741.156) [-1735.978] (-1743.193) * (-1741.681) (-1739.328) [-1738.101] (-1744.977) -- 0:04:44
224000 -- (-1748.039) (-1739.038) [-1737.197] (-1739.185) * (-1733.745) (-1742.882) [-1736.676] (-1751.001) -- 0:04:44
224500 -- [-1750.493] (-1739.848) (-1744.088) (-1740.916) * (-1740.829) [-1743.659] (-1747.846) (-1742.239) -- 0:04:43
225000 -- (-1744.772) (-1741.407) [-1739.329] (-1740.301) * (-1746.936) [-1742.614] (-1741.318) (-1736.731) -- 0:04:42
Average standard deviation of split frequencies: 0.018981
225500 -- (-1742.297) [-1739.856] (-1741.823) (-1745.865) * [-1741.426] (-1747.220) (-1738.208) (-1736.560) -- 0:04:45
226000 -- (-1746.238) (-1737.243) [-1744.989] (-1753.707) * (-1741.358) (-1741.816) (-1747.068) [-1739.988] -- 0:04:44
226500 -- (-1746.803) (-1743.683) (-1748.726) [-1741.654] * (-1734.252) (-1744.030) (-1746.555) [-1738.956] -- 0:04:43
227000 -- (-1742.489) (-1743.316) (-1737.751) [-1742.283] * [-1742.035] (-1750.219) (-1743.869) (-1748.847) -- 0:04:42
227500 -- (-1745.199) (-1736.547) [-1739.599] (-1746.805) * (-1747.978) [-1743.876] (-1734.615) (-1741.983) -- 0:04:41
228000 -- (-1742.432) [-1744.437] (-1744.757) (-1749.379) * (-1746.664) (-1744.644) [-1746.800] (-1749.328) -- 0:04:41
228500 -- (-1742.836) (-1738.143) [-1737.295] (-1738.968) * [-1740.937] (-1746.886) (-1745.643) (-1740.678) -- 0:04:43
229000 -- (-1743.614) (-1736.183) (-1750.958) [-1740.411] * [-1735.253] (-1745.827) (-1748.429) (-1748.034) -- 0:04:42
229500 -- [-1738.035] (-1741.410) (-1747.980) (-1740.702) * (-1747.382) (-1744.858) (-1744.163) [-1736.315] -- 0:04:42
230000 -- [-1743.756] (-1748.438) (-1741.267) (-1743.658) * (-1740.285) (-1748.798) (-1744.434) [-1742.742] -- 0:04:41
Average standard deviation of split frequencies: 0.018393
230500 -- [-1742.261] (-1742.473) (-1740.058) (-1740.020) * (-1743.334) (-1744.814) (-1744.233) [-1741.696] -- 0:04:40
231000 -- (-1740.525) (-1751.721) (-1749.038) [-1742.177] * [-1746.037] (-1744.073) (-1743.494) (-1745.330) -- 0:04:39
231500 -- [-1742.572] (-1746.732) (-1736.718) (-1738.744) * (-1741.155) [-1743.698] (-1750.392) (-1741.951) -- 0:04:42
232000 -- [-1740.804] (-1748.482) (-1749.920) (-1743.734) * (-1741.099) (-1743.723) [-1736.503] (-1739.841) -- 0:04:41
232500 -- [-1746.993] (-1752.287) (-1737.669) (-1745.782) * (-1738.901) (-1744.634) [-1742.116] (-1754.268) -- 0:04:40
233000 -- (-1745.172) [-1741.188] (-1736.048) (-1746.598) * (-1740.706) (-1741.281) [-1737.989] (-1754.989) -- 0:04:39
233500 -- [-1735.997] (-1746.404) (-1740.621) (-1749.135) * (-1737.753) (-1742.744) (-1741.773) [-1740.147] -- 0:04:39
234000 -- (-1738.969) [-1736.770] (-1740.024) (-1746.707) * [-1739.436] (-1742.945) (-1736.416) (-1750.671) -- 0:04:41
234500 -- [-1738.245] (-1742.287) (-1741.951) (-1745.124) * (-1742.580) [-1746.526] (-1737.589) (-1743.974) -- 0:04:40
235000 -- (-1740.422) [-1740.774] (-1736.893) (-1745.956) * (-1741.784) (-1747.720) (-1750.992) [-1745.099] -- 0:04:39
Average standard deviation of split frequencies: 0.018577
235500 -- [-1739.578] (-1742.004) (-1748.440) (-1751.165) * (-1743.597) [-1736.810] (-1738.559) (-1742.739) -- 0:04:39
236000 -- (-1744.747) [-1736.868] (-1745.951) (-1741.629) * (-1748.667) [-1744.571] (-1744.390) (-1749.016) -- 0:04:38
236500 -- (-1746.648) [-1741.965] (-1743.180) (-1741.611) * (-1745.090) [-1742.183] (-1746.917) (-1746.730) -- 0:04:37
237000 -- (-1746.915) (-1740.114) [-1737.722] (-1740.198) * (-1754.383) [-1742.508] (-1744.022) (-1748.929) -- 0:04:40
237500 -- (-1747.775) (-1739.944) [-1743.646] (-1742.017) * (-1753.877) (-1742.060) (-1748.301) [-1742.966] -- 0:04:39
238000 -- (-1736.996) (-1740.809) [-1744.442] (-1741.065) * (-1743.511) (-1747.137) [-1735.828] (-1745.222) -- 0:04:38
238500 -- (-1743.394) (-1755.277) [-1741.880] (-1738.339) * (-1749.045) (-1746.601) (-1742.929) [-1737.831] -- 0:04:37
239000 -- (-1743.527) (-1741.841) [-1735.801] (-1751.121) * (-1742.879) (-1744.850) [-1742.139] (-1749.759) -- 0:04:37
239500 -- [-1737.426] (-1747.570) (-1735.350) (-1740.774) * [-1739.607] (-1742.574) (-1742.062) (-1752.127) -- 0:04:36
240000 -- (-1753.626) [-1742.768] (-1736.911) (-1746.533) * [-1743.832] (-1746.335) (-1740.830) (-1750.861) -- 0:04:38
Average standard deviation of split frequencies: 0.017433
240500 -- (-1740.500) [-1743.754] (-1747.036) (-1739.539) * (-1740.403) (-1738.701) (-1741.527) [-1737.454] -- 0:04:37
241000 -- (-1747.426) (-1743.281) (-1740.262) [-1743.921] * [-1749.253] (-1741.188) (-1737.510) (-1742.123) -- 0:04:37
241500 -- (-1741.308) (-1737.611) [-1739.977] (-1744.443) * (-1741.346) (-1737.890) (-1739.406) [-1740.790] -- 0:04:36
242000 -- (-1751.472) (-1736.108) [-1738.283] (-1747.921) * (-1750.381) [-1741.872] (-1744.679) (-1740.354) -- 0:04:35
242500 -- (-1738.790) [-1743.623] (-1742.198) (-1750.768) * (-1745.436) (-1747.700) (-1753.815) [-1736.306] -- 0:04:34
243000 -- (-1740.201) (-1745.962) (-1743.510) [-1741.991] * (-1737.926) (-1743.171) (-1743.641) [-1744.668] -- 0:04:37
243500 -- (-1741.392) [-1734.970] (-1741.000) (-1749.799) * (-1745.271) (-1743.537) (-1738.773) [-1736.649] -- 0:04:36
244000 -- (-1744.645) (-1742.358) (-1744.639) [-1741.113] * (-1734.061) (-1748.710) (-1743.617) [-1737.322] -- 0:04:35
244500 -- (-1741.028) (-1740.828) [-1737.468] (-1749.188) * [-1743.331] (-1744.433) (-1743.113) (-1740.982) -- 0:04:35
245000 -- (-1746.511) (-1745.292) (-1739.670) [-1745.576] * [-1740.482] (-1750.086) (-1744.585) (-1743.256) -- 0:04:34
Average standard deviation of split frequencies: 0.019738
245500 -- (-1744.507) (-1742.035) [-1749.184] (-1745.081) * (-1741.552) [-1745.543] (-1748.514) (-1749.838) -- 0:04:36
246000 -- (-1740.555) (-1744.408) [-1739.754] (-1742.281) * [-1738.225] (-1746.428) (-1763.341) (-1737.143) -- 0:04:35
246500 -- (-1738.788) [-1741.342] (-1744.288) (-1747.645) * (-1738.816) (-1738.811) (-1746.201) [-1740.139] -- 0:04:35
247000 -- [-1743.745] (-1741.137) (-1751.807) (-1737.458) * (-1733.874) (-1740.134) [-1743.819] (-1746.089) -- 0:04:34
247500 -- (-1737.871) (-1739.754) [-1747.734] (-1744.101) * (-1739.269) [-1739.020] (-1746.574) (-1731.271) -- 0:04:33
248000 -- [-1739.353] (-1749.753) (-1740.139) (-1746.689) * [-1741.892] (-1741.476) (-1747.058) (-1737.530) -- 0:04:32
248500 -- (-1741.793) (-1743.835) [-1736.184] (-1743.550) * (-1739.250) (-1743.516) [-1737.767] (-1740.567) -- 0:04:35
249000 -- (-1743.800) (-1755.581) [-1738.411] (-1744.673) * (-1742.459) (-1758.120) [-1736.043] (-1743.442) -- 0:04:34
249500 -- (-1744.964) (-1740.362) [-1743.556] (-1744.040) * [-1741.605] (-1750.959) (-1740.649) (-1745.776) -- 0:04:33
250000 -- (-1742.115) (-1741.668) (-1736.305) [-1751.541] * (-1741.304) (-1740.654) [-1739.143] (-1740.889) -- 0:04:33
Average standard deviation of split frequencies: 0.021439
250500 -- (-1742.293) (-1746.786) (-1747.530) [-1741.592] * (-1745.193) (-1743.990) [-1738.474] (-1755.128) -- 0:04:32
251000 -- (-1736.325) (-1739.641) (-1746.328) [-1743.874] * (-1743.515) [-1750.409] (-1741.500) (-1749.074) -- 0:04:31
251500 -- (-1744.530) [-1743.857] (-1744.838) (-1744.945) * (-1749.403) (-1743.416) [-1743.498] (-1740.030) -- 0:04:33
252000 -- (-1744.159) (-1741.514) [-1753.296] (-1755.156) * [-1740.678] (-1745.599) (-1749.373) (-1740.154) -- 0:04:33
252500 -- [-1740.691] (-1743.661) (-1749.715) (-1747.493) * (-1742.355) (-1740.691) [-1741.964] (-1743.694) -- 0:04:32
253000 -- [-1733.994] (-1741.905) (-1737.288) (-1752.307) * [-1743.138] (-1737.663) (-1736.569) (-1743.406) -- 0:04:31
253500 -- (-1734.923) [-1744.713] (-1747.008) (-1743.696) * (-1740.729) [-1740.734] (-1744.092) (-1742.185) -- 0:04:30
254000 -- [-1738.527] (-1742.535) (-1755.849) (-1738.231) * (-1745.328) [-1735.307] (-1742.948) (-1740.673) -- 0:04:30
254500 -- [-1751.383] (-1747.456) (-1738.769) (-1743.487) * (-1741.825) (-1740.901) [-1736.132] (-1743.479) -- 0:04:32
255000 -- [-1741.689] (-1746.894) (-1739.756) (-1745.456) * (-1737.616) (-1737.034) [-1733.703] (-1741.890) -- 0:04:31
Average standard deviation of split frequencies: 0.021913
255500 -- (-1743.230) (-1735.331) [-1745.904] (-1744.102) * (-1737.025) (-1753.657) (-1741.255) [-1735.535] -- 0:04:30
256000 -- (-1737.613) (-1739.687) [-1739.691] (-1740.394) * (-1743.187) (-1741.209) [-1743.413] (-1741.210) -- 0:04:30
256500 -- (-1740.739) [-1738.356] (-1739.086) (-1741.461) * (-1744.426) [-1735.804] (-1746.728) (-1746.137) -- 0:04:29
257000 -- (-1744.668) (-1740.594) [-1739.829] (-1742.909) * [-1735.672] (-1738.874) (-1743.188) (-1742.796) -- 0:04:31
257500 -- (-1738.919) (-1750.025) [-1734.238] (-1737.989) * (-1741.986) (-1741.240) (-1744.087) [-1744.036] -- 0:04:31
258000 -- (-1748.077) (-1743.654) (-1741.873) [-1746.779] * (-1735.864) (-1738.650) (-1755.846) [-1743.704] -- 0:04:30
258500 -- (-1740.790) [-1744.109] (-1745.545) (-1742.066) * (-1751.879) [-1739.917] (-1740.516) (-1744.532) -- 0:04:29
259000 -- [-1748.904] (-1746.136) (-1747.519) (-1744.886) * [-1741.011] (-1746.879) (-1742.816) (-1741.655) -- 0:04:28
259500 -- (-1741.082) (-1752.007) [-1748.177] (-1737.292) * (-1743.463) (-1745.801) (-1740.479) [-1745.770] -- 0:04:28
260000 -- (-1747.750) (-1748.225) [-1753.930] (-1738.007) * (-1752.705) (-1740.281) (-1738.957) [-1741.219] -- 0:04:30
Average standard deviation of split frequencies: 0.022606
260500 -- (-1747.816) (-1748.935) (-1751.023) [-1737.052] * [-1742.476] (-1744.518) (-1738.516) (-1744.024) -- 0:04:29
261000 -- (-1739.259) (-1742.652) (-1744.200) [-1742.149] * (-1740.930) [-1736.432] (-1743.952) (-1747.993) -- 0:04:28
261500 -- (-1745.756) (-1738.610) [-1742.994] (-1748.797) * [-1733.307] (-1746.901) (-1745.648) (-1742.946) -- 0:04:28
262000 -- (-1746.373) [-1738.243] (-1739.744) (-1742.101) * [-1735.388] (-1740.193) (-1740.476) (-1750.592) -- 0:04:27
262500 -- (-1740.053) (-1742.957) (-1744.091) [-1742.269] * (-1737.951) [-1743.447] (-1739.774) (-1746.649) -- 0:04:26
263000 -- (-1742.177) (-1742.733) (-1747.771) [-1742.229] * [-1739.807] (-1740.991) (-1743.784) (-1744.141) -- 0:04:29
263500 -- [-1753.723] (-1738.813) (-1742.447) (-1738.357) * [-1737.785] (-1742.427) (-1744.607) (-1749.218) -- 0:04:28
264000 -- (-1749.377) (-1754.207) (-1747.629) [-1744.635] * (-1744.692) (-1741.891) [-1739.159] (-1741.830) -- 0:04:27
264500 -- (-1744.706) [-1739.424] (-1742.930) (-1742.377) * (-1738.081) [-1738.731] (-1736.048) (-1742.657) -- 0:04:26
265000 -- (-1741.172) (-1739.638) (-1743.685) [-1748.489] * (-1743.656) (-1745.659) (-1737.210) [-1745.986] -- 0:04:26
Average standard deviation of split frequencies: 0.021444
265500 -- (-1746.705) [-1739.726] (-1741.836) (-1744.728) * (-1742.750) (-1740.271) [-1735.648] (-1746.534) -- 0:04:25
266000 -- (-1742.776) (-1745.364) [-1743.722] (-1741.121) * (-1738.757) [-1745.752] (-1738.440) (-1743.781) -- 0:04:27
266500 -- [-1737.729] (-1741.477) (-1744.147) (-1741.001) * (-1741.185) (-1740.118) [-1740.342] (-1736.860) -- 0:04:26
267000 -- (-1744.742) (-1742.831) [-1737.045] (-1742.405) * (-1741.360) [-1735.007] (-1745.632) (-1741.786) -- 0:04:26
267500 -- (-1747.685) (-1745.415) (-1742.603) [-1747.340] * (-1740.121) [-1734.793] (-1747.974) (-1743.958) -- 0:04:25
268000 -- (-1745.917) (-1749.309) (-1740.826) [-1740.367] * (-1739.723) [-1741.926] (-1740.808) (-1745.697) -- 0:04:24
268500 -- (-1739.676) [-1735.545] (-1750.344) (-1751.675) * (-1741.507) [-1742.302] (-1744.658) (-1743.106) -- 0:04:24
269000 -- (-1741.080) [-1737.576] (-1749.979) (-1739.615) * (-1743.412) (-1748.567) (-1746.622) [-1740.358] -- 0:04:26
269500 -- [-1741.328] (-1738.829) (-1739.715) (-1746.102) * (-1750.015) (-1741.053) [-1739.760] (-1741.182) -- 0:04:25
270000 -- [-1744.751] (-1743.481) (-1739.239) (-1740.393) * (-1741.180) (-1742.070) [-1735.871] (-1741.699) -- 0:04:24
Average standard deviation of split frequencies: 0.019332
270500 -- [-1746.329] (-1750.184) (-1733.957) (-1741.606) * (-1740.484) (-1737.157) (-1741.688) [-1742.953] -- 0:04:24
271000 -- (-1740.696) (-1751.162) (-1747.627) [-1737.579] * [-1742.135] (-1743.027) (-1742.100) (-1742.074) -- 0:04:23
271500 -- [-1740.739] (-1748.238) (-1742.575) (-1752.471) * [-1745.998] (-1749.817) (-1742.562) (-1752.151) -- 0:04:25
272000 -- [-1743.273] (-1744.830) (-1737.247) (-1747.417) * (-1741.739) [-1745.994] (-1742.715) (-1741.321) -- 0:04:24
272500 -- (-1736.518) (-1741.681) [-1740.459] (-1743.299) * (-1739.402) (-1743.576) (-1741.671) [-1738.062] -- 0:04:24
273000 -- [-1738.434] (-1741.161) (-1739.305) (-1742.580) * [-1743.436] (-1750.184) (-1741.728) (-1742.203) -- 0:04:23
273500 -- (-1748.821) (-1741.115) (-1738.352) [-1740.981] * (-1736.411) (-1751.067) [-1744.940] (-1744.723) -- 0:04:22
274000 -- (-1743.121) (-1749.181) [-1737.240] (-1748.536) * (-1743.132) (-1744.862) (-1749.362) [-1736.007] -- 0:04:22
274500 -- (-1741.996) [-1747.152] (-1735.729) (-1751.403) * (-1749.111) [-1738.243] (-1735.696) (-1739.005) -- 0:04:24
275000 -- [-1739.592] (-1740.503) (-1740.514) (-1749.328) * (-1738.221) (-1746.140) (-1742.025) [-1734.758] -- 0:04:23
Average standard deviation of split frequencies: 0.016738
275500 -- (-1742.749) [-1738.858] (-1746.573) (-1762.138) * (-1737.851) (-1742.772) (-1747.111) [-1742.623] -- 0:04:22
276000 -- [-1737.081] (-1746.763) (-1748.296) (-1747.268) * (-1736.685) (-1748.713) [-1740.682] (-1745.298) -- 0:04:22
276500 -- (-1739.818) (-1745.299) (-1738.172) [-1743.772] * [-1738.349] (-1740.630) (-1738.700) (-1747.873) -- 0:04:21
277000 -- (-1734.871) [-1739.781] (-1747.249) (-1742.620) * (-1744.318) (-1751.050) (-1740.430) [-1744.771] -- 0:04:21
277500 -- [-1737.885] (-1741.050) (-1741.818) (-1746.013) * (-1739.172) (-1745.580) (-1746.293) [-1744.254] -- 0:04:22
278000 -- [-1734.941] (-1740.740) (-1738.869) (-1746.215) * (-1740.685) (-1737.981) [-1743.159] (-1744.709) -- 0:04:22
278500 -- (-1740.676) (-1751.881) [-1742.679] (-1742.813) * [-1740.532] (-1734.461) (-1743.083) (-1742.636) -- 0:04:21
279000 -- (-1740.187) [-1738.943] (-1750.059) (-1746.881) * (-1739.925) (-1744.757) (-1741.571) [-1738.730] -- 0:04:21
279500 -- (-1741.742) [-1740.479] (-1749.025) (-1742.581) * (-1747.969) (-1737.944) [-1745.317] (-1750.712) -- 0:04:20
280000 -- (-1743.367) [-1735.996] (-1745.706) (-1744.356) * (-1743.543) (-1747.376) (-1740.953) [-1737.166] -- 0:04:22
Average standard deviation of split frequencies: 0.018475
280500 -- (-1742.574) (-1738.016) [-1746.226] (-1745.596) * [-1742.923] (-1750.522) (-1745.667) (-1738.543) -- 0:04:21
281000 -- (-1738.643) [-1740.480] (-1738.608) (-1744.555) * (-1751.967) (-1747.616) (-1743.114) [-1737.882] -- 0:04:20
281500 -- (-1737.664) (-1742.648) (-1740.067) [-1741.418] * [-1743.753] (-1737.441) (-1740.123) (-1739.017) -- 0:04:20
282000 -- (-1744.092) (-1740.684) (-1735.535) [-1740.460] * (-1744.074) [-1737.895] (-1735.844) (-1746.601) -- 0:04:19
282500 -- (-1743.852) (-1745.230) (-1743.113) [-1740.618] * (-1741.852) (-1739.152) [-1739.742] (-1737.337) -- 0:04:19
283000 -- (-1745.344) [-1736.991] (-1753.860) (-1738.291) * (-1745.835) (-1745.944) [-1735.998] (-1740.271) -- 0:04:20
283500 -- (-1738.234) [-1736.810] (-1756.934) (-1742.035) * (-1745.847) [-1745.434] (-1743.805) (-1744.295) -- 0:04:20
284000 -- (-1744.015) (-1736.705) (-1744.687) [-1746.841] * [-1744.226] (-1738.033) (-1740.944) (-1736.229) -- 0:04:19
284500 -- (-1741.895) [-1737.983] (-1740.613) (-1748.709) * (-1742.048) (-1734.738) [-1745.737] (-1744.896) -- 0:04:19
285000 -- (-1765.523) (-1737.745) [-1738.681] (-1743.551) * [-1744.418] (-1740.036) (-1743.299) (-1750.903) -- 0:04:18
Average standard deviation of split frequencies: 0.016648
285500 -- (-1750.347) (-1747.959) [-1740.152] (-1738.336) * (-1746.969) [-1735.281] (-1750.068) (-1744.089) -- 0:04:17
286000 -- (-1737.544) [-1738.870] (-1743.947) (-1744.379) * (-1741.342) (-1740.143) (-1739.058) [-1740.178] -- 0:04:19
286500 -- (-1744.903) (-1735.854) (-1743.670) [-1747.241] * (-1747.466) (-1744.587) [-1742.556] (-1741.154) -- 0:04:19
287000 -- (-1751.214) (-1740.800) [-1745.028] (-1748.938) * (-1750.139) [-1738.701] (-1745.711) (-1737.694) -- 0:04:18
287500 -- (-1746.833) (-1740.221) (-1750.097) [-1747.613] * (-1746.769) (-1743.769) (-1747.238) [-1733.385] -- 0:04:17
288000 -- (-1737.010) (-1742.258) (-1750.514) [-1738.279] * (-1739.732) (-1747.213) [-1737.627] (-1746.316) -- 0:04:17
288500 -- (-1746.310) (-1741.743) [-1741.207] (-1750.808) * [-1735.723] (-1741.268) (-1747.325) (-1739.939) -- 0:04:16
289000 -- (-1745.917) (-1752.097) (-1740.815) [-1739.804] * (-1742.149) [-1744.588] (-1744.376) (-1749.738) -- 0:04:18
289500 -- [-1740.446] (-1744.377) (-1735.278) (-1745.564) * [-1739.415] (-1746.792) (-1744.483) (-1742.782) -- 0:04:17
290000 -- [-1743.021] (-1744.306) (-1742.039) (-1748.801) * (-1740.598) (-1745.370) (-1739.341) [-1737.817] -- 0:04:17
Average standard deviation of split frequencies: 0.015083
290500 -- (-1751.119) (-1743.620) [-1739.663] (-1741.227) * (-1736.133) [-1739.232] (-1741.260) (-1747.680) -- 0:04:16
291000 -- (-1743.421) [-1741.918] (-1745.129) (-1750.676) * (-1739.435) (-1746.263) (-1742.574) [-1740.241] -- 0:04:15
291500 -- (-1738.180) [-1738.134] (-1743.398) (-1742.885) * (-1742.961) [-1747.269] (-1742.685) (-1741.420) -- 0:04:17
292000 -- [-1749.260] (-1753.127) (-1744.848) (-1744.428) * [-1736.986] (-1744.125) (-1738.587) (-1738.599) -- 0:04:17
292500 -- (-1739.496) (-1745.603) (-1741.341) [-1746.273] * (-1737.026) (-1741.880) [-1749.023] (-1747.126) -- 0:04:16
293000 -- (-1738.980) (-1740.144) (-1739.199) [-1738.418] * (-1738.215) (-1743.260) [-1738.576] (-1740.206) -- 0:04:15
293500 -- (-1743.087) [-1738.697] (-1746.936) (-1746.139) * (-1744.726) (-1741.173) (-1740.848) [-1734.880] -- 0:04:15
294000 -- (-1742.212) [-1740.505] (-1737.791) (-1741.723) * (-1742.759) (-1747.257) [-1738.519] (-1739.356) -- 0:04:14
294500 -- (-1737.329) (-1741.964) [-1738.699] (-1749.578) * [-1751.137] (-1746.435) (-1740.663) (-1744.416) -- 0:04:16
295000 -- (-1745.026) (-1744.281) [-1740.203] (-1743.052) * [-1743.825] (-1737.688) (-1741.445) (-1744.920) -- 0:04:15
Average standard deviation of split frequencies: 0.013855
295500 -- (-1737.043) (-1741.807) [-1737.643] (-1747.266) * (-1741.643) (-1746.074) (-1742.633) [-1736.153] -- 0:04:15
296000 -- (-1742.730) [-1742.875] (-1744.750) (-1742.627) * [-1742.527] (-1744.909) (-1744.349) (-1736.076) -- 0:04:14
296500 -- (-1740.474) (-1740.987) (-1744.706) [-1738.547] * (-1738.482) (-1741.042) [-1736.423] (-1740.410) -- 0:04:13
297000 -- [-1740.140] (-1740.331) (-1746.049) (-1750.108) * (-1743.950) (-1751.318) (-1749.690) [-1739.189] -- 0:04:13
297500 -- (-1744.759) (-1745.071) (-1751.536) [-1747.633] * (-1744.690) [-1741.759] (-1739.650) (-1743.264) -- 0:04:15
298000 -- (-1750.708) (-1744.838) (-1740.983) [-1742.598] * [-1734.009] (-1740.303) (-1748.914) (-1736.621) -- 0:04:14
298500 -- (-1743.207) (-1746.799) (-1738.930) [-1737.257] * (-1741.163) (-1751.205) [-1734.354] (-1737.351) -- 0:04:13
299000 -- (-1745.264) (-1737.256) [-1735.284] (-1739.256) * (-1742.224) (-1750.209) (-1742.674) [-1738.761] -- 0:04:13
299500 -- (-1744.612) (-1744.819) [-1735.106] (-1740.178) * (-1743.464) (-1738.788) (-1745.754) [-1747.057] -- 0:04:12
300000 -- (-1763.925) (-1739.332) [-1737.731] (-1744.307) * (-1740.594) (-1744.679) (-1743.111) [-1739.778] -- 0:04:14
Average standard deviation of split frequencies: 0.013640
300500 -- (-1749.233) (-1744.264) (-1744.382) [-1741.060] * (-1749.501) (-1741.330) [-1742.801] (-1743.349) -- 0:04:13
301000 -- (-1752.576) (-1745.088) [-1738.676] (-1739.769) * (-1742.294) (-1743.313) (-1745.459) [-1744.401] -- 0:04:13
301500 -- (-1746.366) (-1743.164) [-1739.520] (-1745.401) * (-1749.715) [-1739.842] (-1744.070) (-1747.118) -- 0:04:12
302000 -- (-1744.934) (-1749.130) [-1740.995] (-1744.753) * (-1742.768) (-1746.850) [-1740.238] (-1751.562) -- 0:04:11
302500 -- (-1747.725) (-1739.542) [-1748.814] (-1740.860) * (-1742.429) (-1740.613) [-1744.830] (-1744.416) -- 0:04:11
303000 -- (-1747.914) (-1736.640) [-1742.029] (-1742.095) * [-1739.920] (-1736.173) (-1745.238) (-1747.536) -- 0:04:13
303500 -- (-1752.182) (-1758.181) (-1745.151) [-1739.049] * (-1741.414) (-1739.596) [-1740.057] (-1747.704) -- 0:04:12
304000 -- (-1751.405) (-1749.553) [-1735.685] (-1740.433) * (-1736.940) (-1749.372) (-1740.893) [-1738.340] -- 0:04:11
304500 -- [-1741.366] (-1754.653) (-1743.487) (-1749.399) * (-1743.627) (-1748.501) [-1741.763] (-1739.515) -- 0:04:11
305000 -- (-1742.966) (-1750.142) [-1735.623] (-1741.240) * [-1742.111] (-1742.060) (-1738.414) (-1740.875) -- 0:04:10
Average standard deviation of split frequencies: 0.013557
305500 -- (-1741.461) (-1746.971) (-1744.557) [-1741.392] * [-1738.827] (-1747.172) (-1742.278) (-1744.785) -- 0:04:12
306000 -- (-1746.742) (-1745.709) (-1743.786) [-1744.632] * (-1748.478) [-1740.574] (-1743.489) (-1739.217) -- 0:04:11
306500 -- (-1747.711) (-1744.302) (-1747.028) [-1746.967] * (-1741.554) [-1734.876] (-1745.837) (-1738.400) -- 0:04:11
307000 -- (-1743.238) (-1743.785) (-1757.641) [-1744.197] * (-1746.440) [-1744.510] (-1737.933) (-1741.050) -- 0:04:10
307500 -- (-1737.851) (-1740.807) (-1747.695) [-1738.972] * (-1747.889) (-1744.550) (-1745.114) [-1745.994] -- 0:04:09
308000 -- (-1738.224) [-1735.741] (-1744.295) (-1742.858) * (-1751.646) (-1749.167) (-1746.322) [-1740.848] -- 0:04:09
308500 -- (-1748.398) (-1739.078) (-1743.275) [-1734.365] * [-1746.577] (-1751.702) (-1749.362) (-1739.374) -- 0:04:11
309000 -- (-1740.034) (-1743.303) [-1740.574] (-1733.866) * (-1746.937) (-1737.721) (-1745.329) [-1744.480] -- 0:04:10
309500 -- [-1744.393] (-1752.379) (-1741.525) (-1739.136) * (-1745.696) [-1736.192] (-1748.536) (-1759.457) -- 0:04:09
310000 -- (-1746.111) [-1742.768] (-1736.942) (-1735.555) * (-1739.568) (-1747.761) (-1740.094) [-1737.920] -- 0:04:09
Average standard deviation of split frequencies: 0.014112
310500 -- (-1748.634) [-1748.164] (-1736.847) (-1744.788) * (-1745.627) (-1745.502) [-1738.952] (-1739.341) -- 0:04:08
311000 -- (-1751.500) [-1748.821] (-1744.564) (-1743.133) * [-1741.383] (-1745.438) (-1740.692) (-1739.887) -- 0:04:08
311500 -- (-1754.221) [-1739.158] (-1748.141) (-1744.637) * [-1742.184] (-1746.508) (-1743.706) (-1739.513) -- 0:04:09
312000 -- [-1736.412] (-1747.080) (-1744.312) (-1742.163) * [-1745.036] (-1750.702) (-1746.726) (-1747.021) -- 0:04:09
312500 -- [-1741.046] (-1744.031) (-1748.386) (-1741.326) * (-1748.205) (-1737.753) [-1739.723] (-1745.712) -- 0:04:08
313000 -- (-1739.393) (-1741.849) (-1743.643) [-1741.523] * [-1738.701] (-1740.108) (-1741.346) (-1748.698) -- 0:04:08
313500 -- [-1742.046] (-1737.198) (-1740.340) (-1744.033) * (-1748.119) [-1737.994] (-1737.980) (-1746.742) -- 0:04:07
314000 -- (-1745.030) (-1742.413) (-1739.974) [-1741.788] * (-1739.137) [-1738.009] (-1742.929) (-1748.119) -- 0:04:06
314500 -- (-1748.489) [-1749.358] (-1738.441) (-1743.210) * (-1746.503) (-1749.688) (-1744.696) [-1741.465] -- 0:04:08
315000 -- (-1736.388) [-1747.263] (-1742.291) (-1739.036) * [-1739.756] (-1750.326) (-1737.047) (-1745.228) -- 0:04:07
Average standard deviation of split frequencies: 0.013426
315500 -- [-1742.892] (-1748.996) (-1743.423) (-1741.052) * (-1742.953) [-1747.368] (-1739.424) (-1741.890) -- 0:04:07
316000 -- (-1742.646) [-1748.103] (-1742.622) (-1739.614) * (-1741.576) (-1738.505) (-1742.831) [-1739.494] -- 0:04:06
316500 -- (-1742.460) (-1737.164) (-1749.557) [-1740.931] * (-1751.621) (-1750.337) (-1744.428) [-1741.167] -- 0:04:06
317000 -- [-1736.972] (-1740.685) (-1747.189) (-1748.044) * (-1744.512) (-1748.770) (-1758.838) [-1742.733] -- 0:04:05
317500 -- (-1744.475) (-1742.989) (-1746.343) [-1746.594] * (-1746.120) [-1745.273] (-1748.598) (-1755.027) -- 0:04:07
318000 -- (-1737.658) (-1740.185) [-1742.098] (-1739.428) * (-1739.699) (-1742.377) [-1742.391] (-1752.265) -- 0:04:06
318500 -- (-1742.380) (-1744.781) (-1746.992) [-1738.710] * (-1738.033) [-1741.537] (-1746.637) (-1747.199) -- 0:04:06
319000 -- (-1742.411) [-1738.401] (-1748.756) (-1736.409) * (-1747.759) (-1737.990) [-1737.815] (-1745.966) -- 0:04:05
319500 -- (-1745.353) (-1737.476) (-1744.806) [-1744.070] * (-1747.643) [-1737.644] (-1740.678) (-1745.713) -- 0:04:04
320000 -- (-1737.223) (-1743.592) (-1743.091) [-1736.490] * (-1742.904) [-1734.999] (-1741.328) (-1744.917) -- 0:04:06
Average standard deviation of split frequencies: 0.013966
320500 -- (-1739.005) (-1750.610) (-1742.961) [-1745.208] * (-1742.849) (-1738.091) [-1736.322] (-1750.635) -- 0:04:05
321000 -- (-1743.265) (-1741.473) [-1749.442] (-1741.986) * (-1744.622) [-1742.321] (-1741.357) (-1747.088) -- 0:04:05
321500 -- (-1741.240) (-1741.743) (-1749.257) [-1741.347] * [-1747.998] (-1735.421) (-1744.130) (-1742.321) -- 0:04:04
322000 -- (-1743.444) (-1745.403) (-1748.945) [-1739.475] * (-1745.222) (-1738.165) [-1744.684] (-1740.401) -- 0:04:04
322500 -- (-1743.033) (-1745.408) (-1745.014) [-1750.448] * (-1746.661) [-1746.134] (-1742.617) (-1751.913) -- 0:04:03
323000 -- (-1744.945) (-1741.718) (-1736.581) [-1743.320] * [-1736.103] (-1748.322) (-1738.682) (-1751.845) -- 0:04:05
323500 -- (-1740.692) (-1748.173) [-1737.074] (-1740.339) * (-1738.674) (-1743.011) [-1739.664] (-1740.226) -- 0:04:04
324000 -- (-1749.506) (-1747.659) [-1745.007] (-1738.710) * (-1742.476) [-1743.047] (-1740.808) (-1741.842) -- 0:04:04
324500 -- [-1735.544] (-1743.034) (-1743.234) (-1747.841) * [-1748.684] (-1744.134) (-1746.447) (-1741.116) -- 0:04:03
325000 -- (-1742.474) (-1746.253) (-1735.650) [-1741.108] * [-1739.884] (-1734.773) (-1747.715) (-1743.581) -- 0:04:03
Average standard deviation of split frequencies: 0.013593
325500 -- (-1746.953) (-1745.820) [-1742.102] (-1745.097) * (-1746.108) (-1738.772) [-1744.973] (-1749.423) -- 0:04:02
326000 -- (-1738.785) (-1744.413) (-1742.050) [-1738.516] * (-1743.547) [-1753.140] (-1744.194) (-1747.991) -- 0:04:03
326500 -- (-1733.203) (-1741.884) [-1737.356] (-1741.154) * (-1741.684) [-1737.300] (-1738.629) (-1742.718) -- 0:04:03
327000 -- (-1741.515) (-1743.094) [-1746.103] (-1741.312) * [-1741.641] (-1738.775) (-1747.516) (-1746.356) -- 0:04:02
327500 -- (-1739.921) (-1743.012) (-1741.374) [-1743.063] * [-1746.120] (-1740.569) (-1740.146) (-1749.732) -- 0:04:02
328000 -- (-1744.529) (-1742.470) (-1749.102) [-1738.711] * (-1750.310) (-1741.168) (-1742.183) [-1741.289] -- 0:04:01
328500 -- (-1747.116) (-1740.765) (-1750.684) [-1732.608] * (-1741.538) [-1737.798] (-1745.865) (-1738.871) -- 0:04:01
329000 -- [-1734.523] (-1736.307) (-1742.087) (-1740.389) * (-1745.418) [-1741.269] (-1748.792) (-1750.411) -- 0:04:02
329500 -- (-1741.349) [-1736.950] (-1747.573) (-1743.923) * (-1744.184) [-1749.264] (-1742.824) (-1743.416) -- 0:04:02
330000 -- [-1735.549] (-1739.323) (-1739.592) (-1747.514) * [-1739.344] (-1748.107) (-1739.701) (-1747.545) -- 0:04:01
Average standard deviation of split frequencies: 0.015397
330500 -- (-1742.722) [-1739.174] (-1741.284) (-1739.391) * (-1737.587) [-1746.294] (-1747.694) (-1744.427) -- 0:04:01
331000 -- (-1740.877) [-1743.678] (-1739.145) (-1738.176) * (-1755.579) [-1740.252] (-1744.088) (-1757.141) -- 0:04:00
331500 -- (-1737.399) [-1747.334] (-1743.880) (-1740.037) * [-1746.278] (-1742.217) (-1746.391) (-1753.782) -- 0:04:01
332000 -- [-1742.993] (-1742.969) (-1743.299) (-1742.029) * (-1744.413) (-1751.638) [-1738.796] (-1741.906) -- 0:04:01
332500 -- (-1744.951) (-1737.783) (-1740.024) [-1750.221] * (-1742.008) (-1746.909) [-1745.604] (-1746.316) -- 0:04:00
333000 -- (-1745.928) (-1743.296) [-1738.694] (-1747.726) * (-1749.049) (-1747.820) (-1741.909) [-1736.816] -- 0:04:00
333500 -- (-1742.724) (-1745.734) [-1745.711] (-1740.290) * [-1742.848] (-1746.424) (-1741.639) (-1739.624) -- 0:03:59
334000 -- [-1739.496] (-1742.087) (-1757.105) (-1740.782) * (-1745.730) (-1740.347) [-1735.832] (-1741.170) -- 0:03:59
334500 -- [-1736.457] (-1740.171) (-1751.756) (-1745.180) * [-1745.870] (-1742.382) (-1739.355) (-1744.706) -- 0:04:00
335000 -- (-1743.752) (-1747.514) [-1738.294] (-1741.250) * [-1746.585] (-1744.196) (-1739.430) (-1744.850) -- 0:04:00
Average standard deviation of split frequencies: 0.016134
335500 -- [-1745.665] (-1740.318) (-1735.915) (-1746.298) * [-1738.495] (-1747.351) (-1743.314) (-1749.124) -- 0:03:59
336000 -- (-1749.742) (-1745.208) [-1740.044] (-1739.295) * (-1736.824) (-1747.633) [-1741.826] (-1751.402) -- 0:03:59
336500 -- (-1745.464) [-1739.678] (-1739.145) (-1747.581) * [-1741.285] (-1743.912) (-1739.735) (-1752.220) -- 0:03:58
337000 -- (-1757.873) (-1741.794) (-1749.466) [-1743.837] * (-1741.445) [-1741.482] (-1739.355) (-1753.542) -- 0:03:58
337500 -- (-1748.787) [-1736.969] (-1742.742) (-1745.634) * (-1745.180) (-1746.263) [-1749.946] (-1742.199) -- 0:03:59
338000 -- (-1744.793) (-1747.048) [-1739.044] (-1744.950) * (-1743.744) (-1741.012) [-1738.007] (-1750.485) -- 0:03:58
338500 -- (-1748.363) (-1749.370) (-1743.730) [-1740.068] * (-1742.390) (-1738.594) (-1746.113) [-1743.154] -- 0:03:58
339000 -- (-1738.350) (-1741.156) [-1741.173] (-1741.317) * [-1737.415] (-1751.804) (-1740.961) (-1746.973) -- 0:03:57
339500 -- (-1738.036) (-1743.613) [-1737.354] (-1743.315) * (-1741.825) [-1746.667] (-1740.341) (-1739.088) -- 0:03:57
340000 -- (-1746.400) (-1742.701) [-1737.862] (-1744.924) * (-1751.784) [-1746.547] (-1747.177) (-1753.499) -- 0:03:56
Average standard deviation of split frequencies: 0.016328
340500 -- (-1748.719) (-1748.670) (-1741.085) [-1742.235] * [-1739.623] (-1742.797) (-1747.319) (-1749.956) -- 0:03:58
341000 -- (-1744.895) (-1738.773) [-1734.100] (-1746.544) * (-1737.980) [-1745.875] (-1740.280) (-1747.014) -- 0:03:57
341500 -- [-1744.921] (-1744.124) (-1743.708) (-1741.914) * [-1736.310] (-1746.182) (-1746.983) (-1742.872) -- 0:03:57
342000 -- [-1741.935] (-1736.483) (-1739.846) (-1740.229) * [-1740.126] (-1744.187) (-1750.038) (-1748.028) -- 0:03:56
342500 -- [-1754.058] (-1741.499) (-1741.451) (-1750.125) * (-1747.182) (-1743.358) [-1735.972] (-1745.898) -- 0:03:56
343000 -- (-1749.568) (-1741.338) [-1738.902] (-1748.475) * (-1755.450) (-1737.644) [-1747.730] (-1739.385) -- 0:03:57
343500 -- (-1750.038) [-1748.605] (-1745.011) (-1738.014) * (-1747.991) (-1746.223) (-1742.212) [-1743.353] -- 0:03:56
344000 -- (-1747.875) (-1737.044) (-1752.634) [-1739.177] * [-1739.234] (-1738.452) (-1745.853) (-1748.847) -- 0:03:56
344500 -- (-1747.325) (-1741.234) (-1735.410) [-1739.041] * [-1742.228] (-1738.350) (-1742.020) (-1746.404) -- 0:03:55
345000 -- (-1753.207) (-1754.535) [-1738.071] (-1744.016) * (-1742.604) [-1740.587] (-1755.994) (-1749.347) -- 0:03:55
Average standard deviation of split frequencies: 0.017031
345500 -- (-1738.842) (-1749.269) (-1741.431) [-1739.399] * [-1742.616] (-1743.739) (-1740.458) (-1750.670) -- 0:03:54
346000 -- (-1739.185) (-1747.898) [-1738.491] (-1746.172) * [-1737.622] (-1742.012) (-1761.026) (-1749.377) -- 0:03:56
346500 -- [-1737.171] (-1744.636) (-1746.357) (-1745.911) * (-1744.877) [-1746.728] (-1744.251) (-1750.276) -- 0:03:55
347000 -- [-1740.892] (-1740.057) (-1740.120) (-1743.881) * (-1738.526) (-1737.530) [-1741.779] (-1745.088) -- 0:03:55
347500 -- (-1736.629) (-1740.492) [-1739.935] (-1745.137) * [-1743.710] (-1744.645) (-1745.480) (-1750.653) -- 0:03:54
348000 -- (-1740.947) (-1740.069) [-1738.479] (-1743.793) * (-1745.497) (-1750.079) [-1744.193] (-1742.392) -- 0:03:54
348500 -- (-1745.794) [-1744.777] (-1744.653) (-1741.590) * (-1741.729) [-1745.011] (-1745.060) (-1740.086) -- 0:03:53
349000 -- (-1738.880) (-1746.356) [-1741.557] (-1741.546) * [-1742.874] (-1736.428) (-1743.978) (-1752.004) -- 0:03:55
349500 -- (-1736.402) [-1743.886] (-1742.782) (-1745.180) * (-1747.601) (-1737.711) (-1750.413) [-1740.825] -- 0:03:54
350000 -- (-1744.351) [-1742.775] (-1747.767) (-1743.204) * (-1741.161) (-1743.469) [-1740.197] (-1734.828) -- 0:03:54
Average standard deviation of split frequencies: 0.016669
350500 -- (-1739.122) [-1743.577] (-1741.434) (-1752.313) * (-1739.000) (-1749.442) [-1743.406] (-1737.468) -- 0:03:53
351000 -- (-1740.637) (-1752.869) [-1738.010] (-1740.624) * [-1748.808] (-1752.401) (-1738.690) (-1735.498) -- 0:03:52
351500 -- [-1747.980] (-1742.296) (-1743.875) (-1745.956) * (-1738.513) [-1740.361] (-1736.241) (-1741.034) -- 0:03:52
352000 -- (-1744.944) [-1736.100] (-1743.630) (-1742.815) * [-1743.076] (-1748.689) (-1742.518) (-1736.768) -- 0:03:53
352500 -- (-1755.030) (-1743.551) [-1740.070] (-1738.770) * (-1739.938) [-1743.011] (-1742.625) (-1743.487) -- 0:03:53
353000 -- (-1746.490) (-1746.665) (-1745.121) [-1740.476] * (-1742.933) (-1743.254) (-1741.989) [-1738.001] -- 0:03:52
353500 -- [-1741.197] (-1743.532) (-1745.935) (-1734.653) * (-1744.458) (-1748.714) (-1750.327) [-1742.544] -- 0:03:52
354000 -- [-1740.861] (-1746.287) (-1751.152) (-1745.744) * (-1745.030) (-1748.211) (-1750.004) [-1739.880] -- 0:03:51
354500 -- (-1741.163) (-1747.742) [-1746.047] (-1744.493) * (-1741.269) (-1743.427) [-1742.448] (-1741.779) -- 0:03:51
355000 -- [-1742.787] (-1743.814) (-1750.227) (-1746.804) * (-1745.937) [-1747.729] (-1742.195) (-1745.209) -- 0:03:52
Average standard deviation of split frequencies: 0.014963
355500 -- (-1741.308) [-1739.991] (-1744.868) (-1736.096) * (-1746.156) (-1747.523) [-1735.044] (-1749.202) -- 0:03:52
356000 -- (-1744.764) [-1740.610] (-1738.921) (-1738.677) * (-1742.430) (-1743.579) (-1741.960) [-1738.998] -- 0:03:51
356500 -- (-1745.871) [-1740.487] (-1740.998) (-1740.386) * (-1740.925) (-1749.202) [-1738.901] (-1746.205) -- 0:03:51
357000 -- (-1743.199) [-1742.917] (-1745.982) (-1740.964) * (-1740.768) [-1741.298] (-1736.860) (-1746.119) -- 0:03:50
357500 -- (-1739.944) (-1738.981) [-1738.666] (-1741.312) * (-1747.268) (-1746.197) [-1737.384] (-1741.168) -- 0:03:51
358000 -- [-1740.018] (-1742.157) (-1740.897) (-1736.722) * [-1740.714] (-1739.912) (-1735.884) (-1741.329) -- 0:03:51
358500 -- (-1748.094) (-1742.713) [-1736.856] (-1756.946) * [-1738.930] (-1742.837) (-1741.087) (-1738.129) -- 0:03:50
359000 -- [-1741.631] (-1737.337) (-1742.444) (-1746.388) * (-1746.172) [-1741.235] (-1745.719) (-1740.633) -- 0:03:50
359500 -- (-1734.278) [-1737.955] (-1741.407) (-1748.231) * [-1739.082] (-1739.636) (-1748.129) (-1741.406) -- 0:03:49
360000 -- (-1740.334) [-1739.744] (-1741.314) (-1746.132) * (-1739.861) (-1744.519) (-1746.508) [-1737.482] -- 0:03:49
Average standard deviation of split frequencies: 0.013985
360500 -- [-1740.236] (-1739.834) (-1740.594) (-1739.986) * [-1745.469] (-1738.262) (-1745.603) (-1742.320) -- 0:03:50
361000 -- (-1738.849) [-1744.220] (-1736.795) (-1744.619) * (-1747.603) [-1738.541] (-1747.255) (-1746.962) -- 0:03:50
361500 -- (-1736.613) [-1746.449] (-1744.665) (-1748.929) * (-1741.927) [-1743.951] (-1735.243) (-1741.077) -- 0:03:49
362000 -- (-1736.773) (-1737.744) (-1755.745) [-1745.210] * (-1742.432) (-1742.899) [-1740.329] (-1744.516) -- 0:03:49
362500 -- [-1742.529] (-1746.679) (-1742.170) (-1741.382) * (-1751.193) [-1747.484] (-1746.142) (-1739.939) -- 0:03:48
363000 -- (-1744.621) (-1744.280) (-1734.954) [-1741.486] * (-1743.781) (-1743.136) [-1740.503] (-1742.562) -- 0:03:48
363500 -- (-1743.725) [-1737.502] (-1739.835) (-1756.168) * [-1744.350] (-1740.230) (-1744.994) (-1741.172) -- 0:03:49
364000 -- (-1744.203) (-1739.941) [-1736.644] (-1740.557) * [-1738.535] (-1738.389) (-1739.884) (-1747.672) -- 0:03:48
364500 -- (-1738.633) (-1741.443) [-1744.628] (-1747.405) * (-1750.150) (-1744.328) [-1741.291] (-1742.642) -- 0:03:48
365000 -- [-1739.879] (-1747.686) (-1741.930) (-1750.143) * (-1739.181) [-1737.040] (-1739.666) (-1746.033) -- 0:03:47
Average standard deviation of split frequencies: 0.012880
365500 -- (-1738.848) (-1741.837) (-1738.513) [-1747.589] * [-1741.216] (-1740.995) (-1745.041) (-1746.787) -- 0:03:47
366000 -- (-1738.891) (-1745.811) [-1738.504] (-1736.512) * [-1742.773] (-1745.974) (-1740.718) (-1746.723) -- 0:03:48
366500 -- [-1736.647] (-1742.152) (-1745.895) (-1743.589) * [-1747.398] (-1740.270) (-1741.701) (-1740.748) -- 0:03:48
367000 -- (-1738.338) [-1740.389] (-1742.827) (-1751.549) * (-1741.632) (-1754.021) (-1738.811) [-1742.109] -- 0:03:47
367500 -- (-1749.519) (-1742.527) [-1741.905] (-1745.936) * (-1746.940) (-1745.865) [-1739.245] (-1740.554) -- 0:03:47
368000 -- (-1743.562) [-1743.987] (-1743.438) (-1739.522) * [-1742.380] (-1743.396) (-1749.533) (-1741.301) -- 0:03:46
368500 -- [-1741.439] (-1744.003) (-1749.355) (-1746.002) * (-1761.919) (-1759.179) (-1741.528) [-1743.678] -- 0:03:46
369000 -- (-1749.693) [-1734.575] (-1740.772) (-1752.647) * (-1745.684) (-1752.295) (-1742.894) [-1743.582] -- 0:03:47
369500 -- [-1739.627] (-1737.811) (-1742.605) (-1741.918) * [-1740.697] (-1742.722) (-1740.912) (-1743.276) -- 0:03:46
370000 -- (-1747.690) (-1741.096) [-1742.196] (-1741.344) * [-1739.381] (-1747.535) (-1746.592) (-1743.192) -- 0:03:46
Average standard deviation of split frequencies: 0.013990
370500 -- (-1746.946) (-1741.461) [-1740.571] (-1753.867) * (-1739.111) (-1741.191) (-1744.148) [-1747.295] -- 0:03:45
371000 -- [-1738.763] (-1749.785) (-1744.329) (-1741.019) * (-1742.219) [-1747.831] (-1743.690) (-1741.772) -- 0:03:45
371500 -- (-1738.010) [-1739.696] (-1743.373) (-1740.552) * (-1742.544) [-1737.434] (-1745.059) (-1743.229) -- 0:03:45
372000 -- (-1744.275) (-1738.548) [-1738.929] (-1747.265) * (-1740.324) [-1734.857] (-1745.867) (-1743.266) -- 0:03:46
372500 -- (-1740.926) (-1742.502) (-1747.050) [-1737.086] * [-1738.674] (-1741.837) (-1744.563) (-1750.255) -- 0:03:45
373000 -- (-1744.015) (-1740.853) (-1736.128) [-1741.778] * (-1750.743) (-1744.193) [-1744.175] (-1744.948) -- 0:03:45
373500 -- (-1746.273) (-1744.180) [-1734.381] (-1745.793) * [-1747.626] (-1744.878) (-1748.496) (-1746.521) -- 0:03:44
374000 -- (-1745.686) (-1742.620) (-1741.876) [-1736.983] * [-1741.888] (-1743.246) (-1749.239) (-1741.792) -- 0:03:44
374500 -- [-1740.425] (-1743.279) (-1740.962) (-1746.990) * (-1743.704) [-1738.847] (-1748.408) (-1743.377) -- 0:03:43
375000 -- (-1745.077) (-1738.133) [-1738.481] (-1747.496) * (-1738.335) (-1742.859) [-1742.831] (-1742.418) -- 0:03:45
Average standard deviation of split frequencies: 0.012913
375500 -- (-1742.941) (-1745.774) (-1746.001) [-1745.005] * (-1736.863) [-1744.517] (-1743.083) (-1740.313) -- 0:03:44
376000 -- [-1738.375] (-1740.776) (-1748.960) (-1743.025) * (-1742.015) (-1744.344) [-1740.247] (-1740.671) -- 0:03:44
376500 -- (-1744.746) (-1747.179) (-1738.038) [-1745.485] * (-1744.706) [-1740.640] (-1738.025) (-1742.343) -- 0:03:43
377000 -- (-1740.157) [-1749.981] (-1741.907) (-1747.495) * (-1743.596) (-1742.305) (-1750.669) [-1744.343] -- 0:03:43
377500 -- (-1746.997) [-1739.184] (-1741.069) (-1751.451) * (-1745.067) (-1744.737) (-1744.246) [-1744.042] -- 0:03:44
378000 -- (-1754.014) [-1742.129] (-1739.894) (-1741.878) * (-1741.338) (-1740.571) (-1743.012) [-1739.829] -- 0:03:43
378500 -- [-1743.780] (-1745.843) (-1743.642) (-1743.295) * (-1747.239) [-1740.251] (-1740.184) (-1742.170) -- 0:03:43
379000 -- (-1740.144) (-1741.675) (-1745.463) [-1750.362] * (-1757.013) (-1743.810) (-1744.914) [-1742.797] -- 0:03:42
379500 -- (-1739.789) (-1743.482) [-1739.636] (-1742.325) * (-1742.964) (-1749.619) [-1745.323] (-1743.676) -- 0:03:42
380000 -- [-1737.117] (-1739.737) (-1746.780) (-1745.338) * [-1739.185] (-1748.106) (-1745.402) (-1746.728) -- 0:03:41
Average standard deviation of split frequencies: 0.012260
380500 -- (-1744.467) [-1743.310] (-1744.249) (-1741.225) * (-1739.689) (-1742.503) [-1740.620] (-1755.177) -- 0:03:43
381000 -- [-1740.609] (-1738.357) (-1751.141) (-1740.022) * [-1742.571] (-1743.801) (-1741.042) (-1736.714) -- 0:03:42
381500 -- [-1736.848] (-1741.865) (-1747.598) (-1738.539) * [-1736.687] (-1739.486) (-1745.989) (-1741.976) -- 0:03:42
382000 -- (-1747.417) [-1739.996] (-1747.934) (-1739.706) * (-1744.443) (-1739.200) (-1740.262) [-1741.706] -- 0:03:41
382500 -- (-1748.081) (-1743.933) (-1742.024) [-1737.379] * (-1744.306) (-1747.456) [-1735.520] (-1738.513) -- 0:03:41
383000 -- (-1738.776) [-1744.565] (-1743.203) (-1740.021) * (-1741.400) (-1737.711) [-1739.820] (-1741.621) -- 0:03:40
383500 -- (-1740.151) [-1740.243] (-1749.156) (-1733.168) * (-1736.662) (-1742.143) (-1745.893) [-1737.185] -- 0:03:41
384000 -- [-1740.912] (-1745.453) (-1740.643) (-1738.685) * (-1750.611) (-1743.781) [-1742.936] (-1734.945) -- 0:03:41
384500 -- [-1741.768] (-1737.990) (-1751.292) (-1745.083) * [-1741.378] (-1740.951) (-1742.528) (-1739.386) -- 0:03:40
385000 -- (-1746.416) [-1739.318] (-1745.542) (-1741.190) * (-1742.267) (-1748.739) [-1738.485] (-1738.243) -- 0:03:40
Average standard deviation of split frequencies: 0.012457
385500 -- (-1748.922) [-1752.588] (-1745.833) (-1737.797) * [-1741.995] (-1747.870) (-1747.320) (-1743.411) -- 0:03:39
386000 -- (-1749.349) (-1738.448) [-1737.799] (-1740.563) * (-1742.608) (-1753.618) (-1742.764) [-1739.518] -- 0:03:39
386500 -- (-1749.727) (-1740.434) [-1737.281] (-1742.995) * (-1745.208) [-1743.266] (-1746.548) (-1743.805) -- 0:03:40
387000 -- [-1744.949] (-1737.854) (-1744.943) (-1742.804) * [-1741.715] (-1748.556) (-1751.565) (-1737.514) -- 0:03:40
387500 -- (-1747.194) (-1737.927) [-1737.721] (-1743.611) * (-1735.585) (-1747.136) (-1744.231) [-1747.865] -- 0:03:39
388000 -- (-1744.947) [-1734.339] (-1740.874) (-1739.055) * (-1739.161) (-1743.209) [-1745.449] (-1752.681) -- 0:03:39
388500 -- (-1738.934) [-1737.645] (-1738.619) (-1741.785) * (-1742.242) (-1743.264) (-1747.366) [-1739.680] -- 0:03:38
389000 -- [-1742.857] (-1743.364) (-1736.326) (-1744.370) * (-1745.312) [-1741.712] (-1738.651) (-1742.640) -- 0:03:39
389500 -- (-1744.860) (-1743.114) (-1739.723) [-1737.762] * [-1735.889] (-1745.864) (-1737.932) (-1743.749) -- 0:03:39
390000 -- (-1748.806) (-1739.595) (-1752.631) [-1738.706] * (-1740.457) (-1745.767) [-1743.587] (-1745.757) -- 0:03:38
Average standard deviation of split frequencies: 0.013032
390500 -- (-1746.325) (-1747.084) (-1743.463) [-1737.008] * [-1734.856] (-1740.873) (-1740.733) (-1738.852) -- 0:03:38
391000 -- (-1748.979) (-1743.795) (-1743.851) [-1736.317] * (-1737.254) (-1746.635) (-1738.080) [-1738.322] -- 0:03:38
391500 -- (-1740.207) (-1742.776) [-1739.682] (-1743.556) * (-1742.971) (-1746.251) [-1743.994] (-1744.125) -- 0:03:37
392000 -- (-1742.425) (-1740.897) (-1741.121) [-1741.913] * (-1740.463) (-1738.156) (-1741.562) [-1741.029] -- 0:03:38
392500 -- (-1737.061) [-1741.200] (-1742.870) (-1749.984) * (-1741.495) [-1740.111] (-1745.196) (-1742.830) -- 0:03:38
393000 -- (-1747.322) [-1741.500] (-1741.291) (-1739.424) * (-1740.592) (-1746.822) (-1741.074) [-1739.917] -- 0:03:37
393500 -- (-1735.839) (-1742.985) (-1740.804) [-1740.037] * (-1740.742) (-1738.958) [-1737.793] (-1740.964) -- 0:03:37
394000 -- (-1734.863) (-1744.462) [-1744.460] (-1747.041) * (-1738.313) [-1744.706] (-1741.306) (-1740.615) -- 0:03:36
394500 -- (-1739.910) [-1741.003] (-1745.673) (-1744.598) * (-1740.352) (-1748.060) [-1744.866] (-1750.567) -- 0:03:36
395000 -- (-1745.296) (-1745.376) (-1740.702) [-1738.690] * (-1740.079) (-1743.324) (-1735.789) [-1743.490] -- 0:03:37
Average standard deviation of split frequencies: 0.014999
395500 -- (-1737.400) (-1743.806) [-1739.563] (-1751.415) * (-1746.638) (-1752.989) [-1739.833] (-1747.006) -- 0:03:37
396000 -- (-1737.821) (-1738.926) [-1738.455] (-1745.863) * (-1747.971) (-1742.933) [-1737.278] (-1745.407) -- 0:03:36
396500 -- (-1741.366) [-1739.558] (-1750.902) (-1749.242) * (-1736.057) (-1746.290) [-1742.813] (-1742.640) -- 0:03:36
397000 -- [-1744.722] (-1739.208) (-1740.678) (-1748.678) * (-1746.574) [-1738.434] (-1741.280) (-1743.284) -- 0:03:35
397500 -- (-1745.028) (-1737.971) [-1741.786] (-1746.014) * (-1744.244) (-1738.201) (-1736.861) [-1741.102] -- 0:03:35
398000 -- [-1739.808] (-1743.925) (-1742.478) (-1742.457) * (-1741.824) [-1738.515] (-1743.501) (-1749.509) -- 0:03:36
398500 -- (-1742.793) (-1737.960) [-1737.859] (-1743.232) * (-1744.463) (-1743.688) [-1737.472] (-1735.198) -- 0:03:35
399000 -- (-1744.995) (-1750.788) [-1744.299] (-1748.555) * (-1744.512) (-1746.564) [-1739.129] (-1742.930) -- 0:03:35
399500 -- (-1746.106) [-1746.586] (-1746.157) (-1739.481) * (-1743.290) (-1742.731) [-1736.156] (-1743.325) -- 0:03:34
400000 -- (-1745.693) [-1747.131] (-1748.813) (-1746.918) * (-1745.494) (-1736.790) [-1737.423] (-1738.547) -- 0:03:34
Average standard deviation of split frequencies: 0.015295
400500 -- (-1739.067) (-1742.939) (-1748.283) [-1739.113] * (-1736.986) [-1741.217] (-1735.630) (-1740.595) -- 0:03:35
401000 -- (-1739.416) [-1743.429] (-1752.378) (-1739.114) * [-1740.881] (-1740.970) (-1741.159) (-1743.376) -- 0:03:35
401500 -- (-1737.099) [-1732.933] (-1747.914) (-1734.829) * (-1740.449) [-1739.467] (-1747.182) (-1743.861) -- 0:03:34
402000 -- (-1743.032) [-1741.176] (-1742.688) (-1745.839) * (-1751.945) (-1752.549) [-1735.835] (-1744.723) -- 0:03:34
402500 -- (-1752.081) [-1738.754] (-1746.392) (-1749.205) * (-1755.809) [-1740.165] (-1744.749) (-1741.581) -- 0:03:33
403000 -- (-1740.997) (-1747.088) (-1745.207) [-1741.520] * (-1744.495) [-1741.646] (-1743.747) (-1742.928) -- 0:03:33
403500 -- (-1741.116) (-1744.808) [-1743.316] (-1736.390) * (-1740.402) [-1741.310] (-1739.038) (-1741.485) -- 0:03:34
404000 -- (-1746.399) [-1744.001] (-1748.402) (-1745.757) * (-1735.907) (-1746.826) (-1740.070) [-1737.496] -- 0:03:33
404500 -- [-1739.859] (-1744.409) (-1750.406) (-1746.702) * (-1743.608) (-1744.236) [-1742.056] (-1752.550) -- 0:03:33
405000 -- (-1743.893) [-1744.182] (-1742.440) (-1746.212) * (-1740.592) (-1747.921) [-1736.561] (-1745.489) -- 0:03:33
Average standard deviation of split frequencies: 0.015443
405500 -- (-1743.524) [-1745.980] (-1741.213) (-1739.822) * (-1742.234) [-1745.402] (-1740.140) (-1741.960) -- 0:03:32
406000 -- (-1741.449) [-1738.406] (-1746.841) (-1738.843) * (-1755.314) (-1739.479) [-1740.794] (-1749.095) -- 0:03:32
406500 -- [-1738.411] (-1736.977) (-1737.959) (-1743.241) * (-1744.006) (-1746.226) [-1738.894] (-1743.430) -- 0:03:33
407000 -- (-1741.618) (-1741.598) [-1740.919] (-1747.438) * (-1742.128) (-1742.760) [-1747.215] (-1743.430) -- 0:03:32
407500 -- (-1744.284) [-1736.547] (-1739.443) (-1745.022) * (-1743.907) (-1744.579) (-1754.251) [-1738.649] -- 0:03:32
408000 -- (-1745.365) [-1743.270] (-1748.480) (-1744.620) * (-1742.324) (-1744.728) [-1742.798] (-1746.165) -- 0:03:31
408500 -- (-1738.910) [-1739.500] (-1744.148) (-1739.896) * [-1734.179] (-1741.418) (-1745.318) (-1749.892) -- 0:03:31
409000 -- (-1741.802) (-1736.630) (-1743.046) [-1740.810] * (-1743.606) (-1742.455) [-1734.409] (-1741.399) -- 0:03:30
409500 -- [-1740.948] (-1743.032) (-1735.223) (-1747.106) * (-1742.468) [-1736.675] (-1736.892) (-1742.939) -- 0:03:31
410000 -- (-1737.757) (-1744.836) [-1740.734] (-1742.854) * (-1752.082) (-1743.668) [-1737.314] (-1741.561) -- 0:03:31
Average standard deviation of split frequencies: 0.015037
410500 -- [-1751.918] (-1743.106) (-1749.415) (-1737.928) * (-1741.950) [-1738.903] (-1742.619) (-1744.737) -- 0:03:31
411000 -- (-1742.695) (-1738.818) [-1739.778] (-1743.187) * [-1739.126] (-1746.928) (-1744.548) (-1740.542) -- 0:03:30
411500 -- [-1738.363] (-1749.611) (-1738.629) (-1746.044) * (-1742.623) [-1745.638] (-1741.874) (-1739.043) -- 0:03:30
412000 -- (-1743.704) (-1748.886) (-1738.695) [-1739.264] * (-1736.179) (-1751.536) [-1743.591] (-1746.323) -- 0:03:29
412500 -- (-1747.436) [-1742.359] (-1749.152) (-1744.591) * [-1749.695] (-1740.725) (-1741.048) (-1744.351) -- 0:03:30
413000 -- [-1740.075] (-1744.828) (-1742.348) (-1750.078) * (-1741.386) (-1742.673) (-1755.086) [-1741.972] -- 0:03:30
413500 -- (-1741.344) [-1744.285] (-1741.719) (-1742.640) * (-1743.550) [-1739.186] (-1739.836) (-1746.563) -- 0:03:29
414000 -- [-1739.901] (-1745.624) (-1741.168) (-1746.133) * (-1740.882) (-1745.485) [-1744.156] (-1738.157) -- 0:03:29
414500 -- (-1740.266) (-1737.912) (-1742.625) [-1738.367] * [-1743.293] (-1747.040) (-1743.653) (-1747.937) -- 0:03:29
415000 -- (-1744.119) (-1740.333) (-1738.822) [-1740.125] * (-1739.817) (-1745.456) [-1739.979] (-1744.364) -- 0:03:30
Average standard deviation of split frequencies: 0.015751
415500 -- (-1753.313) [-1744.076] (-1740.036) (-1737.074) * (-1740.273) [-1744.745] (-1743.726) (-1739.782) -- 0:03:29
416000 -- (-1745.887) (-1743.852) (-1749.900) [-1742.151] * (-1745.284) (-1748.772) (-1749.188) [-1738.222] -- 0:03:29
416500 -- (-1736.940) (-1746.356) (-1741.813) [-1737.471] * [-1746.922] (-1747.560) (-1739.329) (-1738.266) -- 0:03:28
417000 -- (-1739.638) [-1744.810] (-1745.123) (-1743.004) * (-1742.869) [-1744.247] (-1743.224) (-1740.283) -- 0:03:28
417500 -- (-1744.246) (-1737.168) [-1743.310] (-1738.834) * [-1735.757] (-1741.810) (-1740.780) (-1756.918) -- 0:03:27
418000 -- (-1742.159) (-1739.761) [-1745.585] (-1738.946) * (-1741.682) [-1738.526] (-1747.708) (-1740.232) -- 0:03:28
418500 -- [-1736.743] (-1737.875) (-1747.047) (-1744.244) * (-1741.315) (-1741.284) [-1741.564] (-1739.166) -- 0:03:28
419000 -- (-1742.009) [-1735.729] (-1746.322) (-1744.786) * (-1754.613) [-1737.660] (-1746.393) (-1741.434) -- 0:03:27
419500 -- [-1737.874] (-1743.993) (-1738.819) (-1740.567) * (-1746.387) [-1743.324] (-1741.198) (-1743.708) -- 0:03:27
420000 -- (-1742.035) (-1745.791) (-1741.154) [-1736.541] * (-1745.458) (-1740.449) [-1743.028] (-1745.364) -- 0:03:27
Average standard deviation of split frequencies: 0.015913
420500 -- (-1750.319) [-1743.036] (-1742.295) (-1742.305) * (-1739.565) (-1740.376) (-1749.784) [-1739.159] -- 0:03:26
421000 -- (-1745.594) (-1741.415) [-1743.972] (-1741.946) * (-1738.904) [-1741.791] (-1742.088) (-1739.882) -- 0:03:27
421500 -- (-1742.512) (-1750.158) (-1746.619) [-1744.914] * (-1742.314) [-1741.960] (-1746.454) (-1741.006) -- 0:03:27
422000 -- [-1744.631] (-1737.899) (-1740.438) (-1751.450) * (-1741.406) (-1737.903) [-1740.890] (-1744.790) -- 0:03:26
422500 -- (-1742.313) (-1754.152) (-1746.419) [-1736.814] * (-1745.586) [-1740.223] (-1744.970) (-1744.288) -- 0:03:26
423000 -- (-1740.002) (-1737.429) (-1748.814) [-1743.445] * [-1743.324] (-1738.840) (-1743.518) (-1739.193) -- 0:03:25
423500 -- (-1745.646) (-1738.040) [-1739.124] (-1743.474) * (-1739.864) [-1740.365] (-1740.842) (-1739.062) -- 0:03:26
424000 -- (-1745.347) (-1746.549) (-1743.217) [-1742.251] * [-1739.348] (-1746.204) (-1749.175) (-1746.925) -- 0:03:26
424500 -- (-1739.821) [-1741.165] (-1743.372) (-1743.722) * (-1740.529) (-1744.480) (-1744.718) [-1735.302] -- 0:03:26
425000 -- (-1740.426) (-1743.849) [-1744.246] (-1748.751) * (-1741.396) (-1747.438) [-1738.177] (-1741.631) -- 0:03:25
Average standard deviation of split frequencies: 0.016156
425500 -- [-1743.427] (-1748.839) (-1736.196) (-1743.219) * (-1757.450) (-1739.036) [-1739.920] (-1742.010) -- 0:03:25
426000 -- (-1741.615) (-1743.038) [-1739.181] (-1748.934) * (-1750.490) (-1747.306) [-1740.587] (-1739.584) -- 0:03:24
426500 -- (-1757.059) (-1736.754) [-1739.268] (-1756.628) * (-1746.343) (-1740.929) (-1745.875) [-1737.942] -- 0:03:25
427000 -- [-1748.183] (-1741.668) (-1736.013) (-1744.598) * (-1745.149) (-1737.887) (-1747.442) [-1748.465] -- 0:03:25
427500 -- [-1745.832] (-1743.654) (-1740.567) (-1743.050) * (-1746.559) (-1745.374) (-1741.901) [-1748.764] -- 0:03:24
428000 -- (-1747.421) (-1748.096) [-1739.501] (-1744.348) * (-1743.588) (-1743.900) [-1751.381] (-1745.332) -- 0:03:24
428500 -- [-1744.424] (-1741.926) (-1739.892) (-1737.591) * [-1742.886] (-1740.855) (-1738.144) (-1748.278) -- 0:03:24
429000 -- (-1740.956) [-1741.968] (-1741.076) (-1733.948) * (-1753.259) (-1745.702) (-1740.036) [-1743.603] -- 0:03:23
429500 -- (-1740.881) [-1738.502] (-1736.986) (-1742.772) * (-1747.836) (-1739.959) [-1737.580] (-1739.835) -- 0:03:24
430000 -- (-1742.119) (-1739.478) (-1741.232) [-1739.799] * (-1744.321) [-1737.400] (-1742.872) (-1741.301) -- 0:03:24
Average standard deviation of split frequencies: 0.016200
430500 -- (-1744.131) [-1740.986] (-1741.665) (-1735.980) * [-1739.500] (-1737.105) (-1740.864) (-1753.456) -- 0:03:23
431000 -- (-1744.436) [-1742.025] (-1741.434) (-1739.596) * (-1744.748) (-1740.886) [-1742.266] (-1751.715) -- 0:03:23
431500 -- (-1739.389) (-1743.165) (-1740.485) [-1743.329] * (-1740.669) (-1737.650) [-1743.292] (-1751.375) -- 0:03:22
432000 -- [-1744.389] (-1735.655) (-1738.859) (-1738.362) * (-1748.206) (-1740.721) [-1746.420] (-1745.897) -- 0:03:22
432500 -- (-1736.216) (-1741.517) (-1743.602) [-1734.130] * (-1741.166) (-1749.280) [-1739.649] (-1748.637) -- 0:03:23
433000 -- (-1746.966) (-1742.107) [-1736.877] (-1743.590) * (-1745.535) [-1742.872] (-1739.849) (-1746.899) -- 0:03:22
433500 -- (-1740.829) [-1739.436] (-1740.728) (-1742.153) * (-1746.222) [-1740.664] (-1737.621) (-1741.468) -- 0:03:22
434000 -- (-1740.525) (-1743.177) [-1738.498] (-1748.432) * (-1759.010) [-1737.638] (-1738.793) (-1741.457) -- 0:03:22
434500 -- (-1740.941) (-1746.306) [-1737.341] (-1744.854) * (-1742.768) [-1736.886] (-1752.792) (-1742.728) -- 0:03:21
435000 -- (-1749.749) (-1747.531) (-1745.100) [-1743.473] * (-1746.153) (-1742.000) [-1746.309] (-1740.521) -- 0:03:21
Average standard deviation of split frequencies: 0.015894
435500 -- (-1738.761) (-1748.830) [-1742.337] (-1744.130) * [-1744.343] (-1743.071) (-1751.483) (-1744.940) -- 0:03:22
436000 -- [-1735.630] (-1745.239) (-1740.966) (-1750.071) * (-1740.972) (-1740.358) [-1743.095] (-1746.865) -- 0:03:21
436500 -- (-1751.271) (-1740.930) (-1742.922) [-1739.614] * (-1737.916) [-1741.138] (-1745.882) (-1742.803) -- 0:03:21
437000 -- (-1740.800) (-1742.205) (-1743.065) [-1739.725] * (-1738.225) [-1743.137] (-1741.120) (-1740.390) -- 0:03:20
437500 -- (-1745.725) (-1743.808) [-1737.709] (-1742.544) * (-1742.391) (-1744.288) (-1736.161) [-1744.246] -- 0:03:20
438000 -- (-1739.682) [-1738.962] (-1746.449) (-1736.240) * (-1737.323) (-1744.604) [-1745.313] (-1751.483) -- 0:03:21
438500 -- (-1742.024) [-1742.087] (-1737.518) (-1737.317) * (-1739.537) (-1756.704) (-1744.127) [-1738.717] -- 0:03:21
439000 -- (-1743.538) [-1745.689] (-1735.864) (-1740.559) * (-1752.225) (-1746.044) [-1741.882] (-1737.917) -- 0:03:20
439500 -- (-1740.942) (-1748.453) (-1743.810) [-1741.354] * [-1740.770] (-1742.299) (-1745.709) (-1740.237) -- 0:03:20
440000 -- (-1739.667) [-1738.554] (-1750.193) (-1744.721) * (-1739.879) (-1743.139) [-1748.085] (-1741.869) -- 0:03:19
Average standard deviation of split frequencies: 0.016153
440500 -- (-1740.277) (-1737.848) [-1754.126] (-1742.798) * (-1741.976) [-1739.861] (-1738.194) (-1740.724) -- 0:03:19
441000 -- (-1742.706) [-1742.467] (-1746.934) (-1753.503) * (-1739.309) [-1738.417] (-1746.706) (-1738.383) -- 0:03:20
441500 -- (-1736.443) (-1743.119) [-1748.127] (-1750.693) * (-1747.798) (-1743.203) (-1740.346) [-1738.623] -- 0:03:19
442000 -- (-1745.862) [-1744.018] (-1742.103) (-1754.010) * (-1756.090) (-1744.928) (-1744.229) [-1745.115] -- 0:03:19
442500 -- (-1746.063) (-1750.701) (-1741.776) [-1747.521] * (-1747.929) (-1740.617) (-1746.056) [-1741.152] -- 0:03:19
443000 -- [-1740.494] (-1742.602) (-1740.723) (-1741.787) * (-1743.437) [-1742.364] (-1743.802) (-1742.874) -- 0:03:18
443500 -- (-1740.350) (-1743.319) (-1746.501) [-1744.668] * [-1738.879] (-1744.378) (-1741.048) (-1746.287) -- 0:03:18
444000 -- (-1740.174) (-1740.832) (-1741.345) [-1744.719] * (-1743.384) (-1744.514) [-1735.292] (-1748.807) -- 0:03:19
444500 -- [-1737.138] (-1739.753) (-1746.047) (-1737.764) * (-1748.447) (-1739.863) [-1739.700] (-1752.769) -- 0:03:18
445000 -- [-1740.845] (-1744.804) (-1753.466) (-1738.437) * (-1750.522) (-1738.163) [-1745.066] (-1743.505) -- 0:03:18
Average standard deviation of split frequencies: 0.016277
445500 -- [-1743.611] (-1746.006) (-1752.791) (-1738.187) * (-1746.523) (-1746.498) (-1744.669) [-1740.496] -- 0:03:17
446000 -- [-1740.488] (-1742.710) (-1746.638) (-1744.696) * (-1739.514) (-1745.750) [-1741.366] (-1743.023) -- 0:03:17
446500 -- (-1748.192) (-1748.025) [-1745.144] (-1737.995) * (-1745.537) [-1741.345] (-1743.281) (-1749.945) -- 0:03:17
447000 -- (-1742.874) (-1741.033) [-1742.294] (-1737.971) * (-1745.744) (-1741.903) [-1742.161] (-1742.574) -- 0:03:17
447500 -- (-1741.743) (-1748.285) [-1742.741] (-1739.092) * (-1741.704) (-1738.787) [-1739.138] (-1748.479) -- 0:03:17
448000 -- (-1741.346) (-1748.279) (-1747.991) [-1741.984] * (-1740.683) [-1735.812] (-1741.770) (-1752.242) -- 0:03:17
448500 -- (-1742.733) (-1741.384) [-1739.326] (-1739.698) * [-1739.365] (-1745.934) (-1736.470) (-1734.245) -- 0:03:16
449000 -- (-1734.583) (-1751.250) [-1741.385] (-1738.721) * (-1733.200) (-1741.550) (-1738.452) [-1740.119] -- 0:03:16
449500 -- (-1742.356) (-1748.633) [-1736.932] (-1744.034) * [-1736.690] (-1741.377) (-1750.971) (-1741.937) -- 0:03:17
450000 -- (-1741.667) [-1737.654] (-1739.395) (-1744.323) * (-1743.250) (-1743.545) (-1757.770) [-1742.049] -- 0:03:16
Average standard deviation of split frequencies: 0.015899
450500 -- (-1738.538) [-1741.905] (-1743.539) (-1739.808) * (-1745.760) [-1741.867] (-1755.038) (-1735.775) -- 0:03:16
451000 -- [-1743.931] (-1740.097) (-1749.147) (-1743.180) * [-1740.762] (-1738.503) (-1751.248) (-1743.739) -- 0:03:15
451500 -- (-1745.837) [-1745.958] (-1735.264) (-1746.643) * (-1743.948) [-1743.515] (-1746.539) (-1741.665) -- 0:03:15
452000 -- (-1747.212) (-1742.334) (-1740.019) [-1736.087] * (-1735.074) (-1743.811) [-1740.382] (-1742.573) -- 0:03:15
452500 -- [-1742.700] (-1738.941) (-1747.230) (-1741.052) * [-1734.423] (-1743.364) (-1740.308) (-1738.112) -- 0:03:16
453000 -- (-1738.739) (-1738.703) [-1741.077] (-1738.364) * [-1743.716] (-1747.249) (-1744.394) (-1746.105) -- 0:03:15
453500 -- (-1738.128) [-1740.501] (-1738.708) (-1744.491) * [-1742.014] (-1744.229) (-1740.130) (-1739.679) -- 0:03:15
454000 -- (-1736.213) (-1746.535) [-1740.635] (-1744.178) * (-1747.751) (-1743.965) [-1749.258] (-1738.689) -- 0:03:14
454500 -- (-1750.997) [-1743.792] (-1742.161) (-1757.629) * [-1739.857] (-1750.994) (-1742.662) (-1735.161) -- 0:03:14
455000 -- (-1740.988) (-1760.958) (-1743.291) [-1744.125] * (-1740.265) (-1742.609) [-1740.280] (-1742.843) -- 0:03:14
Average standard deviation of split frequencies: 0.016127
455500 -- (-1750.843) (-1740.046) (-1753.283) [-1741.960] * (-1738.429) [-1744.057] (-1751.213) (-1746.819) -- 0:03:14
456000 -- (-1745.998) (-1746.958) [-1740.016] (-1754.502) * [-1741.541] (-1743.145) (-1738.565) (-1742.286) -- 0:03:14
456500 -- (-1748.488) (-1748.640) (-1748.154) [-1740.479] * (-1744.786) [-1744.566] (-1741.669) (-1746.299) -- 0:03:14
457000 -- (-1742.346) (-1754.303) (-1744.647) [-1741.367] * (-1749.168) [-1740.132] (-1740.253) (-1747.424) -- 0:03:13
457500 -- [-1739.070] (-1741.249) (-1748.054) (-1740.737) * [-1738.583] (-1742.440) (-1740.231) (-1746.259) -- 0:03:13
458000 -- (-1742.084) [-1736.700] (-1741.608) (-1751.440) * (-1746.907) [-1740.839] (-1738.213) (-1747.704) -- 0:03:12
458500 -- [-1740.966] (-1740.500) (-1741.248) (-1755.249) * (-1742.573) (-1742.990) (-1742.580) [-1739.480] -- 0:03:13
459000 -- (-1738.971) (-1744.744) [-1739.270] (-1753.381) * (-1736.820) [-1736.129] (-1749.332) (-1745.213) -- 0:03:13
459500 -- (-1736.844) [-1742.943] (-1743.129) (-1747.419) * (-1746.948) (-1740.320) (-1752.914) [-1742.585] -- 0:03:12
460000 -- (-1748.134) (-1744.071) [-1740.719] (-1752.387) * [-1743.494] (-1745.506) (-1745.454) (-1739.443) -- 0:03:12
Average standard deviation of split frequencies: 0.015145
460500 -- (-1739.073) (-1743.953) (-1744.025) [-1747.729] * (-1741.889) [-1737.282] (-1742.607) (-1741.087) -- 0:03:12
461000 -- (-1737.276) [-1741.813] (-1745.837) (-1744.478) * (-1749.124) (-1736.466) (-1742.539) [-1743.782] -- 0:03:12
461500 -- [-1735.988] (-1735.548) (-1742.448) (-1745.884) * [-1745.461] (-1746.495) (-1750.905) (-1746.397) -- 0:03:12
462000 -- (-1746.459) (-1743.900) (-1749.677) [-1745.168] * (-1743.895) (-1741.103) [-1749.540] (-1757.554) -- 0:03:12
462500 -- (-1744.483) (-1745.780) (-1740.218) [-1739.623] * (-1737.016) (-1745.393) [-1754.330] (-1750.200) -- 0:03:11
463000 -- [-1738.490] (-1748.141) (-1746.869) (-1746.474) * (-1744.747) [-1742.360] (-1748.745) (-1741.119) -- 0:03:11
463500 -- (-1747.780) [-1738.071] (-1758.049) (-1737.111) * (-1740.894) (-1744.478) [-1743.906] (-1745.029) -- 0:03:10
464000 -- (-1745.374) (-1736.850) (-1745.899) [-1740.825] * (-1745.844) [-1746.986] (-1760.993) (-1740.317) -- 0:03:11
464500 -- (-1740.276) (-1742.029) (-1741.068) [-1740.705] * (-1739.245) [-1743.677] (-1747.229) (-1735.554) -- 0:03:11
465000 -- (-1749.267) (-1736.919) (-1740.655) [-1744.899] * (-1739.865) [-1736.510] (-1740.870) (-1741.682) -- 0:03:10
Average standard deviation of split frequencies: 0.014567
465500 -- (-1747.437) (-1739.991) [-1742.074] (-1740.832) * (-1746.539) [-1743.096] (-1753.142) (-1736.679) -- 0:03:10
466000 -- [-1739.900] (-1736.556) (-1745.706) (-1738.188) * (-1742.755) (-1741.577) (-1746.859) [-1744.105] -- 0:03:10
466500 -- (-1743.432) [-1741.441] (-1744.144) (-1747.831) * (-1741.275) (-1744.765) (-1749.651) [-1739.135] -- 0:03:09
467000 -- [-1742.439] (-1750.065) (-1744.135) (-1752.496) * [-1741.644] (-1745.283) (-1737.673) (-1743.140) -- 0:03:10
467500 -- (-1745.882) (-1742.048) (-1738.207) [-1743.818] * [-1738.389] (-1745.918) (-1748.183) (-1742.835) -- 0:03:10
468000 -- [-1739.371] (-1745.556) (-1740.706) (-1737.540) * (-1738.712) (-1742.949) (-1753.708) [-1741.018] -- 0:03:09
468500 -- (-1736.031) [-1735.186] (-1741.493) (-1744.201) * (-1743.316) (-1747.131) [-1738.863] (-1743.674) -- 0:03:09
469000 -- (-1743.120) [-1735.455] (-1741.309) (-1745.613) * [-1742.838] (-1739.719) (-1741.385) (-1753.380) -- 0:03:09
469500 -- (-1741.930) [-1743.230] (-1746.544) (-1755.109) * [-1744.305] (-1746.672) (-1746.404) (-1739.516) -- 0:03:08
470000 -- (-1749.590) [-1742.731] (-1737.259) (-1748.683) * (-1735.747) [-1739.909] (-1739.057) (-1742.849) -- 0:03:09
Average standard deviation of split frequencies: 0.014423
470500 -- [-1744.743] (-1751.578) (-1739.466) (-1750.746) * (-1742.745) (-1747.056) [-1738.362] (-1744.665) -- 0:03:09
471000 -- (-1741.745) [-1744.235] (-1757.313) (-1746.323) * (-1737.797) (-1743.690) [-1735.565] (-1742.055) -- 0:03:08
471500 -- (-1738.514) (-1754.354) [-1736.554] (-1739.941) * [-1743.832] (-1750.104) (-1737.621) (-1746.745) -- 0:03:08
472000 -- [-1739.078] (-1747.920) (-1738.221) (-1745.892) * (-1739.513) (-1742.445) [-1740.533] (-1748.583) -- 0:03:07
472500 -- (-1736.712) (-1740.634) (-1739.858) [-1746.650] * (-1741.200) [-1739.912] (-1750.224) (-1741.935) -- 0:03:08
473000 -- (-1743.946) (-1754.936) [-1745.759] (-1744.248) * (-1745.498) (-1744.873) (-1738.933) [-1742.167] -- 0:03:08
473500 -- (-1742.566) (-1744.650) (-1745.176) [-1746.857] * (-1749.555) (-1742.542) (-1742.642) [-1742.938] -- 0:03:07
474000 -- (-1741.622) (-1749.494) [-1745.283] (-1747.691) * [-1739.183] (-1742.247) (-1750.147) (-1746.932) -- 0:03:07
474500 -- (-1746.611) (-1745.097) [-1741.472] (-1744.096) * (-1739.549) [-1740.712] (-1743.535) (-1745.502) -- 0:03:07
475000 -- (-1740.309) (-1741.179) (-1748.764) [-1751.137] * (-1742.759) [-1746.043] (-1738.428) (-1738.286) -- 0:03:06
Average standard deviation of split frequencies: 0.014162
475500 -- (-1741.913) (-1741.286) (-1743.018) [-1748.869] * (-1741.928) (-1745.978) [-1745.513] (-1740.539) -- 0:03:07
476000 -- (-1742.881) [-1738.064] (-1748.189) (-1741.855) * (-1752.800) (-1740.815) [-1743.159] (-1750.724) -- 0:03:07
476500 -- (-1744.900) (-1744.524) (-1748.255) [-1744.290] * (-1748.440) (-1741.454) [-1741.441] (-1739.106) -- 0:03:06
477000 -- (-1742.901) [-1744.054] (-1741.142) (-1743.104) * (-1742.458) [-1740.255] (-1749.631) (-1735.952) -- 0:03:06
477500 -- (-1746.553) (-1742.262) [-1745.664] (-1750.948) * (-1742.885) (-1740.752) [-1744.984] (-1740.557) -- 0:03:06
478000 -- (-1739.497) (-1737.098) (-1741.178) [-1739.072] * (-1741.403) [-1746.821] (-1737.365) (-1739.021) -- 0:03:05
478500 -- (-1738.214) [-1738.527] (-1744.702) (-1748.333) * (-1738.518) (-1746.402) (-1739.693) [-1736.445] -- 0:03:06
479000 -- (-1744.025) [-1746.475] (-1740.429) (-1739.191) * (-1753.738) (-1747.842) [-1740.769] (-1741.118) -- 0:03:05
479500 -- (-1755.434) (-1738.225) [-1743.347] (-1739.394) * (-1759.554) [-1738.705] (-1735.575) (-1748.511) -- 0:03:05
480000 -- (-1742.852) (-1746.229) [-1741.587] (-1743.842) * (-1741.036) (-1736.235) [-1750.630] (-1754.411) -- 0:03:05
Average standard deviation of split frequencies: 0.013926
480500 -- [-1743.261] (-1745.155) (-1744.411) (-1737.570) * (-1745.345) [-1735.790] (-1746.025) (-1751.777) -- 0:03:04
481000 -- (-1747.469) (-1744.708) (-1742.458) [-1744.835] * (-1743.429) (-1746.485) [-1740.320] (-1746.917) -- 0:03:04
481500 -- (-1739.634) [-1742.654] (-1744.034) (-1742.832) * (-1743.921) (-1746.116) (-1746.003) [-1735.874] -- 0:03:05
482000 -- (-1744.700) (-1741.628) [-1740.476] (-1740.519) * (-1753.341) [-1742.536] (-1754.242) (-1744.962) -- 0:03:04
482500 -- (-1747.341) (-1739.297) (-1743.025) [-1738.232] * (-1743.383) [-1740.356] (-1742.965) (-1736.576) -- 0:03:04
483000 -- (-1745.037) (-1746.670) (-1742.489) [-1742.418] * (-1740.295) (-1741.166) (-1745.974) [-1741.540] -- 0:03:04
483500 -- (-1746.872) [-1738.422] (-1741.820) (-1735.356) * (-1737.593) (-1742.360) [-1746.670] (-1738.946) -- 0:03:03
484000 -- (-1740.632) (-1741.846) (-1744.748) [-1739.052] * (-1739.692) (-1750.138) [-1742.791] (-1744.913) -- 0:03:04
484500 -- [-1736.775] (-1745.662) (-1743.358) (-1742.328) * (-1741.307) (-1742.158) [-1743.159] (-1741.412) -- 0:03:04
485000 -- (-1739.307) [-1740.980] (-1744.741) (-1747.914) * (-1741.402) (-1735.182) (-1737.084) [-1743.160] -- 0:03:03
Average standard deviation of split frequencies: 0.014938
485500 -- (-1742.417) (-1744.370) (-1742.602) [-1734.463] * (-1732.977) (-1735.562) (-1740.640) [-1737.267] -- 0:03:03
486000 -- (-1738.422) [-1745.239] (-1738.882) (-1735.048) * (-1740.619) (-1739.966) (-1747.820) [-1741.890] -- 0:03:02
486500 -- (-1743.917) (-1745.721) (-1739.126) [-1738.753] * (-1736.887) (-1743.516) [-1739.036] (-1748.895) -- 0:03:02
487000 -- [-1740.974] (-1739.181) (-1755.449) (-1747.677) * (-1738.357) [-1740.674] (-1740.990) (-1737.664) -- 0:03:03
487500 -- (-1743.729) (-1739.157) [-1751.225] (-1744.826) * (-1743.613) [-1746.981] (-1746.766) (-1744.975) -- 0:03:02
488000 -- (-1747.088) (-1740.066) (-1744.357) [-1747.173] * (-1740.848) [-1737.553] (-1742.074) (-1741.864) -- 0:03:02
488500 -- (-1754.428) [-1744.861] (-1747.837) (-1742.913) * (-1737.546) [-1745.049] (-1738.929) (-1739.981) -- 0:03:02
489000 -- (-1751.827) (-1742.792) (-1737.466) [-1736.283] * [-1735.833] (-1745.385) (-1739.481) (-1735.685) -- 0:03:01
489500 -- (-1743.630) (-1744.135) (-1737.444) [-1743.860] * (-1744.907) (-1741.951) (-1743.389) [-1739.105] -- 0:03:01
490000 -- [-1739.621] (-1751.899) (-1737.341) (-1746.497) * [-1744.193] (-1737.284) (-1740.351) (-1748.078) -- 0:03:02
Average standard deviation of split frequencies: 0.014795
490500 -- [-1742.832] (-1744.953) (-1739.583) (-1739.088) * (-1744.620) [-1743.631] (-1747.146) (-1741.722) -- 0:03:01
491000 -- (-1744.624) (-1750.731) [-1737.006] (-1742.266) * (-1755.696) (-1746.476) (-1739.014) [-1738.321] -- 0:03:01
491500 -- (-1738.527) (-1754.535) [-1738.589] (-1744.612) * [-1748.969] (-1744.672) (-1735.753) (-1738.553) -- 0:03:01
492000 -- [-1737.603] (-1747.791) (-1739.688) (-1747.374) * (-1745.358) [-1738.320] (-1743.540) (-1746.506) -- 0:03:00
492500 -- (-1740.543) (-1752.526) [-1746.325] (-1740.605) * (-1755.830) [-1747.217] (-1745.058) (-1742.752) -- 0:03:00
493000 -- (-1753.622) (-1740.682) [-1742.027] (-1745.972) * (-1746.630) (-1751.441) (-1737.922) [-1740.998] -- 0:03:00
493500 -- [-1745.287] (-1744.714) (-1751.109) (-1738.326) * [-1745.331] (-1740.555) (-1749.827) (-1744.533) -- 0:03:00
494000 -- (-1739.800) [-1740.530] (-1741.257) (-1737.962) * (-1743.169) (-1743.361) [-1741.206] (-1742.568) -- 0:03:00
494500 -- [-1738.515] (-1744.104) (-1743.920) (-1741.249) * [-1741.956] (-1737.473) (-1744.917) (-1740.920) -- 0:02:59
495000 -- [-1742.526] (-1746.300) (-1749.246) (-1738.210) * (-1742.999) [-1742.343] (-1746.807) (-1751.327) -- 0:02:59
Average standard deviation of split frequencies: 0.013971
495500 -- (-1741.052) [-1744.154] (-1744.031) (-1737.334) * (-1750.532) (-1743.060) (-1747.211) [-1744.678] -- 0:03:00
496000 -- (-1749.915) [-1747.111] (-1739.047) (-1742.720) * [-1751.580] (-1756.397) (-1757.123) (-1742.970) -- 0:02:59
496500 -- [-1737.442] (-1737.896) (-1741.222) (-1737.919) * (-1745.913) (-1743.391) [-1742.999] (-1741.861) -- 0:02:59
497000 -- [-1742.328] (-1740.699) (-1738.539) (-1748.093) * (-1735.421) [-1739.435] (-1744.985) (-1741.605) -- 0:02:59
497500 -- (-1737.940) [-1745.785] (-1750.387) (-1741.374) * (-1749.441) (-1737.237) [-1739.470] (-1734.237) -- 0:02:58
498000 -- (-1737.529) (-1756.235) [-1745.618] (-1743.814) * [-1747.680] (-1737.969) (-1735.238) (-1747.944) -- 0:02:58
498500 -- (-1743.470) [-1741.525] (-1747.531) (-1743.962) * (-1746.322) [-1739.168] (-1751.991) (-1737.302) -- 0:02:59
499000 -- (-1747.157) (-1747.365) [-1739.932] (-1740.793) * [-1736.331] (-1741.288) (-1738.117) (-1744.673) -- 0:02:58
499500 -- (-1744.204) [-1736.074] (-1746.884) (-1742.220) * [-1737.632] (-1742.131) (-1743.549) (-1747.400) -- 0:02:58
500000 -- (-1745.163) (-1743.634) [-1745.162] (-1744.819) * [-1741.883] (-1740.100) (-1742.233) (-1752.733) -- 0:02:58
Average standard deviation of split frequencies: 0.014123
500500 -- (-1744.822) [-1734.744] (-1739.601) (-1752.245) * (-1745.104) [-1738.425] (-1740.310) (-1738.759) -- 0:02:57
501000 -- (-1744.008) (-1736.644) [-1736.881] (-1741.986) * (-1743.110) (-1745.454) (-1742.774) [-1738.980] -- 0:02:57
501500 -- (-1740.481) [-1745.063] (-1747.344) (-1745.988) * (-1745.589) (-1745.816) [-1742.070] (-1749.671) -- 0:02:57
502000 -- (-1748.032) [-1746.804] (-1743.437) (-1736.850) * (-1747.861) (-1741.698) (-1740.818) [-1744.342] -- 0:02:57
502500 -- [-1737.916] (-1735.278) (-1747.589) (-1741.825) * (-1741.084) [-1743.942] (-1743.499) (-1737.569) -- 0:02:57
503000 -- (-1740.913) (-1739.853) [-1745.167] (-1746.562) * (-1740.062) (-1740.015) [-1745.843] (-1738.189) -- 0:02:56
503500 -- [-1736.577] (-1744.114) (-1746.229) (-1747.316) * (-1740.775) [-1741.229] (-1736.494) (-1739.445) -- 0:02:56
504000 -- [-1744.250] (-1740.790) (-1752.721) (-1747.059) * [-1742.124] (-1742.588) (-1738.698) (-1744.122) -- 0:02:56
504500 -- (-1740.208) (-1746.918) (-1744.547) [-1740.487] * (-1746.601) (-1746.217) [-1742.636] (-1749.616) -- 0:02:56
505000 -- (-1751.984) (-1747.465) [-1746.049] (-1744.428) * (-1738.336) (-1742.833) (-1741.641) [-1740.272] -- 0:02:56
Average standard deviation of split frequencies: 0.013695
505500 -- (-1741.296) (-1749.773) (-1744.577) [-1739.712] * [-1740.307] (-1739.708) (-1741.398) (-1740.878) -- 0:02:56
506000 -- (-1744.133) [-1748.086] (-1744.694) (-1748.494) * (-1743.518) (-1736.235) [-1737.840] (-1740.442) -- 0:02:55
506500 -- (-1748.234) (-1738.541) (-1748.277) [-1737.772] * [-1744.661] (-1750.412) (-1743.176) (-1744.895) -- 0:02:55
507000 -- [-1737.147] (-1747.449) (-1744.060) (-1747.752) * (-1743.106) (-1746.368) (-1749.173) [-1737.551] -- 0:02:56
507500 -- (-1749.025) (-1738.282) (-1739.499) [-1740.615] * (-1742.057) (-1752.600) [-1743.209] (-1749.334) -- 0:02:55
508000 -- (-1737.795) [-1740.043] (-1744.955) (-1743.487) * (-1737.597) (-1746.168) [-1741.786] (-1739.157) -- 0:02:55
508500 -- (-1740.160) [-1737.527] (-1750.077) (-1744.150) * [-1737.063] (-1738.739) (-1748.858) (-1743.102) -- 0:02:54
509000 -- (-1742.767) (-1747.685) [-1751.391] (-1748.366) * [-1736.019] (-1740.582) (-1748.861) (-1744.767) -- 0:02:54
509500 -- (-1744.568) (-1743.963) (-1745.317) [-1739.668] * [-1742.397] (-1749.746) (-1739.726) (-1741.738) -- 0:02:54
510000 -- (-1742.392) [-1744.672] (-1740.471) (-1738.570) * [-1747.316] (-1741.903) (-1739.676) (-1741.701) -- 0:02:54
Average standard deviation of split frequencies: 0.014124
510500 -- [-1739.678] (-1749.432) (-1744.214) (-1761.480) * (-1744.762) [-1738.941] (-1736.996) (-1743.524) -- 0:02:54
511000 -- (-1755.673) (-1751.985) (-1743.936) [-1737.726] * [-1748.673] (-1738.692) (-1738.902) (-1750.041) -- 0:02:54
511500 -- (-1746.063) [-1742.327] (-1744.962) (-1746.146) * (-1743.786) [-1738.070] (-1744.089) (-1746.414) -- 0:02:53
512000 -- [-1740.032] (-1748.657) (-1750.498) (-1751.306) * (-1748.701) [-1739.123] (-1738.172) (-1745.869) -- 0:02:53
512500 -- (-1742.776) [-1740.916] (-1744.635) (-1737.675) * (-1748.738) [-1739.532] (-1739.961) (-1750.649) -- 0:02:53
513000 -- (-1742.085) (-1741.812) (-1747.414) [-1741.441] * [-1744.194] (-1747.815) (-1741.569) (-1744.922) -- 0:02:53
513500 -- (-1737.911) (-1745.754) (-1740.062) [-1739.490] * (-1742.881) [-1746.330] (-1740.677) (-1746.007) -- 0:02:53
514000 -- [-1744.385] (-1738.221) (-1742.405) (-1737.617) * (-1752.370) (-1743.740) [-1737.032] (-1754.355) -- 0:02:53
514500 -- (-1744.342) (-1750.372) [-1744.926] (-1738.763) * (-1744.949) [-1736.356] (-1744.233) (-1743.355) -- 0:02:52
515000 -- (-1748.553) [-1737.749] (-1741.505) (-1740.440) * (-1744.426) (-1738.949) (-1744.353) [-1735.859] -- 0:02:52
Average standard deviation of split frequencies: 0.013430
515500 -- (-1745.559) (-1739.827) (-1741.744) [-1736.927] * [-1743.248] (-1745.528) (-1742.971) (-1738.808) -- 0:02:51
516000 -- (-1740.727) (-1744.535) [-1742.074] (-1745.651) * (-1740.199) (-1751.201) (-1747.398) [-1736.372] -- 0:02:52
516500 -- (-1745.674) (-1741.027) [-1740.511] (-1738.361) * (-1738.824) (-1753.702) [-1740.283] (-1742.349) -- 0:02:52
517000 -- (-1752.731) (-1749.983) (-1744.866) [-1743.366] * (-1746.958) (-1741.603) (-1744.522) [-1733.051] -- 0:02:51
517500 -- [-1740.971] (-1741.194) (-1740.145) (-1746.221) * (-1747.631) [-1744.101] (-1746.861) (-1740.363) -- 0:02:51
518000 -- (-1742.453) (-1736.393) (-1741.019) [-1740.308] * (-1742.678) (-1741.388) (-1753.465) [-1738.224] -- 0:02:51
518500 -- [-1736.478] (-1750.132) (-1739.175) (-1741.485) * (-1746.109) [-1744.040] (-1744.832) (-1740.170) -- 0:02:51
519000 -- (-1746.740) [-1739.188] (-1741.150) (-1740.246) * (-1742.879) (-1738.295) (-1747.141) [-1743.719] -- 0:02:51
519500 -- [-1736.295] (-1737.902) (-1738.713) (-1741.766) * (-1738.206) (-1740.468) (-1743.737) [-1745.258] -- 0:02:51
520000 -- (-1745.533) (-1744.384) [-1739.323] (-1746.561) * [-1736.480] (-1742.561) (-1738.191) (-1744.038) -- 0:02:50
Average standard deviation of split frequencies: 0.013219
520500 -- [-1740.690] (-1744.237) (-1739.437) (-1748.939) * (-1738.501) [-1748.707] (-1743.048) (-1742.950) -- 0:02:50
521000 -- [-1744.826] (-1739.567) (-1738.103) (-1743.191) * [-1737.108] (-1744.211) (-1737.661) (-1741.229) -- 0:02:50
521500 -- (-1737.758) (-1744.021) [-1740.605] (-1742.820) * (-1745.486) [-1742.607] (-1744.879) (-1739.379) -- 0:02:50
522000 -- [-1738.534] (-1745.196) (-1749.062) (-1738.369) * [-1733.715] (-1742.730) (-1743.378) (-1741.431) -- 0:02:50
522500 -- [-1742.290] (-1756.354) (-1742.286) (-1742.086) * (-1748.168) (-1736.357) [-1736.522] (-1749.813) -- 0:02:49
523000 -- (-1740.451) (-1742.469) (-1740.494) [-1746.179] * (-1745.508) (-1744.634) (-1738.003) [-1735.879] -- 0:02:49
523500 -- (-1737.380) (-1742.193) (-1745.163) [-1745.194] * [-1741.114] (-1747.635) (-1741.580) (-1744.088) -- 0:02:49
524000 -- [-1742.073] (-1748.541) (-1740.123) (-1742.891) * (-1737.739) (-1744.527) (-1743.446) [-1740.905] -- 0:02:48
524500 -- (-1743.358) (-1741.470) (-1739.002) [-1747.805] * [-1740.698] (-1745.579) (-1745.868) (-1749.790) -- 0:02:49
525000 -- (-1754.886) (-1739.677) [-1741.446] (-1744.172) * [-1743.282] (-1744.434) (-1737.474) (-1741.983) -- 0:02:49
Average standard deviation of split frequencies: 0.012905
525500 -- [-1740.054] (-1749.913) (-1743.061) (-1748.386) * (-1741.401) (-1754.272) [-1741.979] (-1751.420) -- 0:02:48
526000 -- (-1744.753) [-1743.843] (-1747.202) (-1746.290) * (-1743.701) (-1748.955) [-1748.438] (-1740.798) -- 0:02:48
526500 -- [-1741.236] (-1741.276) (-1745.115) (-1749.878) * [-1749.125] (-1753.667) (-1740.018) (-1748.816) -- 0:02:48
527000 -- [-1741.464] (-1738.685) (-1739.054) (-1749.003) * (-1751.069) (-1743.858) [-1742.063] (-1748.916) -- 0:02:47
527500 -- [-1742.215] (-1745.876) (-1736.266) (-1741.665) * (-1738.019) [-1745.175] (-1745.280) (-1736.321) -- 0:02:48
528000 -- (-1741.108) [-1748.661] (-1744.947) (-1748.998) * (-1743.423) (-1752.733) (-1738.132) [-1741.555] -- 0:02:48
528500 -- (-1742.103) (-1748.673) (-1741.843) [-1744.468] * (-1741.388) (-1738.529) [-1736.565] (-1740.227) -- 0:02:47
529000 -- [-1739.597] (-1751.103) (-1743.316) (-1745.194) * (-1743.518) [-1740.091] (-1737.301) (-1741.022) -- 0:02:47
529500 -- (-1738.161) [-1743.914] (-1752.022) (-1737.689) * [-1747.138] (-1740.533) (-1741.360) (-1743.990) -- 0:02:47
530000 -- [-1741.763] (-1737.706) (-1746.152) (-1741.764) * (-1743.854) [-1742.313] (-1746.515) (-1742.297) -- 0:02:46
Average standard deviation of split frequencies: 0.013058
530500 -- (-1745.759) (-1742.509) (-1746.915) [-1734.852] * (-1744.884) (-1739.637) [-1740.674] (-1744.532) -- 0:02:47
531000 -- (-1748.804) (-1739.983) [-1742.522] (-1745.731) * (-1756.989) (-1748.598) [-1740.387] (-1749.879) -- 0:02:46
531500 -- [-1738.898] (-1749.220) (-1736.998) (-1745.892) * (-1745.404) [-1741.525] (-1747.373) (-1753.284) -- 0:02:46
532000 -- (-1745.565) [-1733.477] (-1746.247) (-1750.650) * (-1748.331) (-1735.768) (-1747.621) [-1741.204] -- 0:02:46
532500 -- (-1741.938) (-1745.152) [-1741.806] (-1747.308) * (-1742.158) [-1745.464] (-1743.132) (-1741.277) -- 0:02:45
533000 -- (-1756.194) (-1743.176) [-1735.101] (-1745.821) * (-1743.773) (-1740.109) [-1740.032] (-1739.778) -- 0:02:46
533500 -- [-1739.561] (-1743.706) (-1745.170) (-1740.155) * (-1740.199) (-1739.329) [-1739.661] (-1744.646) -- 0:02:46
534000 -- (-1741.544) (-1736.888) (-1754.223) [-1737.893] * (-1743.874) (-1741.772) [-1745.263] (-1735.212) -- 0:02:45
534500 -- [-1740.595] (-1742.978) (-1743.367) (-1739.410) * (-1744.641) [-1737.221] (-1741.158) (-1750.470) -- 0:02:45
535000 -- (-1743.448) [-1738.137] (-1743.339) (-1743.891) * (-1751.373) [-1739.903] (-1739.010) (-1743.342) -- 0:02:45
Average standard deviation of split frequencies: 0.013104
535500 -- (-1758.072) [-1739.606] (-1737.431) (-1748.612) * (-1745.128) (-1747.469) [-1735.665] (-1741.724) -- 0:02:44
536000 -- (-1748.202) (-1739.780) (-1740.799) [-1741.095] * (-1738.968) (-1745.874) [-1741.438] (-1740.031) -- 0:02:45
536500 -- (-1740.577) (-1744.151) [-1740.943] (-1735.980) * (-1738.231) [-1742.144] (-1745.858) (-1743.538) -- 0:02:45
537000 -- (-1745.040) (-1751.164) [-1738.542] (-1740.030) * (-1738.080) (-1744.729) (-1738.541) [-1748.040] -- 0:02:44
537500 -- [-1735.681] (-1746.087) (-1748.676) (-1746.180) * [-1742.922] (-1743.106) (-1738.805) (-1738.867) -- 0:02:44
538000 -- (-1744.309) (-1741.070) (-1739.896) [-1735.836] * (-1743.433) (-1747.622) [-1749.009] (-1746.771) -- 0:02:44
538500 -- (-1739.561) (-1749.521) [-1740.037] (-1744.059) * [-1744.592] (-1748.551) (-1751.166) (-1751.262) -- 0:02:43
539000 -- (-1738.784) (-1737.567) [-1741.520] (-1747.234) * (-1742.745) [-1739.956] (-1743.898) (-1741.827) -- 0:02:44
539500 -- (-1745.211) [-1743.728] (-1749.956) (-1739.406) * (-1738.218) (-1743.971) (-1749.157) [-1736.694] -- 0:02:43
540000 -- (-1740.641) [-1739.779] (-1742.144) (-1740.697) * [-1737.862] (-1744.080) (-1748.198) (-1738.628) -- 0:02:43
Average standard deviation of split frequencies: 0.013602
540500 -- (-1741.838) [-1740.550] (-1740.079) (-1744.113) * (-1742.768) (-1742.507) (-1748.758) [-1738.295] -- 0:02:43
541000 -- (-1745.289) [-1744.365] (-1749.982) (-1737.951) * (-1740.696) (-1742.724) (-1740.406) [-1748.681] -- 0:02:42
541500 -- (-1747.835) (-1744.365) [-1739.846] (-1737.248) * [-1745.931] (-1742.049) (-1746.433) (-1765.849) -- 0:02:42
542000 -- [-1742.636] (-1737.078) (-1740.541) (-1744.338) * [-1740.515] (-1740.646) (-1743.779) (-1752.480) -- 0:02:43
542500 -- (-1739.103) (-1739.505) [-1738.021] (-1752.271) * (-1738.861) (-1740.978) [-1744.829] (-1750.527) -- 0:02:42
543000 -- [-1734.123] (-1747.182) (-1743.319) (-1741.755) * (-1743.173) (-1749.450) [-1743.174] (-1744.196) -- 0:02:42
543500 -- [-1740.010] (-1744.391) (-1739.634) (-1746.431) * [-1741.532] (-1745.055) (-1745.340) (-1741.354) -- 0:02:42
544000 -- [-1737.686] (-1737.083) (-1739.153) (-1749.629) * [-1738.635] (-1742.014) (-1745.250) (-1739.399) -- 0:02:41
544500 -- [-1741.553] (-1738.560) (-1749.568) (-1743.984) * [-1741.607] (-1747.416) (-1743.978) (-1744.719) -- 0:02:42
545000 -- (-1743.809) [-1739.289] (-1736.558) (-1738.044) * (-1752.074) (-1738.278) [-1736.483] (-1745.215) -- 0:02:41
Average standard deviation of split frequencies: 0.013900
545500 -- (-1739.252) (-1742.046) [-1741.219] (-1745.442) * (-1746.669) (-1739.511) (-1738.324) [-1741.873] -- 0:02:41
546000 -- [-1739.407] (-1740.265) (-1745.776) (-1739.637) * (-1741.753) (-1736.738) (-1742.524) [-1739.914] -- 0:02:41
546500 -- [-1738.542] (-1742.380) (-1736.000) (-1741.074) * (-1750.724) [-1737.527] (-1742.728) (-1741.979) -- 0:02:40
547000 -- [-1745.724] (-1746.344) (-1738.385) (-1744.110) * [-1739.419] (-1736.631) (-1744.728) (-1746.325) -- 0:02:40
547500 -- (-1742.728) (-1748.989) (-1736.089) [-1741.583] * (-1742.568) (-1742.243) (-1747.396) [-1745.808] -- 0:02:41
548000 -- (-1747.575) (-1754.448) (-1750.261) [-1738.913] * (-1742.094) (-1738.274) (-1753.465) [-1743.754] -- 0:02:40
548500 -- (-1738.085) (-1738.819) [-1738.470] (-1739.559) * (-1741.760) (-1745.033) (-1741.033) [-1741.851] -- 0:02:40
549000 -- [-1745.148] (-1739.444) (-1741.624) (-1742.004) * (-1741.107) [-1753.087] (-1744.995) (-1736.916) -- 0:02:40
549500 -- (-1744.763) [-1742.264] (-1740.689) (-1745.698) * (-1742.408) [-1744.270] (-1739.430) (-1740.711) -- 0:02:39
550000 -- [-1746.001] (-1740.412) (-1745.979) (-1741.007) * [-1738.942] (-1742.639) (-1740.917) (-1742.219) -- 0:02:39
Average standard deviation of split frequencies: 0.012927
550500 -- (-1734.491) (-1743.972) [-1742.530] (-1743.176) * (-1745.538) (-1736.876) [-1738.734] (-1745.250) -- 0:02:40
551000 -- [-1735.840] (-1742.198) (-1745.091) (-1740.998) * (-1745.294) (-1747.576) [-1743.676] (-1750.244) -- 0:02:39
551500 -- [-1737.054] (-1741.395) (-1740.447) (-1742.082) * (-1742.808) (-1749.603) [-1735.460] (-1748.092) -- 0:02:39
552000 -- (-1737.493) (-1738.783) (-1747.302) [-1744.966] * (-1736.550) (-1745.973) [-1737.678] (-1739.805) -- 0:02:39
552500 -- (-1739.130) (-1741.463) (-1738.677) [-1740.124] * [-1751.965] (-1741.221) (-1737.353) (-1743.548) -- 0:02:38
553000 -- (-1746.016) (-1744.651) [-1741.598] (-1744.365) * [-1747.418] (-1748.576) (-1744.590) (-1751.423) -- 0:02:38
553500 -- (-1744.711) (-1742.580) [-1740.330] (-1744.978) * (-1750.057) (-1739.591) [-1752.276] (-1748.741) -- 0:02:38
554000 -- (-1735.122) [-1745.437] (-1754.901) (-1741.360) * (-1744.532) (-1749.816) (-1746.957) [-1743.239] -- 0:02:38
554500 -- [-1738.851] (-1742.687) (-1739.248) (-1740.052) * [-1741.018] (-1750.114) (-1744.978) (-1748.176) -- 0:02:38
555000 -- (-1743.588) (-1749.664) (-1748.228) [-1743.021] * [-1744.420] (-1739.835) (-1748.525) (-1745.693) -- 0:02:37
Average standard deviation of split frequencies: 0.013566
555500 -- (-1750.491) [-1741.168] (-1752.197) (-1738.895) * (-1737.767) [-1739.998] (-1744.833) (-1744.865) -- 0:02:37
556000 -- (-1742.678) (-1739.989) (-1742.308) [-1739.672] * (-1749.369) (-1736.932) (-1757.333) [-1742.088] -- 0:02:38
556500 -- (-1736.920) (-1742.413) (-1741.297) [-1737.684] * (-1752.083) [-1740.518] (-1749.261) (-1744.477) -- 0:02:37
557000 -- (-1747.264) (-1744.446) [-1741.110] (-1741.530) * (-1745.689) (-1747.255) [-1737.889] (-1745.375) -- 0:02:37
557500 -- (-1750.706) (-1750.504) (-1740.977) [-1740.343] * (-1742.674) (-1748.037) [-1737.996] (-1739.188) -- 0:02:37
558000 -- (-1744.408) (-1735.237) (-1738.820) [-1736.008] * (-1741.994) (-1745.409) (-1741.487) [-1738.252] -- 0:02:36
558500 -- [-1742.722] (-1735.346) (-1737.857) (-1742.085) * [-1741.172] (-1740.636) (-1743.090) (-1743.142) -- 0:02:36
559000 -- (-1748.014) (-1744.852) (-1742.614) [-1740.150] * (-1738.648) [-1739.921] (-1743.745) (-1746.727) -- 0:02:36
559500 -- (-1745.896) [-1741.736] (-1744.945) (-1743.405) * (-1742.123) (-1742.376) [-1742.507] (-1740.573) -- 0:02:36
560000 -- (-1740.259) (-1738.310) (-1742.520) [-1739.904] * (-1745.892) (-1740.180) [-1741.038] (-1739.670) -- 0:02:36
Average standard deviation of split frequencies: 0.012864
560500 -- (-1740.907) [-1738.720] (-1736.975) (-1741.641) * [-1739.287] (-1738.066) (-1734.673) (-1741.355) -- 0:02:36
561000 -- (-1743.248) (-1738.611) (-1741.815) [-1739.908] * [-1736.486] (-1740.817) (-1748.159) (-1745.717) -- 0:02:35
561500 -- (-1738.394) [-1742.048] (-1738.985) (-1739.189) * (-1747.531) [-1739.471] (-1745.785) (-1740.838) -- 0:02:35
562000 -- [-1748.270] (-1743.318) (-1749.010) (-1747.806) * (-1737.178) [-1742.858] (-1744.067) (-1742.587) -- 0:02:35
562500 -- (-1739.875) (-1741.783) [-1739.819] (-1740.125) * (-1743.007) [-1739.552] (-1740.995) (-1745.867) -- 0:02:35
563000 -- [-1735.791] (-1741.164) (-1743.490) (-1741.749) * (-1739.952) (-1745.451) [-1739.045] (-1750.330) -- 0:02:35
563500 -- (-1741.743) (-1751.558) (-1741.364) [-1742.913] * (-1748.001) (-1742.663) [-1742.423] (-1751.290) -- 0:02:34
564000 -- (-1748.745) [-1744.278] (-1750.146) (-1740.649) * (-1750.187) (-1737.783) [-1742.196] (-1737.375) -- 0:02:34
564500 -- (-1744.022) (-1744.749) [-1740.927] (-1739.926) * [-1751.307] (-1743.810) (-1740.315) (-1738.122) -- 0:02:34
565000 -- [-1740.459] (-1753.161) (-1748.708) (-1743.540) * (-1740.925) [-1748.026] (-1743.411) (-1739.127) -- 0:02:34
Average standard deviation of split frequencies: 0.013492
565500 -- (-1741.807) (-1745.911) [-1741.581] (-1738.963) * (-1741.582) (-1741.034) [-1743.045] (-1738.917) -- 0:02:34
566000 -- (-1743.074) (-1746.957) [-1741.067] (-1747.656) * (-1754.572) (-1745.123) (-1735.224) [-1735.784] -- 0:02:34
566500 -- (-1740.223) [-1740.279] (-1743.697) (-1744.069) * (-1738.604) (-1746.567) [-1741.806] (-1746.262) -- 0:02:33
567000 -- [-1738.183] (-1741.744) (-1735.821) (-1739.812) * [-1739.722] (-1749.793) (-1738.880) (-1752.224) -- 0:02:33
567500 -- (-1746.248) (-1748.381) (-1743.656) [-1737.294] * (-1737.968) (-1742.913) (-1744.251) [-1745.695] -- 0:02:33
568000 -- (-1742.413) [-1739.330] (-1738.216) (-1739.913) * (-1745.691) [-1746.302] (-1741.124) (-1749.238) -- 0:02:33
568500 -- (-1747.379) [-1738.730] (-1740.836) (-1741.435) * (-1746.373) (-1745.465) (-1739.863) [-1739.682] -- 0:02:33
569000 -- [-1742.719] (-1739.963) (-1742.641) (-1743.969) * (-1739.807) [-1746.146] (-1746.534) (-1739.233) -- 0:02:33
569500 -- (-1741.231) [-1739.462] (-1754.137) (-1741.326) * [-1741.528] (-1741.030) (-1755.494) (-1740.152) -- 0:02:32
570000 -- [-1741.320] (-1749.410) (-1750.946) (-1739.199) * [-1739.865] (-1742.347) (-1741.759) (-1745.059) -- 0:02:32
Average standard deviation of split frequencies: 0.013960
570500 -- (-1747.659) [-1741.505] (-1741.417) (-1737.716) * (-1737.114) [-1741.408] (-1744.221) (-1745.748) -- 0:02:32
571000 -- (-1742.437) (-1742.765) [-1738.163] (-1744.154) * (-1739.235) (-1740.772) [-1738.995] (-1751.772) -- 0:02:32
571500 -- (-1738.622) [-1746.976] (-1739.790) (-1744.059) * (-1746.304) (-1751.289) [-1737.088] (-1735.079) -- 0:02:32
572000 -- (-1747.429) [-1743.556] (-1743.502) (-1746.709) * (-1742.756) (-1739.935) (-1736.313) [-1737.805] -- 0:02:31
572500 -- (-1746.279) [-1751.233] (-1746.651) (-1755.811) * [-1744.825] (-1757.033) (-1742.154) (-1741.588) -- 0:02:31
573000 -- (-1735.783) [-1742.838] (-1748.839) (-1746.272) * (-1739.506) (-1752.489) [-1741.762] (-1741.868) -- 0:02:31
573500 -- [-1742.564] (-1740.581) (-1750.421) (-1740.085) * (-1742.630) (-1745.139) (-1738.476) [-1744.353] -- 0:02:31
574000 -- (-1735.865) (-1749.463) (-1747.290) [-1737.436] * (-1737.778) (-1746.587) [-1743.101] (-1738.247) -- 0:02:31
574500 -- (-1745.469) (-1745.195) [-1740.580] (-1741.754) * (-1735.889) [-1743.848] (-1745.058) (-1737.461) -- 0:02:31
575000 -- (-1742.195) (-1738.522) [-1743.426] (-1743.350) * (-1738.083) (-1741.780) [-1739.931] (-1741.116) -- 0:02:30
Average standard deviation of split frequencies: 0.013995
575500 -- [-1737.530] (-1747.999) (-1752.036) (-1747.722) * (-1739.756) [-1741.044] (-1740.963) (-1743.144) -- 0:02:30
576000 -- (-1742.596) (-1739.580) [-1737.334] (-1743.662) * (-1740.160) (-1748.323) [-1744.107] (-1747.974) -- 0:02:30
576500 -- (-1741.169) [-1739.664] (-1740.810) (-1746.620) * (-1738.895) (-1749.163) (-1741.742) [-1738.863] -- 0:02:30
577000 -- (-1755.051) (-1741.333) [-1742.508] (-1746.712) * (-1753.733) (-1742.814) [-1741.050] (-1740.746) -- 0:02:30
577500 -- (-1753.454) (-1744.733) [-1740.021] (-1750.239) * [-1737.685] (-1741.982) (-1739.364) (-1738.742) -- 0:02:29
578000 -- (-1744.475) (-1739.285) (-1746.551) [-1742.126] * (-1747.563) [-1744.132] (-1736.269) (-1745.737) -- 0:02:29
578500 -- (-1748.189) [-1744.243] (-1750.481) (-1743.662) * (-1739.904) [-1739.339] (-1744.097) (-1744.381) -- 0:02:29
579000 -- (-1743.190) [-1736.869] (-1751.543) (-1749.550) * (-1744.127) (-1747.346) (-1746.019) [-1742.781] -- 0:02:29
579500 -- (-1742.129) (-1740.842) [-1750.906] (-1745.460) * [-1735.752] (-1745.521) (-1738.615) (-1737.341) -- 0:02:29
580000 -- [-1741.263] (-1745.030) (-1747.313) (-1756.811) * (-1744.879) (-1746.643) (-1742.602) [-1744.157] -- 0:02:29
Average standard deviation of split frequencies: 0.014694
580500 -- (-1740.448) (-1747.483) [-1755.137] (-1745.809) * [-1737.807] (-1740.627) (-1749.099) (-1740.614) -- 0:02:28
581000 -- (-1746.005) [-1744.067] (-1754.525) (-1749.874) * (-1747.872) (-1738.938) (-1746.254) [-1742.426] -- 0:02:28
581500 -- (-1752.143) [-1736.411] (-1742.406) (-1742.560) * [-1738.345] (-1742.894) (-1741.816) (-1742.633) -- 0:02:28
582000 -- [-1749.704] (-1743.007) (-1742.280) (-1736.784) * (-1740.282) [-1745.425] (-1744.484) (-1743.542) -- 0:02:28
582500 -- (-1743.940) [-1745.131] (-1738.982) (-1741.056) * (-1747.613) (-1737.783) [-1740.220] (-1751.108) -- 0:02:28
583000 -- (-1748.715) (-1739.791) [-1735.928] (-1744.669) * (-1744.365) [-1741.934] (-1742.374) (-1755.036) -- 0:02:28
583500 -- [-1746.652] (-1744.913) (-1734.302) (-1742.171) * (-1742.637) [-1744.890] (-1740.720) (-1753.718) -- 0:02:27
584000 -- (-1735.751) (-1743.543) (-1745.382) [-1740.800] * (-1742.781) (-1739.053) [-1733.946] (-1743.191) -- 0:02:27
584500 -- (-1747.177) (-1739.002) (-1751.195) [-1739.121] * (-1736.929) [-1742.667] (-1738.542) (-1743.239) -- 0:02:27
585000 -- (-1743.157) (-1734.595) (-1746.772) [-1738.501] * (-1742.460) (-1741.205) (-1738.991) [-1735.538] -- 0:02:27
Average standard deviation of split frequencies: 0.014158
585500 -- [-1738.863] (-1742.077) (-1740.929) (-1741.543) * [-1748.399] (-1747.225) (-1745.885) (-1747.915) -- 0:02:27
586000 -- (-1736.703) (-1739.566) [-1744.423] (-1742.866) * (-1747.609) (-1741.217) (-1749.786) [-1735.488] -- 0:02:26
586500 -- (-1742.213) (-1742.178) [-1740.465] (-1744.944) * [-1738.951] (-1747.018) (-1744.475) (-1748.542) -- 0:02:26
587000 -- [-1742.308] (-1746.990) (-1742.265) (-1744.391) * [-1742.402] (-1742.780) (-1739.472) (-1747.544) -- 0:02:26
587500 -- (-1743.174) [-1742.549] (-1743.865) (-1749.977) * (-1740.155) (-1746.536) (-1738.675) [-1742.026] -- 0:02:26
588000 -- [-1740.189] (-1733.805) (-1742.103) (-1741.805) * (-1738.727) (-1747.855) [-1742.112] (-1737.463) -- 0:02:26
588500 -- (-1744.922) (-1743.507) (-1741.716) [-1739.987] * (-1745.995) (-1746.122) [-1747.176] (-1744.799) -- 0:02:26
589000 -- (-1743.659) [-1741.053] (-1743.632) (-1746.577) * (-1738.740) [-1739.056] (-1737.972) (-1736.841) -- 0:02:25
589500 -- (-1741.707) [-1739.266] (-1740.503) (-1742.164) * (-1740.952) [-1742.213] (-1743.485) (-1735.105) -- 0:02:25
590000 -- (-1749.378) [-1741.852] (-1740.582) (-1739.913) * [-1739.023] (-1732.425) (-1745.060) (-1741.779) -- 0:02:25
Average standard deviation of split frequencies: 0.015403
590500 -- [-1742.705] (-1739.822) (-1743.789) (-1747.273) * [-1743.341] (-1743.824) (-1738.335) (-1742.921) -- 0:02:25
591000 -- (-1748.019) (-1736.833) [-1744.254] (-1740.035) * [-1739.948] (-1740.742) (-1742.935) (-1740.276) -- 0:02:25
591500 -- (-1750.547) [-1736.731] (-1742.624) (-1743.566) * [-1743.016] (-1737.766) (-1743.994) (-1738.964) -- 0:02:25
592000 -- (-1750.116) [-1744.776] (-1741.367) (-1743.831) * (-1740.707) (-1740.642) [-1738.578] (-1740.668) -- 0:02:24
592500 -- (-1755.164) (-1744.191) [-1743.482] (-1742.313) * (-1739.441) (-1735.696) (-1741.969) [-1741.796] -- 0:02:24
593000 -- (-1744.416) [-1745.994] (-1742.790) (-1739.304) * (-1737.829) [-1738.512] (-1745.305) (-1742.498) -- 0:02:24
593500 -- (-1748.234) [-1739.409] (-1740.280) (-1739.719) * (-1739.716) (-1747.234) (-1748.692) [-1742.420] -- 0:02:24
594000 -- (-1745.657) (-1743.698) (-1740.299) [-1743.490] * (-1740.556) [-1737.055] (-1745.798) (-1743.680) -- 0:02:24
594500 -- (-1744.427) [-1741.841] (-1749.421) (-1743.899) * [-1746.294] (-1740.743) (-1744.554) (-1738.816) -- 0:02:23
595000 -- (-1740.734) [-1739.539] (-1735.150) (-1742.299) * (-1742.601) (-1748.650) [-1746.765] (-1738.785) -- 0:02:23
Average standard deviation of split frequencies: 0.015186
595500 -- (-1740.368) (-1744.809) (-1747.285) [-1743.571] * [-1748.069] (-1744.237) (-1743.768) (-1740.566) -- 0:02:23
596000 -- (-1744.491) (-1742.525) [-1737.380] (-1742.088) * (-1739.480) [-1743.461] (-1740.268) (-1743.155) -- 0:02:23
596500 -- [-1744.937] (-1741.817) (-1741.681) (-1739.770) * (-1740.053) (-1736.247) [-1735.041] (-1743.343) -- 0:02:23
597000 -- (-1740.755) (-1740.508) [-1740.622] (-1741.050) * (-1749.689) (-1739.090) (-1750.029) [-1737.241] -- 0:02:23
597500 -- (-1744.048) (-1745.800) [-1736.042] (-1746.892) * (-1748.409) [-1744.281] (-1742.403) (-1741.181) -- 0:02:22
598000 -- [-1740.969] (-1738.851) (-1737.286) (-1751.439) * (-1747.558) (-1746.561) (-1744.813) [-1738.096] -- 0:02:22
598500 -- (-1742.827) (-1741.099) (-1742.187) [-1738.815] * (-1754.869) (-1744.086) [-1740.696] (-1746.452) -- 0:02:22
599000 -- (-1745.279) (-1745.344) (-1744.476) [-1741.008] * [-1745.355] (-1750.218) (-1745.000) (-1742.686) -- 0:02:22
599500 -- (-1737.279) [-1742.832] (-1745.378) (-1736.254) * (-1751.516) (-1744.874) [-1742.211] (-1741.780) -- 0:02:22
600000 -- (-1740.618) [-1743.879] (-1740.629) (-1741.442) * (-1741.667) (-1739.439) [-1740.773] (-1750.496) -- 0:02:22
Average standard deviation of split frequencies: 0.015147
600500 -- (-1741.489) [-1742.898] (-1748.556) (-1748.239) * (-1742.074) (-1744.384) [-1745.122] (-1738.961) -- 0:02:21
601000 -- (-1745.370) (-1744.703) (-1736.953) [-1741.281] * (-1734.110) [-1741.165] (-1743.949) (-1742.167) -- 0:02:21
601500 -- (-1743.073) (-1749.813) [-1738.341] (-1748.509) * (-1745.178) (-1743.124) (-1741.911) [-1737.515] -- 0:02:21
602000 -- (-1741.574) (-1744.251) [-1737.427] (-1744.026) * [-1742.627] (-1743.974) (-1745.456) (-1738.872) -- 0:02:21
602500 -- [-1742.375] (-1747.539) (-1744.711) (-1738.942) * (-1743.448) [-1736.864] (-1742.710) (-1747.483) -- 0:02:21
603000 -- (-1741.682) [-1748.381] (-1734.220) (-1745.212) * (-1754.525) [-1739.754] (-1742.185) (-1735.604) -- 0:02:20
603500 -- (-1743.388) [-1748.915] (-1747.668) (-1743.994) * (-1743.719) (-1738.504) (-1740.912) [-1747.723] -- 0:02:20
604000 -- (-1741.038) [-1741.443] (-1738.059) (-1733.581) * (-1743.717) (-1744.280) (-1748.438) [-1739.583] -- 0:02:20
604500 -- [-1742.505] (-1743.714) (-1742.010) (-1738.932) * (-1748.249) [-1741.599] (-1744.005) (-1737.561) -- 0:02:20
605000 -- (-1748.119) (-1739.331) [-1742.717] (-1741.432) * (-1746.896) [-1740.128] (-1746.523) (-1742.930) -- 0:02:20
Average standard deviation of split frequencies: 0.014858
605500 -- (-1744.255) (-1742.429) [-1739.607] (-1742.027) * (-1740.998) (-1741.299) [-1744.334] (-1741.096) -- 0:02:20
606000 -- (-1746.399) [-1739.304] (-1748.015) (-1740.838) * (-1744.587) (-1749.288) [-1741.237] (-1743.458) -- 0:02:19
606500 -- (-1743.300) [-1740.047] (-1747.058) (-1740.899) * [-1746.263] (-1738.736) (-1770.038) (-1734.908) -- 0:02:19
607000 -- (-1742.686) [-1740.827] (-1748.249) (-1750.744) * (-1742.426) [-1743.412] (-1750.257) (-1742.057) -- 0:02:19
607500 -- [-1741.939] (-1739.292) (-1739.982) (-1746.482) * (-1745.899) [-1739.106] (-1739.794) (-1745.521) -- 0:02:19
608000 -- (-1749.264) (-1745.977) [-1738.250] (-1741.149) * [-1738.790] (-1739.912) (-1737.269) (-1740.291) -- 0:02:19
608500 -- (-1745.771) (-1740.756) [-1737.532] (-1745.685) * (-1745.950) (-1738.537) [-1736.237] (-1741.303) -- 0:02:18
609000 -- [-1745.366] (-1744.113) (-1737.185) (-1742.002) * [-1745.736] (-1745.897) (-1746.508) (-1744.167) -- 0:02:18
609500 -- (-1741.440) (-1747.384) (-1738.199) [-1736.002] * (-1737.927) (-1742.921) (-1743.060) [-1745.154] -- 0:02:18
610000 -- (-1748.582) (-1744.317) [-1742.047] (-1739.968) * (-1738.346) (-1750.081) (-1746.799) [-1739.244] -- 0:02:18
Average standard deviation of split frequencies: 0.015362
610500 -- [-1746.286] (-1739.201) (-1738.977) (-1743.698) * (-1739.055) [-1739.576] (-1738.655) (-1750.148) -- 0:02:18
611000 -- (-1744.132) (-1744.742) (-1742.666) [-1742.364] * [-1735.260] (-1744.655) (-1745.247) (-1743.442) -- 0:02:18
611500 -- (-1751.177) (-1747.778) (-1740.556) [-1742.263] * [-1739.793] (-1743.243) (-1738.749) (-1750.879) -- 0:02:17
612000 -- (-1749.023) (-1747.541) (-1749.117) [-1739.256] * (-1741.777) (-1735.599) (-1756.700) [-1737.362] -- 0:02:17
612500 -- (-1740.588) [-1746.239] (-1746.747) (-1746.004) * (-1735.924) [-1736.226] (-1749.233) (-1737.698) -- 0:02:17
613000 -- [-1739.842] (-1741.198) (-1749.236) (-1747.959) * (-1747.815) (-1744.306) [-1752.359] (-1739.851) -- 0:02:17
613500 -- (-1744.965) [-1745.955] (-1740.913) (-1752.992) * (-1749.036) (-1745.745) (-1758.603) [-1744.764] -- 0:02:17
614000 -- [-1742.373] (-1740.090) (-1750.899) (-1740.324) * (-1750.711) (-1744.252) (-1743.240) [-1738.704] -- 0:02:17
614500 -- [-1739.181] (-1742.972) (-1739.922) (-1746.733) * (-1746.498) (-1754.993) [-1739.448] (-1737.659) -- 0:02:16
615000 -- [-1741.809] (-1742.566) (-1737.779) (-1737.270) * (-1739.098) (-1743.615) (-1743.634) [-1736.406] -- 0:02:16
Average standard deviation of split frequencies: 0.014464
615500 -- (-1746.396) [-1742.433] (-1738.834) (-1738.236) * [-1738.100] (-1737.171) (-1736.816) (-1736.839) -- 0:02:16
616000 -- (-1746.678) (-1741.725) [-1737.939] (-1741.745) * (-1741.184) (-1741.566) [-1743.145] (-1737.968) -- 0:02:16
616500 -- (-1742.527) (-1740.733) [-1742.425] (-1743.211) * (-1744.697) (-1742.383) (-1738.817) [-1740.964] -- 0:02:16
617000 -- [-1745.344] (-1748.427) (-1751.797) (-1745.536) * [-1740.860] (-1750.389) (-1737.955) (-1750.950) -- 0:02:15
617500 -- (-1743.561) (-1745.991) [-1736.611] (-1742.073) * (-1751.345) (-1746.085) (-1742.592) [-1738.028] -- 0:02:15
618000 -- (-1752.873) [-1735.170] (-1748.120) (-1743.176) * [-1737.911] (-1744.447) (-1741.733) (-1745.218) -- 0:02:15
618500 -- (-1741.499) [-1742.716] (-1750.522) (-1745.529) * (-1742.685) (-1754.218) (-1750.007) [-1741.521] -- 0:02:15
619000 -- (-1741.223) (-1736.787) (-1747.804) [-1747.094] * (-1738.919) (-1744.923) [-1737.769] (-1747.833) -- 0:02:15
619500 -- (-1740.463) (-1734.969) [-1746.574] (-1750.778) * (-1739.961) (-1741.806) (-1744.913) [-1744.367] -- 0:02:15
620000 -- (-1737.653) [-1742.475] (-1741.302) (-1742.686) * (-1742.435) [-1744.737] (-1736.701) (-1740.044) -- 0:02:14
Average standard deviation of split frequencies: 0.014431
620500 -- (-1741.537) (-1736.923) [-1743.120] (-1740.106) * [-1745.122] (-1744.040) (-1740.453) (-1743.679) -- 0:02:14
621000 -- (-1741.224) (-1749.386) [-1740.298] (-1748.296) * (-1743.904) (-1741.055) [-1739.903] (-1745.941) -- 0:02:14
621500 -- (-1744.582) (-1744.938) [-1740.767] (-1741.006) * (-1738.751) [-1745.227] (-1744.243) (-1737.740) -- 0:02:14
622000 -- (-1741.384) (-1750.417) [-1737.572] (-1744.519) * (-1740.970) [-1736.447] (-1741.599) (-1745.263) -- 0:02:14
622500 -- (-1742.073) (-1737.227) [-1741.207] (-1745.214) * (-1741.148) (-1739.629) [-1744.903] (-1752.975) -- 0:02:14
623000 -- (-1749.369) [-1739.548] (-1742.201) (-1746.498) * (-1740.875) (-1744.724) [-1739.301] (-1747.987) -- 0:02:13
623500 -- (-1749.526) (-1752.873) [-1736.833] (-1745.019) * (-1743.750) (-1742.700) [-1743.368] (-1746.436) -- 0:02:13
624000 -- [-1753.329] (-1740.748) (-1740.847) (-1749.377) * (-1740.280) (-1741.281) (-1741.541) [-1747.517] -- 0:02:13
624500 -- (-1751.262) [-1738.942] (-1745.870) (-1745.492) * (-1742.786) [-1739.096] (-1742.300) (-1741.741) -- 0:02:13
625000 -- [-1737.836] (-1739.602) (-1745.878) (-1743.431) * [-1740.447] (-1741.145) (-1747.899) (-1742.212) -- 0:02:13
Average standard deviation of split frequencies: 0.014233
625500 -- [-1735.432] (-1737.461) (-1749.797) (-1747.796) * (-1745.191) (-1738.427) [-1739.102] (-1739.286) -- 0:02:12
626000 -- (-1740.520) [-1739.450] (-1743.465) (-1748.540) * (-1735.800) (-1743.077) [-1741.349] (-1747.798) -- 0:02:12
626500 -- (-1739.464) (-1739.646) [-1744.388] (-1740.773) * (-1743.553) (-1737.373) (-1744.303) [-1740.162] -- 0:02:12
627000 -- (-1744.719) [-1742.203] (-1745.167) (-1740.717) * [-1739.497] (-1740.670) (-1743.765) (-1742.174) -- 0:02:12
627500 -- [-1738.012] (-1744.440) (-1738.818) (-1751.916) * (-1737.760) (-1748.255) (-1738.055) [-1738.444] -- 0:02:12
628000 -- (-1742.662) (-1749.647) (-1743.367) [-1738.475] * [-1749.003] (-1746.419) (-1741.919) (-1747.425) -- 0:02:12
628500 -- (-1741.312) (-1742.226) [-1739.716] (-1746.051) * (-1745.481) (-1745.653) [-1741.741] (-1746.140) -- 0:02:11
629000 -- [-1739.474] (-1744.171) (-1742.722) (-1745.994) * (-1742.494) (-1740.826) [-1739.495] (-1741.509) -- 0:02:11
629500 -- (-1750.165) (-1740.421) (-1742.149) [-1747.221] * (-1752.531) (-1749.081) (-1739.094) [-1742.792] -- 0:02:11
630000 -- (-1741.449) (-1740.697) [-1740.623] (-1741.479) * (-1753.047) (-1745.648) (-1746.387) [-1734.936] -- 0:02:11
Average standard deviation of split frequencies: 0.015024
630500 -- [-1743.901] (-1740.879) (-1736.221) (-1740.813) * (-1753.328) (-1750.367) (-1738.716) [-1739.920] -- 0:02:11
631000 -- (-1748.336) [-1745.086] (-1739.671) (-1742.085) * (-1752.588) (-1747.421) (-1746.882) [-1738.778] -- 0:02:10
631500 -- (-1747.127) (-1741.128) (-1743.107) [-1748.311] * (-1751.333) (-1744.508) (-1745.502) [-1737.934] -- 0:02:10
632000 -- (-1743.930) (-1752.288) [-1740.783] (-1751.978) * (-1746.254) (-1756.503) (-1745.305) [-1740.101] -- 0:02:10
632500 -- [-1747.209] (-1747.429) (-1741.505) (-1741.233) * (-1745.161) [-1743.352] (-1749.635) (-1744.899) -- 0:02:10
633000 -- (-1743.334) (-1752.003) (-1736.627) [-1736.630] * (-1754.392) (-1743.512) (-1745.866) [-1736.503] -- 0:02:10
633500 -- (-1745.368) (-1754.694) (-1743.373) [-1739.242] * [-1742.349] (-1748.848) (-1753.626) (-1742.162) -- 0:02:10
634000 -- (-1740.535) [-1744.257] (-1746.028) (-1746.753) * (-1743.115) (-1744.166) (-1740.031) [-1741.149] -- 0:02:09
634500 -- (-1748.781) (-1738.968) [-1739.000] (-1750.702) * (-1736.864) (-1746.186) (-1745.906) [-1742.670] -- 0:02:09
635000 -- [-1749.530] (-1739.860) (-1742.745) (-1746.503) * [-1743.788] (-1742.333) (-1749.780) (-1750.963) -- 0:02:09
Average standard deviation of split frequencies: 0.014750
635500 -- (-1744.470) (-1742.428) [-1745.025] (-1740.843) * (-1741.205) [-1735.029] (-1749.509) (-1758.885) -- 0:02:09
636000 -- (-1745.725) (-1741.000) (-1742.605) [-1738.069] * (-1748.919) [-1740.592] (-1749.479) (-1744.031) -- 0:02:09
636500 -- [-1746.203] (-1747.789) (-1743.535) (-1744.569) * (-1743.635) [-1744.646] (-1748.518) (-1748.281) -- 0:02:09
637000 -- (-1739.426) [-1748.906] (-1741.793) (-1742.612) * (-1747.241) (-1740.203) (-1741.452) [-1737.839] -- 0:02:08
637500 -- [-1738.798] (-1743.791) (-1743.648) (-1761.321) * (-1746.627) (-1736.840) [-1739.117] (-1737.565) -- 0:02:08
638000 -- (-1741.717) [-1743.669] (-1750.136) (-1746.311) * (-1744.967) (-1736.280) [-1739.240] (-1743.330) -- 0:02:08
638500 -- (-1746.116) [-1743.664] (-1745.877) (-1738.813) * (-1749.772) (-1743.069) [-1741.918] (-1743.487) -- 0:02:07
639000 -- [-1741.601] (-1746.079) (-1738.111) (-1740.045) * [-1738.857] (-1741.459) (-1741.938) (-1746.120) -- 0:02:08
639500 -- (-1743.552) [-1746.456] (-1736.679) (-1745.467) * (-1740.330) [-1741.536] (-1740.578) (-1746.443) -- 0:02:07
640000 -- (-1739.449) (-1746.753) (-1738.975) [-1742.373] * (-1745.776) [-1744.206] (-1745.165) (-1748.101) -- 0:02:07
Average standard deviation of split frequencies: 0.014275
640500 -- (-1737.836) (-1742.666) (-1743.652) [-1740.154] * (-1744.792) [-1742.386] (-1746.635) (-1743.201) -- 0:02:07
641000 -- (-1742.343) [-1738.467] (-1741.626) (-1743.230) * (-1749.142) [-1739.211] (-1740.868) (-1740.199) -- 0:02:07
641500 -- [-1740.804] (-1739.281) (-1743.131) (-1740.726) * (-1743.775) (-1749.212) (-1737.514) [-1737.306] -- 0:02:07
642000 -- (-1741.477) (-1737.415) (-1736.061) [-1740.774] * (-1749.409) [-1741.510] (-1746.661) (-1740.501) -- 0:02:07
642500 -- (-1740.494) (-1749.849) (-1737.354) [-1746.967] * [-1738.293] (-1739.449) (-1736.922) (-1735.224) -- 0:02:06
643000 -- [-1736.103] (-1737.249) (-1741.295) (-1741.339) * (-1740.594) (-1741.471) [-1737.701] (-1748.289) -- 0:02:06
643500 -- [-1740.110] (-1739.657) (-1738.355) (-1745.691) * [-1739.447] (-1742.820) (-1742.691) (-1735.916) -- 0:02:06
644000 -- (-1750.579) (-1739.662) [-1742.676] (-1741.194) * (-1735.083) [-1741.667] (-1742.245) (-1747.638) -- 0:02:06
644500 -- (-1747.201) (-1745.474) (-1739.099) [-1741.721] * (-1739.209) (-1739.198) [-1740.913] (-1743.976) -- 0:02:06
645000 -- [-1743.543] (-1739.075) (-1741.168) (-1737.476) * (-1740.575) (-1747.710) (-1748.292) [-1740.083] -- 0:02:06
Average standard deviation of split frequencies: 0.014303
645500 -- (-1744.541) [-1744.140] (-1741.363) (-1740.443) * (-1745.373) (-1737.132) [-1739.213] (-1749.426) -- 0:02:05
646000 -- (-1735.633) (-1739.741) [-1737.525] (-1751.927) * (-1743.421) (-1741.434) [-1739.577] (-1740.247) -- 0:02:05
646500 -- [-1736.996] (-1742.544) (-1744.733) (-1745.847) * (-1740.965) (-1746.278) (-1753.510) [-1744.090] -- 0:02:05
647000 -- (-1737.347) (-1739.661) [-1738.751] (-1747.335) * (-1751.487) (-1737.561) [-1738.059] (-1739.393) -- 0:02:04
647500 -- (-1737.456) [-1739.413] (-1744.367) (-1741.922) * (-1738.311) (-1737.647) [-1742.343] (-1737.705) -- 0:02:05
648000 -- (-1741.279) (-1744.426) (-1745.087) [-1745.000] * (-1744.912) [-1741.791] (-1742.577) (-1750.671) -- 0:02:04
648500 -- (-1737.286) (-1739.555) [-1739.824] (-1734.271) * (-1746.153) (-1743.007) (-1751.633) [-1741.062] -- 0:02:04
649000 -- (-1738.452) (-1739.328) (-1735.754) [-1739.499] * (-1736.473) [-1742.243] (-1749.238) (-1743.749) -- 0:02:04
649500 -- (-1738.196) (-1744.171) (-1741.667) [-1743.499] * (-1743.714) (-1744.420) (-1743.687) [-1737.047] -- 0:02:04
650000 -- (-1739.999) (-1738.687) [-1738.869] (-1739.129) * [-1743.623] (-1745.265) (-1745.591) (-1738.123) -- 0:02:03
Average standard deviation of split frequencies: 0.013983
650500 -- [-1737.513] (-1738.311) (-1735.263) (-1739.274) * (-1740.814) (-1746.433) [-1737.554] (-1744.734) -- 0:02:04
651000 -- (-1745.001) (-1736.510) [-1736.286] (-1739.881) * [-1743.441] (-1751.081) (-1743.600) (-1745.311) -- 0:02:03
651500 -- (-1757.310) (-1737.994) (-1748.002) [-1735.195] * (-1750.552) (-1742.562) [-1745.039] (-1743.985) -- 0:02:03
652000 -- (-1748.481) (-1739.099) (-1739.786) [-1739.395] * [-1738.162] (-1744.263) (-1745.154) (-1747.587) -- 0:02:03
652500 -- [-1741.306] (-1750.573) (-1742.886) (-1745.356) * (-1752.392) [-1738.029] (-1741.431) (-1736.806) -- 0:02:03
653000 -- (-1739.028) (-1748.889) (-1741.854) [-1745.868] * (-1751.535) (-1743.975) [-1738.503] (-1740.053) -- 0:02:03
653500 -- (-1745.785) (-1742.094) (-1739.262) [-1742.438] * [-1739.807] (-1732.705) (-1750.288) (-1741.133) -- 0:02:03
654000 -- (-1746.570) (-1743.752) [-1743.591] (-1740.093) * (-1744.325) [-1745.265] (-1746.689) (-1742.613) -- 0:02:02
654500 -- (-1742.664) (-1754.198) [-1738.259] (-1743.878) * (-1741.530) (-1742.829) [-1749.244] (-1744.579) -- 0:02:02
655000 -- [-1743.853] (-1742.645) (-1741.615) (-1738.120) * (-1743.815) [-1742.075] (-1754.355) (-1746.842) -- 0:02:02
Average standard deviation of split frequencies: 0.014085
655500 -- (-1742.513) (-1750.711) (-1744.380) [-1746.952] * [-1746.123] (-1734.406) (-1742.949) (-1745.596) -- 0:02:01
656000 -- (-1743.168) (-1741.653) [-1742.519] (-1740.548) * (-1746.285) (-1740.746) (-1748.461) [-1743.972] -- 0:02:02
656500 -- (-1745.132) (-1736.934) [-1737.913] (-1737.210) * [-1742.205] (-1740.089) (-1745.357) (-1747.507) -- 0:02:01
657000 -- [-1741.494] (-1737.785) (-1736.791) (-1747.136) * [-1737.020] (-1743.641) (-1741.158) (-1743.402) -- 0:02:01
657500 -- (-1752.579) (-1747.893) [-1742.168] (-1743.674) * (-1745.734) (-1742.738) (-1738.147) [-1737.811] -- 0:02:01
658000 -- (-1744.394) [-1739.449] (-1735.127) (-1739.982) * (-1746.165) (-1744.771) (-1746.053) [-1738.189] -- 0:02:01
658500 -- [-1747.924] (-1747.831) (-1740.665) (-1743.124) * (-1741.320) (-1741.306) [-1743.827] (-1739.114) -- 0:02:00
659000 -- (-1746.825) (-1744.388) [-1740.057] (-1749.124) * (-1749.066) (-1738.783) (-1759.642) [-1740.327] -- 0:02:01
659500 -- (-1748.873) [-1741.435] (-1739.464) (-1748.569) * (-1742.002) (-1742.063) [-1739.025] (-1744.327) -- 0:02:00
660000 -- (-1744.062) [-1740.532] (-1740.000) (-1750.547) * (-1738.851) (-1741.150) (-1745.355) [-1745.241] -- 0:02:00
Average standard deviation of split frequencies: 0.013700
660500 -- [-1749.850] (-1740.543) (-1743.460) (-1741.867) * [-1740.559] (-1743.914) (-1739.956) (-1736.871) -- 0:02:00
661000 -- (-1748.456) [-1743.895] (-1735.434) (-1751.603) * (-1740.581) (-1745.956) [-1746.071] (-1747.432) -- 0:02:00
661500 -- (-1742.163) (-1749.519) [-1742.353] (-1741.582) * (-1748.695) [-1738.157] (-1749.988) (-1745.086) -- 0:01:59
662000 -- (-1741.895) [-1744.150] (-1744.154) (-1744.883) * [-1741.969] (-1750.606) (-1742.794) (-1756.908) -- 0:01:59
662500 -- (-1750.447) (-1744.995) [-1737.264] (-1739.643) * (-1740.529) [-1752.481] (-1742.936) (-1742.023) -- 0:01:59
663000 -- (-1750.339) [-1740.823] (-1736.751) (-1741.507) * (-1738.448) (-1745.060) (-1742.787) [-1738.985] -- 0:01:59
663500 -- [-1740.770] (-1747.625) (-1737.763) (-1744.150) * [-1737.715] (-1745.875) (-1740.623) (-1741.280) -- 0:01:59
664000 -- (-1743.153) (-1741.732) [-1745.788] (-1744.767) * (-1737.794) (-1740.160) (-1738.071) [-1739.367] -- 0:01:58
664500 -- (-1746.175) (-1746.952) (-1755.753) [-1744.863] * (-1747.091) (-1743.321) [-1742.616] (-1746.957) -- 0:01:59
665000 -- [-1750.671] (-1745.863) (-1745.897) (-1741.526) * (-1739.135) [-1738.595] (-1747.827) (-1737.171) -- 0:01:58
Average standard deviation of split frequencies: 0.013236
665500 -- (-1736.573) [-1745.978] (-1741.838) (-1742.106) * (-1749.342) (-1738.802) (-1750.704) [-1737.798] -- 0:01:58
666000 -- (-1750.870) (-1748.681) [-1734.801] (-1743.785) * (-1740.028) [-1740.961] (-1744.711) (-1744.017) -- 0:01:58
666500 -- (-1753.285) [-1741.606] (-1739.941) (-1742.936) * [-1738.064] (-1734.525) (-1745.807) (-1753.392) -- 0:01:58
667000 -- (-1744.771) (-1740.759) (-1739.212) [-1746.399] * (-1747.076) [-1740.268] (-1735.238) (-1745.738) -- 0:01:57
667500 -- (-1749.064) (-1749.855) [-1741.403] (-1743.065) * (-1750.458) [-1744.366] (-1737.619) (-1743.396) -- 0:01:58
668000 -- [-1750.868] (-1757.914) (-1749.090) (-1747.186) * (-1751.187) (-1738.796) [-1740.077] (-1744.520) -- 0:01:57
668500 -- (-1743.735) (-1742.475) (-1737.799) [-1746.565] * (-1743.331) [-1747.395] (-1746.165) (-1739.330) -- 0:01:57
669000 -- (-1755.091) (-1742.331) (-1741.916) [-1747.010] * [-1739.003] (-1746.985) (-1754.809) (-1737.722) -- 0:01:57
669500 -- (-1742.788) (-1749.941) [-1743.200] (-1745.540) * [-1739.159] (-1740.980) (-1749.747) (-1745.458) -- 0:01:56
670000 -- (-1744.497) (-1746.981) [-1742.588] (-1751.632) * (-1738.345) (-1750.683) (-1743.623) [-1742.846] -- 0:01:56
Average standard deviation of split frequencies: 0.013074
670500 -- (-1742.263) [-1742.585] (-1739.903) (-1745.252) * (-1738.800) (-1758.206) [-1739.250] (-1748.996) -- 0:01:56
671000 -- (-1742.416) (-1737.936) [-1737.696] (-1745.465) * (-1739.313) (-1739.722) [-1737.780] (-1741.901) -- 0:01:56
671500 -- [-1749.234] (-1741.662) (-1738.784) (-1744.560) * (-1753.044) (-1740.785) (-1737.713) [-1738.438] -- 0:01:56
672000 -- (-1743.679) [-1737.107] (-1745.797) (-1747.556) * (-1742.903) [-1737.851] (-1745.160) (-1739.895) -- 0:01:56
672500 -- (-1743.319) (-1739.041) (-1743.456) [-1738.743] * (-1743.926) (-1739.279) [-1744.016] (-1747.256) -- 0:01:55
673000 -- (-1739.444) [-1748.482] (-1743.669) (-1739.231) * (-1748.751) [-1740.603] (-1743.447) (-1742.213) -- 0:01:55
673500 -- (-1745.134) (-1747.781) (-1737.059) [-1735.177] * (-1755.885) (-1744.684) [-1743.506] (-1735.183) -- 0:01:55
674000 -- (-1749.059) (-1739.442) (-1742.488) [-1736.595] * (-1739.636) [-1743.921] (-1739.578) (-1738.473) -- 0:01:55
674500 -- (-1738.993) (-1740.494) (-1739.155) [-1739.161] * [-1741.905] (-1744.883) (-1741.411) (-1734.734) -- 0:01:55
675000 -- (-1745.233) (-1741.910) [-1743.367] (-1748.613) * (-1754.318) (-1749.031) (-1737.657) [-1735.797] -- 0:01:55
Average standard deviation of split frequencies: 0.012134
675500 -- [-1742.225] (-1740.041) (-1747.975) (-1745.395) * (-1737.533) [-1748.029] (-1753.121) (-1743.492) -- 0:01:54
676000 -- (-1744.455) (-1744.116) (-1747.443) [-1737.876] * (-1747.290) [-1746.918] (-1747.913) (-1750.508) -- 0:01:55
676500 -- [-1742.688] (-1737.644) (-1737.318) (-1741.085) * (-1739.071) (-1751.419) [-1753.893] (-1748.478) -- 0:01:54
677000 -- [-1738.463] (-1741.325) (-1742.785) (-1743.459) * [-1741.603] (-1752.362) (-1743.059) (-1743.805) -- 0:01:54
677500 -- [-1738.714] (-1744.220) (-1740.357) (-1739.623) * (-1739.159) [-1739.898] (-1750.700) (-1749.841) -- 0:01:54
678000 -- [-1739.343] (-1744.452) (-1735.179) (-1742.321) * (-1739.183) [-1748.783] (-1743.157) (-1740.648) -- 0:01:53
678500 -- (-1748.661) (-1744.446) [-1740.576] (-1743.353) * (-1747.797) (-1750.067) [-1738.918] (-1742.376) -- 0:01:53
679000 -- (-1750.177) (-1737.402) [-1743.386] (-1745.121) * (-1737.381) [-1738.103] (-1744.931) (-1745.039) -- 0:01:53
679500 -- [-1743.465] (-1739.263) (-1749.170) (-1738.236) * (-1742.128) [-1747.919] (-1743.813) (-1745.960) -- 0:01:53
680000 -- (-1740.562) [-1741.772] (-1745.265) (-1738.287) * (-1738.650) (-1750.426) [-1745.704] (-1738.209) -- 0:01:53
Average standard deviation of split frequencies: 0.011635
680500 -- [-1743.731] (-1740.901) (-1749.544) (-1743.280) * (-1740.606) (-1748.416) [-1746.295] (-1749.493) -- 0:01:53
681000 -- (-1745.158) (-1747.487) [-1742.442] (-1743.471) * (-1744.271) [-1735.597] (-1746.924) (-1742.197) -- 0:01:52
681500 -- (-1742.125) [-1739.739] (-1741.013) (-1737.250) * (-1739.631) (-1741.809) [-1737.068] (-1753.103) -- 0:01:52
682000 -- (-1747.316) [-1733.212] (-1737.783) (-1746.079) * (-1740.877) (-1742.116) [-1741.194] (-1738.659) -- 0:01:52
682500 -- (-1747.714) [-1748.932] (-1749.201) (-1746.905) * (-1748.717) (-1748.642) [-1742.541] (-1742.969) -- 0:01:52
683000 -- [-1746.270] (-1744.290) (-1744.326) (-1746.496) * (-1740.179) [-1741.378] (-1748.924) (-1737.818) -- 0:01:52
683500 -- [-1739.304] (-1743.777) (-1739.491) (-1742.383) * [-1742.576] (-1752.282) (-1741.885) (-1742.540) -- 0:01:52
684000 -- [-1736.910] (-1742.011) (-1741.334) (-1745.637) * (-1747.611) (-1740.368) [-1751.880] (-1746.916) -- 0:01:51
684500 -- [-1750.166] (-1742.393) (-1750.492) (-1739.695) * (-1747.340) [-1741.459] (-1743.360) (-1738.077) -- 0:01:51
685000 -- (-1743.011) (-1741.281) (-1735.857) [-1741.384] * [-1739.666] (-1741.286) (-1742.085) (-1749.937) -- 0:01:51
Average standard deviation of split frequencies: 0.011064
685500 -- (-1741.342) [-1752.352] (-1746.301) (-1746.885) * (-1744.820) [-1740.911] (-1740.020) (-1748.325) -- 0:01:51
686000 -- (-1748.487) (-1742.959) (-1748.262) [-1738.985] * (-1746.892) (-1746.124) (-1741.245) [-1739.949] -- 0:01:51
686500 -- [-1740.729] (-1745.040) (-1744.283) (-1738.554) * [-1751.388] (-1741.697) (-1738.964) (-1755.880) -- 0:01:50
687000 -- (-1737.556) (-1749.935) (-1744.094) [-1739.763] * [-1740.022] (-1747.075) (-1738.508) (-1742.483) -- 0:01:50
687500 -- (-1739.189) [-1736.102] (-1761.572) (-1740.041) * (-1741.321) (-1744.720) [-1738.463] (-1749.387) -- 0:01:50
688000 -- [-1739.945] (-1747.246) (-1749.137) (-1742.655) * (-1739.373) (-1742.836) [-1747.799] (-1745.415) -- 0:01:50
688500 -- [-1738.975] (-1744.150) (-1746.114) (-1744.749) * [-1738.955] (-1750.282) (-1746.423) (-1741.295) -- 0:01:50
689000 -- [-1745.257] (-1745.339) (-1745.453) (-1740.657) * (-1742.013) [-1741.917] (-1748.465) (-1746.771) -- 0:01:50
689500 -- (-1746.960) [-1741.163] (-1752.241) (-1744.385) * (-1742.505) (-1746.385) (-1743.814) [-1746.600] -- 0:01:49
690000 -- (-1739.943) (-1738.779) (-1749.636) [-1742.261] * (-1749.224) (-1741.308) (-1739.408) [-1747.176] -- 0:01:49
Average standard deviation of split frequencies: 0.011671
690500 -- (-1744.234) (-1733.983) [-1748.812] (-1744.143) * (-1749.116) [-1739.127] (-1745.534) (-1740.223) -- 0:01:49
691000 -- (-1739.783) [-1738.885] (-1743.930) (-1744.323) * (-1742.668) (-1740.224) [-1738.448] (-1738.150) -- 0:01:49
691500 -- [-1747.163] (-1745.924) (-1742.078) (-1746.472) * (-1741.496) (-1738.498) [-1738.454] (-1752.754) -- 0:01:49
692000 -- (-1745.134) (-1738.148) (-1743.724) [-1744.404] * (-1741.021) (-1750.659) [-1745.033] (-1743.750) -- 0:01:49
692500 -- (-1737.062) [-1738.953] (-1746.029) (-1742.306) * (-1740.887) [-1740.451] (-1749.233) (-1743.604) -- 0:01:48
693000 -- (-1746.715) (-1744.840) (-1744.974) [-1739.269] * (-1749.018) (-1760.333) [-1737.623] (-1743.074) -- 0:01:48
693500 -- [-1738.286] (-1746.426) (-1738.952) (-1737.372) * (-1747.844) (-1743.909) (-1746.189) [-1741.477] -- 0:01:48
694000 -- (-1743.186) (-1749.147) (-1737.250) [-1744.228] * (-1742.183) [-1747.306] (-1744.909) (-1742.748) -- 0:01:48
694500 -- (-1758.816) [-1748.629] (-1745.247) (-1742.299) * (-1749.540) (-1742.829) (-1750.714) [-1740.964] -- 0:01:48
695000 -- (-1745.561) (-1738.209) (-1741.120) [-1742.823] * (-1746.575) [-1737.742] (-1743.103) (-1744.859) -- 0:01:47
Average standard deviation of split frequencies: 0.011650
695500 -- [-1742.160] (-1735.800) (-1751.999) (-1750.116) * (-1753.688) (-1743.562) [-1735.080] (-1749.355) -- 0:01:48
696000 -- (-1742.270) (-1747.220) [-1740.242] (-1738.541) * (-1747.347) [-1737.262] (-1743.068) (-1738.047) -- 0:01:47
696500 -- [-1742.686] (-1747.700) (-1749.310) (-1735.879) * (-1745.210) (-1740.798) (-1736.956) [-1746.374] -- 0:01:47
697000 -- (-1745.518) (-1744.855) [-1739.071] (-1747.164) * (-1739.478) (-1750.930) [-1742.213] (-1743.886) -- 0:01:47
697500 -- [-1744.463] (-1745.464) (-1746.430) (-1749.444) * [-1740.192] (-1739.917) (-1740.672) (-1742.451) -- 0:01:47
698000 -- (-1742.497) (-1743.375) (-1747.169) [-1740.450] * (-1750.787) (-1741.682) (-1736.976) [-1746.484] -- 0:01:46
698500 -- (-1739.987) [-1739.171] (-1744.990) (-1746.180) * [-1740.942] (-1737.112) (-1741.352) (-1742.364) -- 0:01:47
699000 -- (-1745.187) [-1741.749] (-1745.142) (-1743.958) * (-1739.895) (-1744.674) (-1737.917) [-1741.138] -- 0:01:46
699500 -- (-1739.873) (-1742.518) (-1745.107) [-1736.743] * (-1752.325) (-1742.052) [-1740.383] (-1738.638) -- 0:01:46
700000 -- (-1745.856) [-1737.894] (-1747.891) (-1737.148) * [-1739.011] (-1747.959) (-1736.265) (-1738.036) -- 0:01:46
Average standard deviation of split frequencies: 0.011370
700500 -- (-1736.307) (-1748.394) [-1737.963] (-1736.548) * (-1746.957) [-1742.981] (-1736.071) (-1746.760) -- 0:01:46
701000 -- (-1742.579) [-1741.818] (-1736.855) (-1738.335) * (-1747.114) (-1739.804) [-1741.619] (-1745.750) -- 0:01:46
701500 -- (-1749.675) (-1747.655) [-1741.874] (-1741.763) * [-1739.756] (-1741.442) (-1740.310) (-1745.292) -- 0:01:45
702000 -- (-1740.354) [-1734.233] (-1741.341) (-1743.227) * [-1739.526] (-1744.423) (-1740.669) (-1740.006) -- 0:01:45
702500 -- (-1746.156) [-1746.409] (-1743.085) (-1750.574) * [-1743.552] (-1738.626) (-1742.850) (-1747.781) -- 0:01:45
703000 -- [-1741.332] (-1747.626) (-1747.703) (-1746.645) * (-1741.793) (-1742.442) (-1737.738) [-1741.918] -- 0:01:45
703500 -- (-1743.192) [-1749.440] (-1749.148) (-1743.214) * (-1752.372) [-1743.780] (-1745.733) (-1744.193) -- 0:01:44
704000 -- (-1745.140) [-1739.173] (-1742.572) (-1739.115) * [-1742.636] (-1748.025) (-1739.603) (-1742.065) -- 0:01:45
704500 -- (-1742.957) (-1742.933) (-1748.139) [-1737.945] * [-1737.174] (-1734.316) (-1742.134) (-1751.631) -- 0:01:44
705000 -- (-1753.274) [-1737.379] (-1749.529) (-1740.808) * (-1743.687) (-1736.775) [-1738.250] (-1744.208) -- 0:01:44
Average standard deviation of split frequencies: 0.011752
705500 -- (-1746.002) (-1744.700) [-1738.063] (-1737.495) * [-1735.721] (-1738.372) (-1742.871) (-1743.417) -- 0:01:44
706000 -- (-1744.562) (-1737.100) (-1738.582) [-1741.933] * (-1740.153) [-1744.102] (-1739.109) (-1740.796) -- 0:01:44
706500 -- (-1747.589) [-1738.260] (-1738.945) (-1739.031) * [-1745.028] (-1742.156) (-1743.832) (-1745.787) -- 0:01:43
707000 -- [-1745.631] (-1749.603) (-1747.591) (-1742.503) * (-1745.478) [-1750.363] (-1742.928) (-1739.334) -- 0:01:44
707500 -- (-1748.486) [-1738.068] (-1748.346) (-1747.965) * (-1749.628) (-1743.329) (-1749.247) [-1736.913] -- 0:01:43
708000 -- (-1746.110) (-1739.353) [-1739.313] (-1742.057) * (-1741.571) (-1741.572) (-1745.097) [-1743.064] -- 0:01:43
708500 -- (-1748.916) (-1737.751) [-1745.272] (-1748.584) * (-1744.306) (-1741.011) (-1736.272) [-1737.825] -- 0:01:43
709000 -- (-1759.878) (-1745.811) [-1739.699] (-1752.230) * (-1741.143) (-1752.921) (-1739.796) [-1736.041] -- 0:01:43
709500 -- (-1743.724) (-1749.822) [-1737.712] (-1747.238) * [-1739.449] (-1745.335) (-1742.199) (-1744.614) -- 0:01:43
710000 -- (-1741.900) (-1749.102) [-1739.931] (-1743.311) * (-1742.028) (-1747.623) [-1742.361] (-1736.607) -- 0:01:42
Average standard deviation of split frequencies: 0.011542
710500 -- (-1742.719) [-1749.564] (-1740.828) (-1743.507) * [-1744.832] (-1750.663) (-1743.781) (-1740.787) -- 0:01:42
711000 -- (-1747.136) (-1740.831) [-1747.417] (-1739.022) * (-1744.416) [-1741.590] (-1750.255) (-1737.328) -- 0:01:42
711500 -- (-1736.913) (-1742.440) [-1746.105] (-1741.307) * [-1748.092] (-1741.837) (-1741.605) (-1744.570) -- 0:01:42
712000 -- [-1739.877] (-1742.254) (-1744.294) (-1742.539) * (-1751.409) (-1737.115) (-1739.881) [-1745.157] -- 0:01:41
712500 -- (-1739.741) (-1744.731) [-1738.517] (-1737.058) * (-1744.270) [-1739.876] (-1739.938) (-1740.525) -- 0:01:42
713000 -- (-1752.055) [-1744.897] (-1747.272) (-1736.621) * [-1739.974] (-1751.865) (-1740.578) (-1746.914) -- 0:01:41
713500 -- (-1734.182) (-1750.481) (-1745.398) [-1734.627] * (-1743.583) (-1750.089) [-1739.172] (-1745.195) -- 0:01:41
714000 -- [-1738.130] (-1747.967) (-1750.767) (-1743.723) * (-1738.493) (-1746.134) (-1751.230) [-1742.713] -- 0:01:41
714500 -- (-1744.263) (-1739.585) (-1747.702) [-1739.760] * (-1742.806) (-1745.537) (-1743.322) [-1745.708] -- 0:01:41
715000 -- (-1739.589) (-1740.936) [-1742.953] (-1739.727) * (-1741.832) [-1737.491] (-1745.691) (-1738.398) -- 0:01:40
Average standard deviation of split frequencies: 0.011719
715500 -- [-1738.810] (-1742.241) (-1736.391) (-1740.568) * (-1741.417) [-1741.853] (-1750.482) (-1740.553) -- 0:01:40
716000 -- (-1740.801) (-1739.405) [-1747.591] (-1739.312) * (-1746.373) (-1741.117) (-1753.338) [-1739.961] -- 0:01:40
716500 -- (-1740.119) (-1741.840) (-1742.240) [-1737.032] * (-1743.148) (-1745.987) [-1744.236] (-1745.393) -- 0:01:40
717000 -- (-1742.056) [-1742.338] (-1749.951) (-1739.128) * (-1741.040) (-1739.484) (-1743.695) [-1735.841] -- 0:01:40
717500 -- (-1744.672) (-1745.799) (-1750.805) [-1737.950] * (-1740.543) (-1745.164) (-1744.177) [-1747.395] -- 0:01:40
718000 -- (-1742.192) [-1735.235] (-1740.891) (-1742.518) * (-1748.271) [-1740.381] (-1743.916) (-1739.227) -- 0:01:39
718500 -- (-1741.978) [-1741.079] (-1741.719) (-1744.760) * [-1745.514] (-1744.782) (-1739.148) (-1745.514) -- 0:01:39
719000 -- (-1738.752) (-1746.941) (-1741.244) [-1742.916] * (-1749.349) (-1740.546) (-1744.357) [-1746.651] -- 0:01:39
719500 -- (-1748.638) (-1744.079) (-1744.492) [-1740.366] * [-1738.311] (-1741.689) (-1741.002) (-1749.322) -- 0:01:39
720000 -- (-1739.133) (-1743.504) (-1744.398) [-1741.485] * (-1741.371) (-1740.873) (-1749.194) [-1737.951] -- 0:01:39
Average standard deviation of split frequencies: 0.012298
720500 -- (-1739.664) (-1744.000) (-1739.390) [-1743.255] * (-1762.630) [-1737.985] (-1757.538) (-1737.523) -- 0:01:38
721000 -- [-1734.659] (-1744.610) (-1742.927) (-1740.761) * [-1745.940] (-1736.877) (-1750.129) (-1739.714) -- 0:01:38
721500 -- (-1740.435) (-1751.541) [-1741.304] (-1743.065) * (-1746.700) [-1738.420] (-1751.647) (-1739.661) -- 0:01:38
722000 -- (-1736.629) (-1752.736) [-1739.004] (-1750.140) * (-1741.780) (-1750.978) (-1746.941) [-1732.672] -- 0:01:38
722500 -- (-1741.587) [-1750.710] (-1745.136) (-1741.965) * [-1741.233] (-1742.161) (-1748.019) (-1740.822) -- 0:01:38
723000 -- (-1744.678) [-1745.135] (-1745.607) (-1751.606) * [-1737.789] (-1735.426) (-1753.617) (-1737.154) -- 0:01:38
723500 -- (-1743.411) [-1740.909] (-1750.032) (-1745.491) * (-1737.114) (-1748.117) (-1745.526) [-1741.779] -- 0:01:37
724000 -- (-1743.686) [-1741.680] (-1760.037) (-1746.630) * (-1737.132) [-1748.589] (-1744.679) (-1743.126) -- 0:01:37
724500 -- (-1742.275) [-1749.326] (-1755.966) (-1741.671) * [-1737.765] (-1746.401) (-1744.770) (-1742.227) -- 0:01:37
725000 -- (-1746.931) (-1735.978) (-1747.354) [-1739.359] * (-1743.782) (-1751.484) (-1743.985) [-1742.733] -- 0:01:37
Average standard deviation of split frequencies: 0.011947
725500 -- (-1740.651) (-1748.545) (-1740.474) [-1740.657] * (-1743.142) (-1754.831) (-1748.760) [-1744.773] -- 0:01:37
726000 -- [-1740.367] (-1743.903) (-1737.451) (-1738.201) * (-1745.792) (-1741.877) [-1745.840] (-1744.962) -- 0:01:36
726500 -- (-1747.758) (-1746.781) (-1738.331) [-1741.130] * (-1751.294) (-1749.958) [-1740.017] (-1742.113) -- 0:01:36
727000 -- (-1751.079) [-1739.244] (-1739.647) (-1747.103) * (-1748.377) [-1744.335] (-1750.365) (-1737.620) -- 0:01:36
727500 -- (-1747.747) (-1740.651) (-1744.618) [-1741.955] * (-1750.024) [-1738.164] (-1739.995) (-1738.932) -- 0:01:36
728000 -- (-1749.687) (-1736.572) [-1744.970] (-1740.932) * (-1736.963) (-1746.614) [-1738.497] (-1743.948) -- 0:01:36
728500 -- (-1745.210) (-1738.796) (-1747.258) [-1739.893] * (-1743.139) (-1750.359) (-1743.459) [-1737.740] -- 0:01:36
729000 -- [-1739.868] (-1737.812) (-1746.313) (-1752.167) * (-1741.745) [-1751.389] (-1741.408) (-1742.697) -- 0:01:35
729500 -- (-1740.995) (-1746.624) (-1756.533) [-1746.750] * (-1740.348) (-1740.501) (-1746.377) [-1737.610] -- 0:01:35
730000 -- (-1744.655) (-1747.883) (-1744.557) [-1738.950] * (-1737.971) (-1741.798) (-1742.048) [-1738.244] -- 0:01:35
Average standard deviation of split frequencies: 0.011678
730500 -- (-1742.323) (-1741.312) (-1739.718) [-1738.759] * (-1749.881) (-1745.095) (-1740.053) [-1748.188] -- 0:01:35
731000 -- [-1742.790] (-1752.279) (-1742.446) (-1745.855) * (-1744.425) [-1741.597] (-1745.735) (-1740.847) -- 0:01:35
731500 -- (-1739.739) [-1745.929] (-1747.264) (-1747.063) * (-1740.105) (-1743.751) (-1746.842) [-1744.308] -- 0:01:35
732000 -- [-1737.220] (-1745.567) (-1744.154) (-1744.624) * (-1744.679) (-1737.815) (-1743.814) [-1746.100] -- 0:01:34
732500 -- (-1741.756) [-1736.612] (-1749.034) (-1745.959) * (-1739.817) (-1742.428) [-1739.990] (-1747.853) -- 0:01:34
733000 -- [-1740.999] (-1738.088) (-1745.332) (-1738.272) * (-1741.062) [-1738.111] (-1751.972) (-1749.062) -- 0:01:34
733500 -- (-1743.303) (-1749.252) [-1744.171] (-1746.341) * (-1741.145) (-1745.098) (-1743.635) [-1738.364] -- 0:01:34
734000 -- (-1738.797) [-1736.486] (-1751.778) (-1737.432) * [-1745.359] (-1749.157) (-1750.810) (-1747.927) -- 0:01:34
734500 -- (-1741.655) (-1751.976) [-1745.721] (-1736.922) * (-1747.085) [-1737.783] (-1755.357) (-1741.867) -- 0:01:33
735000 -- (-1745.169) [-1745.789] (-1743.281) (-1741.386) * (-1744.356) (-1744.135) [-1748.335] (-1742.588) -- 0:01:33
Average standard deviation of split frequencies: 0.011593
735500 -- (-1756.287) (-1746.932) (-1743.465) [-1742.913] * [-1740.914] (-1747.990) (-1749.758) (-1745.387) -- 0:01:33
736000 -- (-1735.835) (-1740.992) [-1738.536] (-1744.793) * [-1735.654] (-1737.169) (-1741.489) (-1739.287) -- 0:01:33
736500 -- [-1745.975] (-1748.452) (-1740.322) (-1742.347) * [-1744.495] (-1742.346) (-1748.959) (-1741.349) -- 0:01:33
737000 -- (-1749.590) (-1743.797) (-1733.946) [-1742.632] * (-1736.311) (-1748.787) (-1741.143) [-1742.243] -- 0:01:33
737500 -- [-1741.010] (-1752.857) (-1752.860) (-1741.125) * (-1751.729) (-1741.985) (-1742.066) [-1748.165] -- 0:01:32
738000 -- [-1739.071] (-1745.762) (-1739.850) (-1744.117) * (-1753.320) (-1739.081) (-1738.636) [-1742.833] -- 0:01:32
738500 -- (-1741.290) (-1743.356) (-1740.054) [-1737.610] * (-1753.874) (-1741.637) [-1735.991] (-1741.277) -- 0:01:32
739000 -- (-1742.866) (-1743.503) (-1741.204) [-1738.332] * (-1744.927) (-1752.042) [-1740.951] (-1751.242) -- 0:01:32
739500 -- (-1742.190) [-1740.926] (-1743.482) (-1744.006) * (-1741.738) (-1741.630) (-1738.825) [-1749.873] -- 0:01:32
740000 -- [-1739.438] (-1745.950) (-1750.221) (-1741.256) * [-1740.582] (-1748.118) (-1741.602) (-1748.628) -- 0:01:32
Average standard deviation of split frequencies: 0.010438
740500 -- [-1734.965] (-1738.042) (-1746.450) (-1745.459) * [-1736.049] (-1746.164) (-1741.764) (-1745.977) -- 0:01:31
741000 -- (-1737.086) (-1738.836) [-1738.627] (-1741.853) * [-1743.902] (-1747.679) (-1739.598) (-1752.332) -- 0:01:31
741500 -- [-1740.835] (-1745.039) (-1743.001) (-1737.515) * (-1742.444) (-1750.002) [-1745.055] (-1739.142) -- 0:01:31
742000 -- (-1739.869) [-1739.826] (-1742.466) (-1741.090) * (-1745.081) [-1743.133] (-1739.073) (-1750.488) -- 0:01:31
742500 -- (-1745.235) [-1741.020] (-1739.954) (-1742.003) * [-1742.466] (-1741.876) (-1751.271) (-1739.975) -- 0:01:31
743000 -- (-1742.016) (-1743.024) (-1748.564) [-1737.030] * (-1749.702) [-1735.422] (-1753.479) (-1740.483) -- 0:01:30
743500 -- (-1743.096) (-1751.231) (-1741.242) [-1740.637] * [-1738.184] (-1736.624) (-1743.851) (-1741.210) -- 0:01:30
744000 -- (-1738.262) (-1746.198) [-1739.506] (-1744.199) * (-1745.880) (-1746.148) [-1739.306] (-1743.781) -- 0:01:30
744500 -- (-1739.439) (-1740.379) [-1738.533] (-1739.686) * (-1745.510) (-1735.835) (-1750.753) [-1746.419] -- 0:01:30
745000 -- (-1745.310) (-1743.781) [-1740.801] (-1745.168) * (-1745.824) (-1735.820) (-1739.813) [-1742.005] -- 0:01:30
Average standard deviation of split frequencies: 0.009984
745500 -- (-1745.515) (-1738.847) [-1744.517] (-1740.124) * (-1745.840) [-1741.047] (-1742.343) (-1745.563) -- 0:01:30
746000 -- (-1747.840) (-1739.657) [-1741.972] (-1739.112) * (-1746.846) (-1738.834) [-1748.152] (-1748.063) -- 0:01:29
746500 -- (-1740.091) (-1750.315) [-1746.927] (-1742.055) * [-1743.567] (-1739.909) (-1741.071) (-1745.305) -- 0:01:29
747000 -- (-1743.276) (-1745.732) (-1744.227) [-1739.121] * [-1751.827] (-1742.574) (-1741.324) (-1749.877) -- 0:01:29
747500 -- [-1742.349] (-1740.953) (-1739.430) (-1741.318) * (-1746.855) (-1748.134) [-1737.711] (-1755.183) -- 0:01:29
748000 -- (-1744.348) [-1739.147] (-1754.825) (-1737.615) * (-1747.426) [-1741.665] (-1738.140) (-1744.343) -- 0:01:29
748500 -- (-1739.462) (-1737.995) (-1751.365) [-1737.648] * (-1747.302) (-1748.659) (-1741.575) [-1739.823] -- 0:01:29
749000 -- (-1742.073) [-1744.436] (-1746.292) (-1745.332) * (-1745.514) (-1743.731) [-1740.322] (-1744.947) -- 0:01:28
749500 -- (-1744.821) (-1744.408) (-1744.420) [-1741.006] * (-1745.367) [-1742.597] (-1742.331) (-1744.656) -- 0:01:28
750000 -- (-1746.037) (-1743.142) (-1740.976) [-1748.040] * (-1746.022) [-1743.660] (-1748.222) (-1747.848) -- 0:01:28
Average standard deviation of split frequencies: 0.009859
750500 -- [-1740.631] (-1740.735) (-1746.920) (-1746.435) * [-1750.235] (-1738.373) (-1740.209) (-1740.669) -- 0:01:28
751000 -- (-1742.943) (-1742.404) (-1739.630) [-1739.505] * (-1745.452) (-1744.049) (-1748.921) [-1736.226] -- 0:01:28
751500 -- (-1740.030) (-1746.280) [-1736.545] (-1743.269) * [-1744.054] (-1746.224) (-1743.673) (-1740.167) -- 0:01:27
752000 -- [-1736.788] (-1745.539) (-1735.599) (-1744.933) * (-1756.365) (-1742.290) (-1738.022) [-1735.635] -- 0:01:27
752500 -- (-1743.207) [-1741.388] (-1739.022) (-1740.686) * (-1736.762) [-1737.384] (-1744.319) (-1737.875) -- 0:01:27
753000 -- [-1740.246] (-1741.686) (-1736.896) (-1744.943) * (-1737.165) (-1743.884) [-1742.827] (-1742.856) -- 0:01:27
753500 -- (-1738.376) (-1750.323) (-1741.203) [-1740.040] * (-1754.144) (-1740.352) (-1745.113) [-1736.052] -- 0:01:27
754000 -- (-1737.409) [-1736.151] (-1739.280) (-1738.488) * (-1743.697) [-1741.753] (-1740.729) (-1746.245) -- 0:01:27
754500 -- (-1739.461) [-1735.335] (-1740.774) (-1736.754) * (-1740.768) [-1744.219] (-1738.516) (-1743.480) -- 0:01:26
755000 -- (-1742.643) (-1738.813) (-1737.669) [-1736.942] * (-1744.154) (-1741.187) [-1743.102] (-1742.924) -- 0:01:26
Average standard deviation of split frequencies: 0.009727
755500 -- [-1740.145] (-1745.928) (-1747.078) (-1735.927) * (-1745.140) (-1742.052) (-1739.623) [-1745.760] -- 0:01:26
756000 -- (-1752.439) (-1742.394) (-1742.816) [-1738.364] * (-1748.582) [-1742.659] (-1739.015) (-1744.361) -- 0:01:26
756500 -- (-1737.466) (-1747.186) [-1744.276] (-1746.219) * (-1739.904) [-1745.505] (-1742.665) (-1738.309) -- 0:01:26
757000 -- (-1740.566) (-1735.401) (-1746.731) [-1745.488] * (-1738.660) [-1746.873] (-1744.271) (-1742.076) -- 0:01:26
757500 -- (-1741.771) (-1742.396) (-1740.841) [-1743.520] * (-1744.558) (-1753.138) (-1736.032) [-1738.622] -- 0:01:25
758000 -- [-1739.569] (-1743.070) (-1751.974) (-1742.419) * (-1741.557) [-1747.718] (-1740.369) (-1744.688) -- 0:01:25
758500 -- (-1748.070) (-1746.588) [-1740.194] (-1740.802) * (-1743.400) [-1739.426] (-1742.495) (-1744.068) -- 0:01:25
759000 -- (-1738.712) (-1740.664) [-1740.799] (-1746.546) * (-1743.025) [-1740.863] (-1749.790) (-1737.918) -- 0:01:25
759500 -- (-1743.844) (-1742.183) (-1745.637) [-1743.024] * (-1742.994) (-1741.586) (-1736.431) [-1738.239] -- 0:01:25
760000 -- (-1741.995) (-1748.088) (-1740.384) [-1739.223] * [-1738.284] (-1742.904) (-1743.657) (-1742.536) -- 0:01:24
Average standard deviation of split frequencies: 0.009792
760500 -- (-1760.079) [-1735.745] (-1748.145) (-1743.634) * (-1752.890) (-1740.364) (-1744.708) [-1741.306] -- 0:01:24
761000 -- (-1746.287) (-1743.145) (-1748.180) [-1741.341] * (-1750.385) [-1741.548] (-1742.023) (-1737.570) -- 0:01:24
761500 -- [-1743.320] (-1735.616) (-1744.717) (-1740.603) * (-1743.338) (-1739.885) [-1739.466] (-1743.324) -- 0:01:24
762000 -- (-1743.838) [-1736.387] (-1748.920) (-1737.984) * (-1740.659) (-1746.599) [-1747.602] (-1739.045) -- 0:01:24
762500 -- (-1743.559) [-1745.530] (-1757.265) (-1735.836) * (-1740.685) (-1740.307) [-1742.460] (-1742.641) -- 0:01:24
763000 -- (-1738.939) [-1739.700] (-1745.866) (-1734.049) * (-1737.991) [-1736.741] (-1742.703) (-1741.867) -- 0:01:23
763500 -- [-1734.887] (-1739.127) (-1744.351) (-1737.478) * (-1742.323) (-1745.418) (-1741.259) [-1737.784] -- 0:01:23
764000 -- [-1743.445] (-1736.386) (-1747.837) (-1737.827) * (-1747.865) (-1742.675) (-1743.581) [-1741.720] -- 0:01:23
764500 -- (-1748.586) (-1742.875) [-1744.912] (-1752.232) * (-1747.732) (-1747.653) [-1737.816] (-1743.177) -- 0:01:23
765000 -- (-1744.415) [-1741.378] (-1743.149) (-1745.397) * [-1733.556] (-1744.057) (-1739.669) (-1736.744) -- 0:01:23
Average standard deviation of split frequencies: 0.010154
765500 -- (-1738.688) [-1738.845] (-1739.965) (-1748.344) * [-1743.011] (-1743.606) (-1743.999) (-1744.530) -- 0:01:23
766000 -- (-1737.508) (-1744.281) [-1745.910] (-1742.331) * (-1741.806) (-1738.471) (-1749.626) [-1741.198] -- 0:01:22
766500 -- (-1743.189) (-1744.428) (-1740.377) [-1741.186] * (-1741.531) (-1747.031) (-1742.208) [-1738.538] -- 0:01:22
767000 -- (-1740.072) (-1739.920) [-1739.890] (-1746.705) * [-1750.489] (-1743.025) (-1742.040) (-1744.097) -- 0:01:22
767500 -- (-1740.873) (-1741.500) (-1743.600) [-1742.794] * (-1742.007) (-1743.833) (-1746.386) [-1741.171] -- 0:01:22
768000 -- (-1747.162) (-1746.652) [-1743.153] (-1740.395) * (-1748.202) [-1750.364] (-1746.895) (-1740.353) -- 0:01:22
768500 -- (-1745.906) (-1744.369) (-1744.470) [-1747.719] * (-1747.910) (-1738.071) [-1740.305] (-1746.105) -- 0:01:21
769000 -- (-1746.361) (-1743.374) (-1736.340) [-1739.407] * (-1764.317) (-1737.463) [-1738.827] (-1755.819) -- 0:01:21
769500 -- (-1746.915) (-1741.739) (-1743.378) [-1741.017] * (-1757.112) [-1740.410] (-1750.037) (-1737.773) -- 0:01:21
770000 -- (-1747.462) [-1742.679] (-1737.275) (-1743.326) * [-1741.935] (-1743.455) (-1748.499) (-1745.373) -- 0:01:21
Average standard deviation of split frequencies: 0.009787
770500 -- (-1748.930) (-1743.983) [-1739.918] (-1742.720) * (-1752.127) (-1750.884) (-1752.640) [-1742.216] -- 0:01:21
771000 -- [-1744.491] (-1751.819) (-1737.556) (-1751.459) * (-1743.026) (-1757.585) (-1740.364) [-1744.841] -- 0:01:21
771500 -- (-1748.845) [-1742.628] (-1748.365) (-1750.297) * (-1749.690) (-1748.137) (-1743.010) [-1739.740] -- 0:01:20
772000 -- [-1741.025] (-1743.397) (-1743.649) (-1748.356) * [-1747.503] (-1749.843) (-1741.717) (-1746.319) -- 0:01:20
772500 -- (-1738.803) (-1741.981) [-1744.178] (-1743.630) * [-1746.598] (-1755.739) (-1742.167) (-1738.699) -- 0:01:20
773000 -- [-1745.121] (-1750.980) (-1744.890) (-1748.098) * (-1752.548) (-1747.761) (-1738.658) [-1745.861] -- 0:01:20
773500 -- [-1741.349] (-1754.957) (-1744.649) (-1752.216) * (-1743.703) (-1748.059) (-1739.054) [-1739.798] -- 0:01:20
774000 -- (-1743.134) (-1751.565) (-1748.880) [-1743.582] * (-1754.076) (-1747.226) (-1736.338) [-1741.004] -- 0:01:20
774500 -- (-1740.494) (-1747.475) [-1745.441] (-1745.231) * (-1747.090) (-1742.984) (-1743.120) [-1741.099] -- 0:01:19
775000 -- (-1742.399) (-1743.250) [-1742.719] (-1741.386) * (-1749.831) (-1743.777) (-1737.375) [-1740.209] -- 0:01:19
Average standard deviation of split frequencies: 0.010145
775500 -- (-1756.589) [-1737.948] (-1745.428) (-1747.675) * (-1749.308) [-1740.510] (-1741.753) (-1735.119) -- 0:01:19
776000 -- (-1742.443) (-1747.127) (-1739.276) [-1740.722] * (-1745.294) (-1739.041) (-1747.028) [-1741.471] -- 0:01:19
776500 -- [-1749.693] (-1746.805) (-1742.328) (-1741.509) * (-1755.403) [-1740.297] (-1752.359) (-1743.414) -- 0:01:19
777000 -- (-1747.956) [-1741.582] (-1745.204) (-1741.634) * (-1745.861) (-1743.485) (-1749.151) [-1740.427] -- 0:01:18
777500 -- (-1752.764) (-1742.009) (-1747.832) [-1735.439] * [-1745.059] (-1741.936) (-1738.939) (-1750.342) -- 0:01:18
778000 -- (-1748.642) [-1736.145] (-1745.005) (-1741.549) * [-1738.033] (-1739.139) (-1744.820) (-1747.296) -- 0:01:18
778500 -- [-1748.362] (-1743.280) (-1749.525) (-1752.328) * (-1743.146) [-1749.759] (-1748.138) (-1740.478) -- 0:01:18
779000 -- (-1745.613) (-1749.284) (-1740.876) [-1744.036] * (-1736.806) (-1739.460) (-1739.705) [-1735.265] -- 0:01:18
779500 -- (-1739.583) [-1743.768] (-1742.549) (-1744.308) * [-1741.523] (-1738.952) (-1737.562) (-1746.656) -- 0:01:18
780000 -- (-1742.684) (-1749.242) (-1737.170) [-1741.480] * (-1739.170) [-1744.766] (-1738.239) (-1744.266) -- 0:01:17
Average standard deviation of split frequencies: 0.009541
780500 -- [-1734.218] (-1743.994) (-1739.262) (-1744.240) * (-1747.455) [-1744.022] (-1746.751) (-1745.796) -- 0:01:17
781000 -- [-1734.466] (-1740.597) (-1740.655) (-1744.391) * (-1742.138) [-1735.762] (-1744.643) (-1754.697) -- 0:01:17
781500 -- (-1739.481) [-1742.503] (-1747.115) (-1743.649) * (-1736.915) (-1740.067) [-1738.144] (-1751.099) -- 0:01:17
782000 -- (-1744.144) (-1739.660) [-1739.054] (-1745.666) * (-1742.099) (-1741.357) [-1736.724] (-1749.567) -- 0:01:17
782500 -- (-1741.535) (-1739.139) (-1739.506) [-1742.762] * (-1751.602) [-1740.201] (-1738.512) (-1754.011) -- 0:01:16
783000 -- (-1743.003) [-1736.707] (-1737.391) (-1739.528) * (-1746.879) (-1738.935) (-1738.842) [-1744.449] -- 0:01:16
783500 -- (-1739.460) [-1744.673] (-1740.622) (-1741.688) * (-1751.161) (-1747.392) (-1744.021) [-1738.622] -- 0:01:16
784000 -- (-1746.349) (-1742.581) [-1738.820] (-1751.368) * (-1746.656) [-1749.204] (-1736.472) (-1738.850) -- 0:01:16
784500 -- (-1742.538) (-1744.737) [-1741.965] (-1741.433) * (-1743.340) (-1741.811) [-1744.309] (-1743.596) -- 0:01:16
785000 -- (-1739.614) (-1744.072) (-1748.332) [-1747.872] * (-1744.216) (-1739.130) (-1737.868) [-1739.088] -- 0:01:16
Average standard deviation of split frequencies: 0.008696
785500 -- (-1744.894) [-1742.046] (-1746.399) (-1745.913) * (-1742.256) (-1737.105) (-1743.388) [-1735.049] -- 0:01:15
786000 -- (-1737.533) [-1739.050] (-1739.399) (-1752.960) * [-1741.887] (-1737.800) (-1740.697) (-1741.779) -- 0:01:15
786500 -- (-1753.135) (-1742.287) (-1739.570) [-1742.363] * (-1740.059) (-1743.632) (-1738.795) [-1739.439] -- 0:01:15
787000 -- (-1748.987) (-1742.525) (-1736.997) [-1743.354] * (-1738.742) [-1740.971] (-1746.197) (-1743.296) -- 0:01:15
787500 -- (-1735.345) (-1743.456) (-1748.220) [-1740.445] * (-1753.870) (-1748.718) (-1745.325) [-1737.708] -- 0:01:15
788000 -- (-1735.836) (-1742.290) (-1746.010) [-1736.296] * (-1749.440) [-1742.374] (-1746.915) (-1739.250) -- 0:01:15
788500 -- [-1736.231] (-1740.333) (-1744.641) (-1745.369) * [-1737.706] (-1750.065) (-1744.504) (-1750.300) -- 0:01:14
789000 -- (-1741.671) (-1748.661) [-1740.050] (-1743.268) * (-1746.875) (-1734.260) [-1739.207] (-1747.458) -- 0:01:14
789500 -- (-1741.902) [-1742.155] (-1752.583) (-1739.063) * (-1746.808) (-1749.781) [-1738.638] (-1739.891) -- 0:01:14
790000 -- [-1738.361] (-1738.464) (-1742.016) (-1742.908) * (-1740.679) (-1739.601) (-1741.073) [-1736.401] -- 0:01:14
Average standard deviation of split frequencies: 0.008585
790500 -- (-1744.149) (-1738.308) [-1740.956] (-1738.945) * (-1739.508) (-1752.148) [-1742.913] (-1742.108) -- 0:01:14
791000 -- (-1745.787) (-1744.144) [-1738.119] (-1744.614) * (-1736.734) [-1739.574] (-1741.866) (-1740.373) -- 0:01:13
791500 -- (-1749.548) [-1742.856] (-1738.672) (-1743.966) * [-1738.708] (-1753.110) (-1744.394) (-1741.661) -- 0:01:13
792000 -- (-1737.699) (-1746.300) [-1738.944] (-1749.819) * (-1738.132) (-1745.651) (-1744.482) [-1739.247] -- 0:01:13
792500 -- (-1749.225) (-1750.272) [-1741.712] (-1749.416) * (-1736.421) (-1750.923) (-1742.239) [-1741.906] -- 0:01:13
793000 -- (-1744.591) (-1745.496) [-1739.587] (-1738.602) * (-1735.233) [-1745.041] (-1756.798) (-1740.422) -- 0:01:13
793500 -- (-1745.214) (-1741.548) [-1740.215] (-1745.035) * (-1755.240) [-1741.445] (-1745.859) (-1741.172) -- 0:01:13
794000 -- (-1741.416) [-1735.721] (-1748.007) (-1742.264) * [-1740.211] (-1741.674) (-1746.260) (-1747.826) -- 0:01:12
794500 -- (-1741.189) [-1738.135] (-1737.672) (-1742.867) * [-1739.159] (-1738.560) (-1748.590) (-1739.171) -- 0:01:12
795000 -- (-1745.396) (-1739.041) [-1736.411] (-1739.000) * (-1740.225) [-1740.120] (-1743.148) (-1745.691) -- 0:01:12
Average standard deviation of split frequencies: 0.008646
795500 -- (-1744.493) (-1738.742) (-1738.849) [-1740.837] * (-1744.083) [-1739.341] (-1739.840) (-1745.360) -- 0:01:12
796000 -- (-1741.846) [-1739.428] (-1736.580) (-1743.286) * (-1745.011) (-1740.092) (-1739.492) [-1743.200] -- 0:01:12
796500 -- (-1745.139) [-1742.919] (-1748.212) (-1741.169) * (-1742.050) (-1741.524) (-1749.348) [-1750.256] -- 0:01:12
797000 -- (-1740.273) (-1739.397) (-1744.331) [-1736.957] * (-1740.815) [-1742.801] (-1745.918) (-1748.247) -- 0:01:11
797500 -- (-1743.284) (-1738.938) (-1740.043) [-1737.661] * (-1745.270) (-1741.301) [-1737.270] (-1746.708) -- 0:01:11
798000 -- (-1746.054) [-1744.841] (-1739.183) (-1741.008) * (-1746.284) (-1745.309) (-1745.736) [-1741.433] -- 0:01:11
798500 -- [-1741.550] (-1745.575) (-1741.475) (-1745.191) * (-1739.926) [-1738.711] (-1739.110) (-1740.839) -- 0:01:11
799000 -- (-1745.524) (-1740.350) [-1738.650] (-1743.393) * (-1740.181) (-1743.066) [-1744.343] (-1738.468) -- 0:01:11
799500 -- (-1741.915) (-1742.882) (-1740.253) [-1741.402] * (-1747.166) (-1741.152) [-1744.118] (-1752.460) -- 0:01:10
800000 -- (-1737.813) (-1750.672) (-1740.100) [-1736.224] * [-1738.242] (-1745.437) (-1742.981) (-1751.888) -- 0:01:10
Average standard deviation of split frequencies: 0.008537
800500 -- (-1744.302) (-1747.809) (-1741.045) [-1743.411] * (-1742.483) (-1743.733) (-1752.013) [-1747.448] -- 0:01:10
801000 -- (-1741.987) [-1747.598] (-1735.533) (-1748.609) * [-1733.693] (-1735.846) (-1738.957) (-1743.401) -- 0:01:10
801500 -- [-1739.363] (-1739.900) (-1751.805) (-1754.905) * [-1742.388] (-1738.761) (-1740.925) (-1757.617) -- 0:01:10
802000 -- (-1738.734) (-1745.567) (-1739.043) [-1739.704] * (-1741.853) [-1743.107] (-1742.049) (-1738.065) -- 0:01:10
802500 -- (-1740.215) (-1745.488) (-1741.321) [-1740.975] * (-1738.215) (-1756.433) [-1742.384] (-1741.010) -- 0:01:09
803000 -- (-1741.180) (-1743.236) (-1747.705) [-1747.224] * (-1744.946) (-1740.574) [-1741.040] (-1743.868) -- 0:01:09
803500 -- (-1739.270) [-1744.698] (-1741.993) (-1740.324) * [-1734.685] (-1740.945) (-1739.466) (-1740.938) -- 0:01:09
804000 -- (-1743.368) (-1745.565) (-1747.464) [-1745.565] * (-1739.929) (-1744.382) (-1743.485) [-1742.649] -- 0:01:09
804500 -- (-1746.040) (-1747.853) [-1737.984] (-1738.902) * (-1746.414) (-1747.023) (-1742.493) [-1740.995] -- 0:01:09
805000 -- [-1747.644] (-1751.653) (-1744.675) (-1747.955) * (-1740.913) (-1743.145) (-1746.638) [-1741.106] -- 0:01:09
Average standard deviation of split frequencies: 0.008130
805500 -- (-1749.753) [-1746.416] (-1744.499) (-1740.446) * (-1736.484) (-1744.553) [-1745.432] (-1739.049) -- 0:01:08
806000 -- [-1745.749] (-1749.958) (-1742.532) (-1740.060) * (-1740.747) [-1739.070] (-1742.397) (-1744.078) -- 0:01:08
806500 -- (-1744.815) (-1747.697) [-1739.467] (-1743.320) * (-1740.060) [-1739.282] (-1745.384) (-1743.266) -- 0:01:08
807000 -- (-1751.349) (-1739.004) (-1739.972) [-1737.554] * [-1738.354] (-1739.217) (-1741.635) (-1744.923) -- 0:01:08
807500 -- (-1742.486) [-1739.885] (-1743.115) (-1739.918) * (-1743.217) (-1740.513) (-1744.344) [-1744.312] -- 0:01:08
808000 -- (-1739.731) [-1737.660] (-1739.040) (-1747.851) * (-1747.466) (-1740.772) [-1745.323] (-1746.476) -- 0:01:07
808500 -- (-1747.973) [-1743.364] (-1752.655) (-1751.200) * (-1748.006) [-1735.240] (-1739.593) (-1739.510) -- 0:01:07
809000 -- (-1739.142) (-1742.110) (-1739.884) [-1743.564] * (-1745.706) (-1735.969) (-1734.412) [-1739.556] -- 0:01:07
809500 -- (-1746.034) (-1740.473) [-1739.016] (-1743.228) * (-1747.056) [-1738.193] (-1740.998) (-1740.599) -- 0:01:07
810000 -- (-1744.402) (-1741.303) [-1741.662] (-1738.804) * (-1745.092) (-1738.842) [-1739.207] (-1749.437) -- 0:01:07
Average standard deviation of split frequencies: 0.007734
810500 -- [-1736.623] (-1748.340) (-1742.515) (-1738.516) * (-1744.255) (-1737.383) [-1740.798] (-1748.361) -- 0:01:07
811000 -- [-1742.552] (-1742.939) (-1740.470) (-1745.961) * (-1740.928) (-1750.160) (-1738.506) [-1743.055] -- 0:01:06
811500 -- [-1737.695] (-1741.388) (-1745.646) (-1735.232) * [-1736.997] (-1738.514) (-1743.575) (-1746.367) -- 0:01:06
812000 -- (-1738.264) (-1742.764) (-1739.054) [-1743.971] * (-1741.892) [-1738.252] (-1740.711) (-1740.258) -- 0:01:06
812500 -- (-1748.930) [-1743.718] (-1744.117) (-1742.198) * (-1737.895) (-1736.661) [-1740.515] (-1742.076) -- 0:01:06
813000 -- (-1755.709) [-1738.820] (-1743.692) (-1745.434) * (-1739.407) (-1747.546) (-1744.122) [-1739.725] -- 0:01:06
813500 -- (-1739.795) [-1743.376] (-1744.481) (-1744.456) * (-1743.362) (-1737.564) [-1740.713] (-1743.724) -- 0:01:06
814000 -- [-1739.563] (-1742.233) (-1744.412) (-1742.850) * (-1736.470) (-1742.774) (-1740.768) [-1742.286] -- 0:01:05
814500 -- (-1743.725) (-1740.177) (-1754.453) [-1746.301] * (-1740.173) (-1740.658) [-1743.859] (-1748.839) -- 0:01:05
815000 -- (-1746.676) (-1746.555) (-1739.331) [-1741.929] * (-1742.213) (-1740.530) (-1740.214) [-1746.926] -- 0:01:05
Average standard deviation of split frequencies: 0.007568
815500 -- (-1748.324) (-1743.945) [-1740.427] (-1746.789) * (-1738.935) (-1753.883) (-1740.229) [-1739.098] -- 0:01:05
816000 -- (-1744.533) (-1749.867) (-1743.660) [-1750.869] * (-1750.672) (-1743.864) [-1739.577] (-1744.622) -- 0:01:04
816500 -- (-1749.040) [-1735.719] (-1734.600) (-1737.542) * (-1744.000) (-1745.383) (-1743.162) [-1741.902] -- 0:01:04
817000 -- (-1743.516) [-1739.866] (-1741.450) (-1738.101) * (-1746.958) [-1735.786] (-1741.855) (-1746.162) -- 0:01:04
817500 -- (-1739.394) (-1757.572) (-1745.398) [-1740.104] * (-1740.738) (-1737.970) (-1742.682) [-1741.887] -- 0:01:04
818000 -- (-1739.843) (-1745.658) [-1743.186] (-1741.046) * (-1741.051) [-1743.504] (-1743.985) (-1737.542) -- 0:01:04
818500 -- [-1740.454] (-1742.829) (-1741.323) (-1748.781) * (-1740.166) (-1735.701) [-1746.444] (-1743.554) -- 0:01:04
819000 -- (-1744.412) [-1738.576] (-1737.693) (-1749.458) * (-1739.990) (-1742.150) (-1746.345) [-1741.471] -- 0:01:04
819500 -- [-1745.699] (-1737.481) (-1743.188) (-1739.007) * (-1743.963) [-1745.592] (-1744.662) (-1751.176) -- 0:01:03
820000 -- (-1740.008) [-1735.510] (-1747.443) (-1748.969) * (-1738.919) (-1739.203) [-1742.479] (-1745.413) -- 0:01:03
Average standard deviation of split frequencies: 0.007238
820500 -- [-1736.395] (-1738.209) (-1740.096) (-1741.556) * [-1741.392] (-1742.616) (-1749.130) (-1740.916) -- 0:01:03
821000 -- [-1738.611] (-1748.998) (-1746.294) (-1736.208) * [-1746.110] (-1738.448) (-1743.309) (-1740.321) -- 0:01:03
821500 -- (-1735.671) [-1745.140] (-1744.992) (-1740.840) * [-1744.270] (-1739.648) (-1737.408) (-1740.309) -- 0:01:03
822000 -- [-1738.092] (-1755.193) (-1743.912) (-1739.858) * [-1738.017] (-1742.701) (-1744.953) (-1739.931) -- 0:01:03
822500 -- (-1741.223) (-1753.967) (-1745.827) [-1739.170] * (-1741.471) [-1737.099] (-1744.273) (-1739.652) -- 0:01:02
823000 -- [-1741.998] (-1743.026) (-1750.910) (-1751.939) * (-1750.291) [-1744.459] (-1741.005) (-1743.631) -- 0:01:02
823500 -- (-1749.543) (-1744.075) [-1739.592] (-1745.794) * [-1744.430] (-1744.076) (-1743.320) (-1742.991) -- 0:01:02
824000 -- (-1745.928) [-1734.964] (-1734.387) (-1750.917) * (-1741.878) (-1743.254) (-1740.489) [-1748.303] -- 0:01:02
824500 -- (-1744.285) (-1735.032) [-1737.785] (-1742.637) * (-1742.201) [-1744.006] (-1740.954) (-1752.461) -- 0:01:01
825000 -- (-1741.182) [-1739.070] (-1740.955) (-1755.445) * (-1743.748) (-1742.938) (-1750.796) [-1736.967] -- 0:01:01
Average standard deviation of split frequencies: 0.007305
825500 -- (-1748.598) [-1734.512] (-1740.928) (-1749.229) * [-1740.542] (-1754.762) (-1741.399) (-1745.869) -- 0:01:01
826000 -- (-1737.105) (-1745.328) [-1743.291] (-1746.758) * (-1742.096) (-1744.902) [-1741.671] (-1741.230) -- 0:01:01
826500 -- (-1745.730) (-1749.615) (-1741.746) [-1743.565] * (-1748.188) (-1743.966) (-1745.560) [-1738.804] -- 0:01:01
827000 -- (-1735.048) [-1743.440] (-1745.979) (-1746.012) * (-1751.504) (-1743.918) [-1741.038] (-1739.508) -- 0:01:01
827500 -- [-1746.146] (-1736.810) (-1740.294) (-1736.319) * (-1744.006) (-1745.239) (-1743.907) [-1746.428] -- 0:01:00
828000 -- (-1739.782) (-1751.766) (-1748.362) [-1738.042] * (-1744.011) (-1740.166) [-1733.269] (-1740.369) -- 0:01:00
828500 -- (-1742.617) (-1744.417) (-1746.370) [-1737.546] * (-1740.362) [-1740.529] (-1741.626) (-1740.758) -- 0:01:00
829000 -- [-1738.484] (-1743.170) (-1747.389) (-1741.378) * (-1744.591) [-1738.784] (-1746.349) (-1737.046) -- 0:01:00
829500 -- (-1745.499) [-1741.173] (-1746.393) (-1749.369) * (-1751.240) (-1743.751) [-1742.252] (-1742.596) -- 0:01:00
830000 -- (-1742.042) (-1737.465) [-1737.889] (-1747.431) * (-1744.533) (-1737.829) [-1741.375] (-1747.993) -- 0:01:00
Average standard deviation of split frequencies: 0.007378
830500 -- (-1741.932) [-1739.528] (-1740.494) (-1749.046) * (-1737.463) (-1741.318) (-1736.649) [-1741.643] -- 0:01:00
831000 -- (-1739.807) (-1737.519) (-1738.496) [-1743.245] * (-1744.745) (-1736.550) (-1745.903) [-1738.421] -- 0:00:59
831500 -- (-1738.356) [-1740.880] (-1743.027) (-1747.333) * (-1742.276) (-1735.893) [-1740.214] (-1737.825) -- 0:00:59
832000 -- [-1737.864] (-1741.788) (-1745.222) (-1738.745) * [-1738.055] (-1745.731) (-1737.380) (-1742.197) -- 0:00:59
832500 -- [-1737.939] (-1744.582) (-1745.403) (-1742.079) * [-1737.299] (-1736.301) (-1740.850) (-1741.205) -- 0:00:59
833000 -- [-1745.127] (-1740.825) (-1747.184) (-1740.593) * (-1739.427) [-1739.246] (-1737.822) (-1740.454) -- 0:00:58
833500 -- (-1741.087) (-1745.426) [-1746.387] (-1743.088) * (-1743.562) [-1744.921] (-1741.917) (-1750.510) -- 0:00:58
834000 -- (-1739.866) [-1741.270] (-1747.407) (-1742.929) * (-1744.247) (-1746.478) [-1749.466] (-1743.272) -- 0:00:58
834500 -- (-1747.278) (-1741.849) (-1746.609) [-1736.572] * (-1740.697) (-1747.179) [-1739.083] (-1755.481) -- 0:00:58
835000 -- (-1746.635) [-1738.402] (-1744.905) (-1743.549) * (-1749.448) (-1745.354) [-1738.463] (-1741.663) -- 0:00:58
Average standard deviation of split frequencies: 0.006767
835500 -- (-1747.756) (-1744.783) [-1743.747] (-1739.892) * (-1747.847) (-1740.570) [-1746.737] (-1743.616) -- 0:00:58
836000 -- (-1741.024) (-1742.210) [-1747.033] (-1734.907) * (-1746.818) (-1740.760) [-1746.350] (-1742.382) -- 0:00:57
836500 -- (-1738.183) (-1743.370) (-1736.794) [-1741.764] * (-1741.360) (-1741.624) [-1741.942] (-1749.345) -- 0:00:57
837000 -- [-1742.318] (-1741.784) (-1741.129) (-1740.301) * (-1743.193) (-1740.580) [-1743.033] (-1741.652) -- 0:00:57
837500 -- (-1742.478) (-1750.497) [-1744.217] (-1743.719) * (-1759.301) (-1745.850) [-1742.343] (-1737.127) -- 0:00:57
838000 -- (-1745.970) (-1740.851) [-1746.200] (-1737.098) * (-1750.904) (-1736.095) (-1742.819) [-1738.553] -- 0:00:57
838500 -- (-1742.876) (-1752.238) [-1739.694] (-1736.909) * (-1748.362) (-1742.334) [-1740.582] (-1739.574) -- 0:00:57
839000 -- (-1747.471) (-1747.724) [-1737.791] (-1737.428) * [-1748.260] (-1744.569) (-1743.577) (-1751.336) -- 0:00:56
839500 -- [-1745.095] (-1750.685) (-1750.561) (-1741.979) * (-1748.431) [-1746.966] (-1744.893) (-1742.500) -- 0:00:56
840000 -- (-1736.944) [-1739.679] (-1742.172) (-1742.376) * (-1745.323) (-1747.453) [-1741.950] (-1749.479) -- 0:00:56
Average standard deviation of split frequencies: 0.006785
840500 -- (-1741.679) [-1740.753] (-1736.817) (-1739.410) * (-1737.895) (-1742.769) [-1739.431] (-1737.194) -- 0:00:56
841000 -- (-1743.260) (-1740.249) (-1742.287) [-1741.431] * [-1740.961] (-1744.538) (-1744.643) (-1742.904) -- 0:00:56
841500 -- (-1742.758) (-1739.644) [-1746.137] (-1744.711) * (-1739.178) (-1742.728) [-1745.319] (-1738.740) -- 0:00:55
842000 -- [-1734.230] (-1745.483) (-1740.614) (-1738.850) * (-1736.112) (-1739.517) (-1745.797) [-1737.327] -- 0:00:55
842500 -- (-1745.474) (-1748.645) [-1735.637] (-1736.907) * [-1738.597] (-1749.454) (-1741.907) (-1743.084) -- 0:00:55
843000 -- [-1739.968] (-1745.198) (-1741.585) (-1743.645) * (-1741.664) (-1754.494) [-1739.463] (-1749.908) -- 0:00:55
843500 -- [-1741.859] (-1745.804) (-1744.044) (-1745.737) * (-1736.083) (-1744.202) [-1747.835] (-1744.328) -- 0:00:55
844000 -- [-1742.861] (-1740.516) (-1741.216) (-1743.686) * (-1739.648) (-1745.556) [-1742.298] (-1738.013) -- 0:00:55
844500 -- (-1742.104) (-1745.219) (-1744.533) [-1751.119] * (-1743.979) (-1733.542) (-1745.237) [-1746.097] -- 0:00:54
845000 -- [-1741.449] (-1742.212) (-1745.861) (-1748.824) * (-1749.154) (-1744.517) [-1737.702] (-1746.219) -- 0:00:54
Average standard deviation of split frequencies: 0.007244
845500 -- (-1738.281) (-1753.108) (-1745.237) [-1740.393] * [-1742.891] (-1752.323) (-1739.258) (-1745.915) -- 0:00:54
846000 -- [-1744.085] (-1747.537) (-1746.111) (-1745.953) * (-1751.063) [-1735.699] (-1740.104) (-1743.534) -- 0:00:54
846500 -- (-1735.473) (-1747.127) [-1741.149] (-1744.688) * (-1736.652) [-1733.302] (-1742.828) (-1744.476) -- 0:00:54
847000 -- [-1737.846] (-1742.985) (-1749.023) (-1743.996) * [-1739.511] (-1739.769) (-1745.264) (-1745.977) -- 0:00:54
847500 -- [-1742.557] (-1753.052) (-1742.548) (-1745.905) * (-1741.526) (-1746.279) (-1748.457) [-1742.165] -- 0:00:53
848000 -- (-1743.557) (-1747.819) [-1741.872] (-1748.755) * (-1743.248) (-1744.627) (-1752.952) [-1746.692] -- 0:00:53
848500 -- (-1744.326) (-1745.388) [-1741.749] (-1747.786) * (-1749.752) (-1744.738) [-1741.200] (-1742.967) -- 0:00:53
849000 -- (-1740.568) (-1738.380) [-1742.251] (-1746.089) * [-1739.599] (-1741.052) (-1745.359) (-1756.849) -- 0:00:53
849500 -- [-1739.252] (-1748.146) (-1744.457) (-1740.235) * (-1743.485) (-1738.523) [-1736.580] (-1748.638) -- 0:00:53
850000 -- (-1746.552) [-1734.212] (-1746.249) (-1748.726) * (-1744.545) (-1746.116) [-1745.288] (-1740.420) -- 0:00:52
Average standard deviation of split frequencies: 0.007259
850500 -- (-1748.480) [-1740.737] (-1738.128) (-1742.974) * (-1741.657) (-1747.411) (-1743.921) [-1744.426] -- 0:00:52
851000 -- [-1746.945] (-1739.067) (-1737.447) (-1740.522) * [-1745.723] (-1734.716) (-1747.808) (-1740.470) -- 0:00:52
851500 -- (-1739.638) (-1744.275) [-1740.928] (-1734.796) * [-1740.742] (-1738.488) (-1749.789) (-1737.553) -- 0:00:52
852000 -- (-1754.522) (-1739.122) [-1739.061] (-1743.138) * (-1739.659) (-1747.018) [-1743.470] (-1747.696) -- 0:00:52
852500 -- [-1738.265] (-1737.527) (-1742.394) (-1740.914) * [-1738.279] (-1738.815) (-1744.366) (-1741.789) -- 0:00:52
853000 -- (-1738.376) (-1750.864) [-1745.727] (-1741.776) * (-1740.709) (-1746.726) (-1740.591) [-1739.563] -- 0:00:51
853500 -- [-1736.723] (-1738.349) (-1749.778) (-1744.188) * (-1739.747) (-1749.052) (-1741.098) [-1740.523] -- 0:00:51
854000 -- (-1740.953) (-1739.506) (-1748.990) [-1746.399] * (-1741.458) (-1743.468) [-1744.194] (-1749.325) -- 0:00:51
854500 -- (-1740.295) (-1751.934) [-1747.529] (-1742.213) * (-1744.161) (-1745.045) [-1743.808] (-1740.902) -- 0:00:51
855000 -- (-1736.680) (-1745.789) (-1742.457) [-1747.991] * (-1739.645) (-1738.815) [-1738.416] (-1738.134) -- 0:00:51
Average standard deviation of split frequencies: 0.007104
855500 -- [-1741.023] (-1735.949) (-1741.701) (-1743.150) * (-1742.139) (-1739.746) (-1737.712) [-1734.506] -- 0:00:51
856000 -- (-1744.524) (-1744.607) [-1745.463] (-1741.737) * (-1746.146) [-1740.518] (-1742.587) (-1747.530) -- 0:00:50
856500 -- (-1746.512) [-1736.370] (-1744.743) (-1744.408) * (-1744.729) (-1747.188) [-1736.648] (-1742.603) -- 0:00:50
857000 -- (-1752.375) (-1745.438) (-1746.499) [-1741.602] * [-1744.903] (-1741.638) (-1742.266) (-1737.263) -- 0:00:50
857500 -- (-1742.916) [-1743.623] (-1744.142) (-1741.518) * (-1752.033) (-1745.467) [-1737.551] (-1740.687) -- 0:00:50
858000 -- (-1738.304) [-1742.061] (-1740.850) (-1748.326) * (-1744.085) (-1743.858) (-1737.458) [-1742.995] -- 0:00:50
858500 -- [-1739.382] (-1740.794) (-1741.275) (-1741.506) * (-1741.689) (-1751.553) [-1744.123] (-1748.858) -- 0:00:49
859000 -- (-1747.911) (-1743.574) [-1741.841] (-1753.503) * (-1740.726) (-1747.665) (-1742.980) [-1744.177] -- 0:00:49
859500 -- (-1743.829) (-1744.341) [-1739.130] (-1741.916) * [-1736.987] (-1740.819) (-1746.444) (-1755.619) -- 0:00:49
860000 -- [-1739.974] (-1742.527) (-1743.371) (-1743.794) * (-1741.179) [-1744.262] (-1745.505) (-1750.222) -- 0:00:49
Average standard deviation of split frequencies: 0.007066
860500 -- (-1740.992) (-1739.057) (-1742.765) [-1740.988] * (-1741.551) (-1740.250) (-1748.881) [-1740.590] -- 0:00:49
861000 -- (-1741.400) [-1741.866] (-1746.320) (-1746.346) * (-1751.957) [-1736.428] (-1741.605) (-1735.087) -- 0:00:49
861500 -- (-1740.024) (-1739.493) (-1738.205) [-1738.210] * (-1742.691) [-1745.921] (-1749.416) (-1738.413) -- 0:00:48
862000 -- (-1742.573) [-1745.363] (-1738.018) (-1737.711) * (-1736.219) [-1740.901] (-1741.160) (-1749.704) -- 0:00:48
862500 -- (-1741.201) [-1745.627] (-1752.223) (-1743.403) * (-1742.302) (-1749.389) [-1740.770] (-1745.752) -- 0:00:48
863000 -- [-1738.961] (-1759.464) (-1747.465) (-1738.230) * (-1746.958) (-1744.225) (-1744.931) [-1743.313] -- 0:00:48
863500 -- (-1744.193) (-1746.571) (-1742.941) [-1741.513] * (-1743.568) [-1744.155] (-1744.606) (-1743.925) -- 0:00:48
864000 -- (-1751.857) (-1752.412) (-1742.282) [-1738.528] * (-1743.282) [-1745.944] (-1749.553) (-1741.979) -- 0:00:48
864500 -- [-1740.960] (-1748.365) (-1744.070) (-1742.318) * (-1746.165) (-1743.540) (-1743.602) [-1744.962] -- 0:00:47
865000 -- (-1739.780) (-1749.721) [-1739.330] (-1743.115) * (-1735.515) (-1745.243) (-1750.130) [-1748.153] -- 0:00:47
Average standard deviation of split frequencies: 0.006913
865500 -- (-1739.007) [-1747.969] (-1741.154) (-1740.952) * (-1740.442) (-1742.478) (-1741.212) [-1738.482] -- 0:00:47
866000 -- (-1738.364) (-1737.428) (-1742.256) [-1742.787] * (-1742.917) (-1749.670) (-1740.523) [-1737.559] -- 0:00:47
866500 -- (-1734.978) (-1742.140) (-1741.076) [-1742.788] * (-1737.027) [-1742.228] (-1751.473) (-1746.002) -- 0:00:47
867000 -- [-1740.291] (-1749.923) (-1746.705) (-1747.446) * (-1741.537) (-1742.845) (-1745.023) [-1742.306] -- 0:00:46
867500 -- [-1735.157] (-1741.383) (-1742.631) (-1746.284) * (-1741.950) [-1739.894] (-1746.745) (-1738.992) -- 0:00:46
868000 -- (-1746.233) (-1734.817) (-1751.304) [-1740.056] * [-1736.503] (-1749.787) (-1735.332) (-1749.131) -- 0:00:46
868500 -- [-1743.130] (-1737.119) (-1742.223) (-1745.194) * (-1737.440) [-1736.203] (-1743.297) (-1754.011) -- 0:00:46
869000 -- [-1742.755] (-1741.179) (-1738.133) (-1748.836) * [-1739.178] (-1741.567) (-1736.348) (-1748.638) -- 0:00:46
869500 -- [-1739.520] (-1740.134) (-1751.986) (-1743.733) * (-1741.202) (-1741.783) (-1742.975) [-1749.100] -- 0:00:46
870000 -- [-1739.440] (-1747.768) (-1739.472) (-1741.502) * (-1748.219) (-1742.202) [-1738.128] (-1746.983) -- 0:00:45
Average standard deviation of split frequencies: 0.007418
870500 -- [-1739.408] (-1740.668) (-1741.936) (-1741.357) * [-1747.424] (-1741.970) (-1743.125) (-1749.294) -- 0:00:45
871000 -- (-1743.166) [-1742.121] (-1748.696) (-1740.769) * (-1739.250) (-1744.278) [-1737.061] (-1737.536) -- 0:00:45
871500 -- (-1741.245) (-1739.923) [-1742.637] (-1739.419) * (-1736.322) (-1744.085) [-1739.675] (-1741.166) -- 0:00:45
872000 -- (-1743.070) (-1747.043) (-1738.993) [-1740.283] * (-1743.858) (-1741.157) [-1741.789] (-1740.055) -- 0:00:45
872500 -- (-1744.199) (-1747.566) [-1742.741] (-1738.876) * (-1740.390) (-1750.324) (-1744.409) [-1740.720] -- 0:00:45
873000 -- (-1742.699) (-1744.507) (-1742.146) [-1740.016] * (-1741.080) (-1744.408) (-1739.924) [-1745.798] -- 0:00:44
873500 -- (-1750.702) [-1742.021] (-1743.530) (-1745.275) * (-1738.647) (-1739.222) (-1739.527) [-1738.339] -- 0:00:44
874000 -- (-1740.729) (-1741.404) (-1741.445) [-1737.355] * (-1743.525) (-1745.196) [-1743.292] (-1746.880) -- 0:00:44
874500 -- (-1744.985) (-1740.294) (-1741.715) [-1742.877] * (-1737.216) (-1745.736) (-1742.811) [-1742.789] -- 0:00:44
875000 -- (-1747.826) (-1736.214) [-1736.364] (-1744.475) * (-1741.012) (-1745.632) (-1738.810) [-1737.367] -- 0:00:44
Average standard deviation of split frequencies: 0.007534
875500 -- (-1738.523) (-1748.668) [-1736.983] (-1744.915) * (-1745.435) [-1740.920] (-1743.871) (-1737.371) -- 0:00:43
876000 -- (-1740.127) (-1744.142) [-1738.597] (-1739.427) * (-1742.336) (-1754.310) [-1746.200] (-1739.404) -- 0:00:43
876500 -- (-1741.731) (-1743.807) [-1737.622] (-1744.614) * (-1742.425) (-1738.713) (-1736.684) [-1738.812] -- 0:00:43
877000 -- (-1735.658) (-1742.635) [-1740.803] (-1742.024) * [-1744.233] (-1746.210) (-1747.870) (-1737.120) -- 0:00:43
877500 -- (-1740.123) (-1750.461) [-1740.894] (-1750.965) * (-1756.020) (-1745.349) (-1748.722) [-1735.860] -- 0:00:43
878000 -- (-1746.702) [-1739.250] (-1747.102) (-1747.713) * [-1750.872] (-1738.659) (-1743.435) (-1739.656) -- 0:00:43
878500 -- (-1741.738) (-1741.385) [-1735.569] (-1747.035) * (-1741.315) [-1742.476] (-1748.600) (-1738.661) -- 0:00:42
879000 -- (-1739.689) (-1743.990) [-1738.027] (-1739.458) * (-1743.102) (-1737.042) [-1742.397] (-1739.030) -- 0:00:42
879500 -- (-1752.551) (-1743.445) [-1738.994] (-1742.912) * (-1740.684) (-1744.448) [-1740.341] (-1747.851) -- 0:00:42
880000 -- (-1738.370) (-1745.467) [-1742.419] (-1740.132) * [-1738.872] (-1736.893) (-1744.788) (-1737.501) -- 0:00:42
Average standard deviation of split frequencies: 0.007280
880500 -- (-1740.269) (-1741.618) (-1737.150) [-1737.984] * [-1742.244] (-1740.854) (-1743.824) (-1744.780) -- 0:00:42
881000 -- (-1749.422) [-1737.108] (-1747.518) (-1750.463) * (-1740.744) (-1739.943) (-1746.301) [-1742.121] -- 0:00:42
881500 -- (-1750.477) [-1741.791] (-1747.977) (-1738.584) * (-1740.834) [-1735.915] (-1743.895) (-1742.763) -- 0:00:41
882000 -- (-1747.690) [-1741.302] (-1754.111) (-1740.966) * (-1743.915) (-1739.620) (-1745.866) [-1736.277] -- 0:00:41
882500 -- (-1747.395) [-1739.400] (-1739.295) (-1743.140) * (-1745.566) [-1739.546] (-1749.607) (-1743.412) -- 0:00:41
883000 -- (-1744.471) (-1742.945) [-1738.432] (-1747.727) * (-1742.332) (-1746.665) (-1738.483) [-1740.743] -- 0:00:41
883500 -- (-1745.367) (-1755.689) [-1738.767] (-1744.102) * (-1736.410) [-1742.666] (-1747.300) (-1750.850) -- 0:00:41
884000 -- (-1739.664) (-1747.043) (-1744.074) [-1745.836] * (-1743.886) [-1736.365] (-1739.958) (-1741.564) -- 0:00:40
884500 -- (-1740.257) (-1742.010) [-1745.018] (-1742.416) * (-1748.410) [-1739.743] (-1745.495) (-1747.170) -- 0:00:40
885000 -- (-1747.360) [-1744.662] (-1739.902) (-1738.669) * [-1738.482] (-1736.900) (-1738.126) (-1734.817) -- 0:00:40
Average standard deviation of split frequencies: 0.007555
885500 -- (-1745.350) (-1752.792) [-1736.742] (-1743.016) * [-1742.642] (-1736.831) (-1746.260) (-1751.625) -- 0:00:40
886000 -- (-1734.442) [-1750.336] (-1745.413) (-1744.526) * [-1737.156] (-1741.806) (-1743.398) (-1739.682) -- 0:00:40
886500 -- (-1747.122) (-1746.555) (-1745.709) [-1747.194] * [-1737.890] (-1750.247) (-1746.747) (-1737.186) -- 0:00:40
887000 -- [-1740.716] (-1750.907) (-1751.026) (-1743.762) * (-1749.845) [-1746.015] (-1745.690) (-1739.282) -- 0:00:39
887500 -- (-1744.612) (-1745.093) (-1741.362) [-1741.290] * (-1739.864) (-1742.492) (-1741.677) [-1736.764] -- 0:00:39
888000 -- (-1747.655) (-1737.118) (-1743.684) [-1735.745] * (-1743.245) (-1747.122) (-1744.744) [-1735.327] -- 0:00:39
888500 -- (-1748.173) [-1737.402] (-1743.122) (-1744.708) * (-1747.403) (-1743.309) (-1740.022) [-1743.200] -- 0:00:39
889000 -- [-1743.781] (-1736.707) (-1741.103) (-1747.245) * (-1744.016) (-1741.997) [-1745.241] (-1743.823) -- 0:00:39
889500 -- (-1745.708) (-1742.937) (-1751.033) [-1740.869] * [-1737.188] (-1738.528) (-1739.818) (-1740.353) -- 0:00:39
890000 -- [-1739.398] (-1738.960) (-1738.878) (-1746.391) * (-1744.131) (-1741.122) (-1740.723) [-1744.390] -- 0:00:38
Average standard deviation of split frequencies: 0.007992
890500 -- (-1746.869) (-1739.666) (-1745.504) [-1738.755] * (-1746.776) (-1735.010) (-1759.823) [-1741.343] -- 0:00:38
891000 -- [-1740.670] (-1738.100) (-1762.854) (-1745.043) * [-1738.034] (-1745.592) (-1745.738) (-1740.452) -- 0:00:38
891500 -- (-1746.344) [-1744.642] (-1738.063) (-1744.578) * [-1744.824] (-1745.832) (-1755.205) (-1741.725) -- 0:00:38
892000 -- (-1738.477) (-1740.065) (-1746.877) [-1744.053] * [-1749.227] (-1743.395) (-1756.698) (-1742.072) -- 0:00:38
892500 -- [-1736.614] (-1748.137) (-1740.111) (-1742.591) * [-1737.474] (-1743.603) (-1753.389) (-1745.925) -- 0:00:37
893000 -- (-1739.077) [-1737.890] (-1748.522) (-1739.229) * (-1739.976) [-1748.317] (-1747.819) (-1748.241) -- 0:00:37
893500 -- (-1739.310) (-1749.489) [-1738.371] (-1741.774) * [-1735.102] (-1743.270) (-1749.098) (-1747.074) -- 0:00:37
894000 -- [-1741.221] (-1744.252) (-1745.452) (-1739.910) * (-1747.408) [-1736.962] (-1743.189) (-1736.622) -- 0:00:37
894500 -- (-1743.398) (-1750.456) [-1735.923] (-1744.533) * [-1737.789] (-1749.112) (-1744.366) (-1750.025) -- 0:00:37
895000 -- (-1752.375) (-1742.033) (-1739.610) [-1733.095] * [-1735.227] (-1739.813) (-1741.038) (-1746.587) -- 0:00:37
Average standard deviation of split frequencies: 0.007629
895500 -- (-1745.042) (-1745.361) (-1744.782) [-1744.554] * (-1741.412) [-1737.002] (-1739.217) (-1764.833) -- 0:00:36
896000 -- (-1742.391) (-1742.567) [-1746.896] (-1738.450) * (-1746.054) (-1741.773) [-1743.666] (-1738.939) -- 0:00:36
896500 -- [-1739.818] (-1745.552) (-1738.453) (-1741.500) * (-1746.065) (-1741.338) (-1742.241) [-1741.773] -- 0:00:36
897000 -- [-1735.016] (-1740.769) (-1740.363) (-1739.002) * (-1742.993) (-1746.807) (-1742.897) [-1738.828] -- 0:00:36
897500 -- (-1748.695) (-1752.418) [-1740.430] (-1742.206) * (-1746.700) (-1737.591) [-1741.034] (-1739.888) -- 0:00:36
898000 -- (-1754.057) (-1732.872) [-1740.116] (-1744.594) * [-1740.820] (-1743.492) (-1742.385) (-1738.315) -- 0:00:36
898500 -- (-1742.877) (-1742.486) (-1738.034) [-1744.018] * (-1736.546) (-1739.728) [-1743.149] (-1742.403) -- 0:00:35
899000 -- (-1736.655) [-1741.280] (-1745.969) (-1747.349) * (-1740.528) [-1735.460] (-1742.992) (-1741.681) -- 0:00:35
899500 -- (-1742.299) (-1739.440) [-1747.994] (-1740.221) * [-1744.242] (-1742.740) (-1745.269) (-1750.685) -- 0:00:35
900000 -- (-1743.531) [-1743.664] (-1742.524) (-1751.759) * [-1739.913] (-1738.981) (-1738.703) (-1744.763) -- 0:00:35
Average standard deviation of split frequencies: 0.007746
900500 -- (-1736.873) (-1738.795) (-1742.478) [-1746.714] * (-1742.173) (-1738.271) (-1739.486) [-1744.943] -- 0:00:35
901000 -- (-1746.104) [-1742.129] (-1741.614) (-1759.508) * (-1741.412) (-1738.834) (-1741.899) [-1743.071] -- 0:00:34
901500 -- [-1742.469] (-1737.899) (-1739.336) (-1751.817) * (-1742.698) [-1745.268] (-1738.498) (-1737.304) -- 0:00:34
902000 -- (-1744.914) [-1746.359] (-1753.393) (-1746.213) * (-1743.832) [-1740.259] (-1745.197) (-1738.143) -- 0:00:34
902500 -- (-1755.499) [-1739.297] (-1747.589) (-1749.833) * (-1737.828) [-1745.221] (-1741.837) (-1739.423) -- 0:00:34
903000 -- (-1747.132) [-1737.586] (-1751.576) (-1746.357) * (-1747.508) (-1737.662) [-1743.444] (-1738.471) -- 0:00:34
903500 -- [-1744.475] (-1740.740) (-1746.181) (-1740.972) * (-1742.881) (-1738.759) [-1738.698] (-1744.366) -- 0:00:34
904000 -- [-1744.112] (-1739.025) (-1740.805) (-1739.721) * (-1745.442) [-1742.169] (-1741.453) (-1740.212) -- 0:00:33
904500 -- (-1742.337) (-1742.975) [-1742.701] (-1748.047) * (-1737.150) (-1748.981) [-1742.745] (-1740.184) -- 0:00:33
905000 -- (-1744.243) (-1751.110) (-1739.684) [-1742.484] * (-1744.956) [-1744.047] (-1751.875) (-1743.595) -- 0:00:33
Average standard deviation of split frequencies: 0.007388
905500 -- (-1739.002) [-1747.887] (-1741.107) (-1741.984) * (-1745.840) (-1738.798) [-1740.673] (-1741.278) -- 0:00:33
906000 -- (-1741.840) (-1749.739) (-1747.703) [-1740.530] * (-1756.626) [-1737.916] (-1738.054) (-1745.324) -- 0:00:33
906500 -- [-1743.109] (-1745.504) (-1740.268) (-1747.005) * [-1744.996] (-1744.574) (-1746.550) (-1741.905) -- 0:00:33
907000 -- [-1738.311] (-1752.199) (-1741.599) (-1753.630) * [-1740.319] (-1741.472) (-1743.986) (-1748.730) -- 0:00:32
907500 -- (-1736.961) [-1739.757] (-1741.980) (-1744.271) * [-1737.226] (-1741.657) (-1738.640) (-1743.638) -- 0:00:32
908000 -- (-1743.406) [-1740.356] (-1745.469) (-1742.556) * (-1740.487) (-1740.383) [-1741.978] (-1740.529) -- 0:00:32
908500 -- (-1743.238) [-1738.321] (-1743.821) (-1739.429) * [-1739.374] (-1743.213) (-1740.405) (-1741.391) -- 0:00:32
909000 -- (-1738.622) (-1743.880) (-1742.086) [-1748.842] * (-1738.818) (-1742.477) (-1755.932) [-1739.197] -- 0:00:32
909500 -- [-1745.611] (-1743.916) (-1747.029) (-1745.005) * [-1741.584] (-1753.804) (-1741.796) (-1739.466) -- 0:00:31
910000 -- (-1743.022) (-1736.825) [-1745.154] (-1738.762) * (-1739.894) (-1737.215) (-1747.915) [-1733.870] -- 0:00:31
Average standard deviation of split frequencies: 0.007299
910500 -- (-1743.300) (-1738.888) (-1745.656) [-1734.167] * (-1749.936) [-1734.513] (-1739.249) (-1741.652) -- 0:00:31
911000 -- (-1744.220) [-1743.425] (-1742.989) (-1746.033) * (-1743.154) [-1737.409] (-1747.135) (-1742.505) -- 0:00:31
911500 -- (-1748.271) (-1749.741) [-1737.792] (-1742.543) * [-1740.026] (-1746.270) (-1738.104) (-1763.241) -- 0:00:31
912000 -- (-1742.946) (-1743.805) [-1742.880] (-1740.049) * (-1747.487) (-1738.377) (-1739.885) [-1741.129] -- 0:00:31
912500 -- (-1747.130) (-1739.620) (-1746.111) [-1743.386] * [-1737.104] (-1749.180) (-1745.505) (-1740.877) -- 0:00:30
913000 -- (-1755.616) (-1733.929) [-1748.942] (-1743.170) * [-1742.775] (-1743.649) (-1740.619) (-1741.480) -- 0:00:30
913500 -- (-1738.476) (-1739.852) [-1739.601] (-1744.126) * (-1753.903) [-1744.970] (-1741.671) (-1750.612) -- 0:00:30
914000 -- (-1742.839) (-1739.547) (-1738.779) [-1746.283] * (-1740.281) (-1743.485) [-1742.218] (-1747.520) -- 0:00:30
914500 -- (-1744.278) (-1737.397) [-1746.997] (-1739.057) * (-1748.636) (-1741.766) (-1744.334) [-1747.991] -- 0:00:30
915000 -- (-1747.085) (-1748.951) (-1747.590) [-1739.843] * [-1738.471] (-1737.014) (-1738.224) (-1744.503) -- 0:00:30
Average standard deviation of split frequencies: 0.007668
915500 -- (-1743.914) (-1744.605) [-1746.039] (-1740.929) * (-1744.770) (-1740.080) [-1740.504] (-1738.531) -- 0:00:29
916000 -- (-1742.996) (-1738.087) (-1741.858) [-1741.019] * (-1749.771) (-1749.252) (-1739.651) [-1743.320] -- 0:00:29
916500 -- (-1746.031) (-1740.055) [-1737.865] (-1738.211) * (-1746.708) [-1738.673] (-1739.061) (-1747.556) -- 0:00:29
917000 -- (-1745.219) [-1739.764] (-1738.742) (-1742.514) * (-1744.387) (-1746.806) [-1738.013] (-1741.172) -- 0:00:29
917500 -- (-1742.133) (-1743.167) (-1740.988) [-1734.651] * (-1754.658) [-1745.622] (-1739.680) (-1745.804) -- 0:00:29
918000 -- (-1739.555) [-1739.890] (-1741.044) (-1736.032) * (-1744.959) (-1742.577) [-1741.529] (-1734.465) -- 0:00:28
918500 -- (-1749.206) (-1758.260) (-1748.729) [-1744.493] * (-1741.262) (-1753.613) (-1747.172) [-1737.054] -- 0:00:28
919000 -- [-1737.303] (-1757.912) (-1742.240) (-1750.544) * (-1746.519) (-1758.645) [-1749.521] (-1742.459) -- 0:00:28
919500 -- (-1743.991) [-1745.257] (-1748.028) (-1740.807) * (-1744.621) (-1747.589) (-1740.896) [-1740.670] -- 0:00:28
920000 -- (-1748.674) [-1740.912] (-1745.624) (-1747.577) * (-1742.633) (-1741.769) [-1734.480] (-1739.685) -- 0:00:28
Average standard deviation of split frequencies: 0.007117
920500 -- (-1740.235) (-1739.950) [-1738.043] (-1744.147) * (-1759.095) (-1741.936) [-1733.614] (-1739.368) -- 0:00:28
921000 -- (-1736.502) (-1735.896) (-1741.355) [-1738.430] * [-1745.344] (-1749.076) (-1743.372) (-1742.703) -- 0:00:27
921500 -- (-1747.346) (-1740.228) (-1747.477) [-1750.984] * (-1742.711) (-1744.589) (-1742.478) [-1740.431] -- 0:00:27
922000 -- [-1739.494] (-1743.614) (-1738.694) (-1736.191) * [-1743.425] (-1746.244) (-1748.079) (-1744.287) -- 0:00:27
922500 -- (-1741.160) [-1742.839] (-1739.247) (-1741.845) * (-1741.042) (-1742.058) (-1744.435) [-1738.616] -- 0:00:27
923000 -- (-1741.515) (-1740.138) [-1751.239] (-1741.694) * (-1745.756) [-1743.740] (-1749.244) (-1743.507) -- 0:00:27
923500 -- (-1740.157) (-1738.912) [-1739.570] (-1743.695) * [-1738.110] (-1740.899) (-1744.437) (-1738.708) -- 0:00:27
924000 -- [-1737.608] (-1740.807) (-1748.552) (-1741.545) * (-1742.618) [-1742.987] (-1742.647) (-1742.589) -- 0:00:26
924500 -- (-1740.957) (-1743.671) [-1744.082] (-1736.207) * (-1744.150) [-1736.329] (-1738.004) (-1746.495) -- 0:00:26
925000 -- [-1737.776] (-1743.582) (-1737.040) (-1740.058) * [-1747.032] (-1752.832) (-1737.575) (-1745.559) -- 0:00:26
Average standard deviation of split frequencies: 0.006923
925500 -- (-1740.183) [-1746.743] (-1746.219) (-1746.231) * [-1740.197] (-1740.069) (-1738.989) (-1743.490) -- 0:00:26
926000 -- (-1738.982) [-1740.174] (-1741.178) (-1741.770) * (-1745.369) (-1738.776) [-1741.793] (-1741.656) -- 0:00:26
926500 -- [-1737.217] (-1747.023) (-1745.446) (-1740.937) * (-1748.102) (-1743.209) (-1741.346) [-1741.267] -- 0:00:25
927000 -- (-1741.115) [-1746.497] (-1744.127) (-1738.568) * (-1747.784) [-1742.729] (-1742.938) (-1744.345) -- 0:00:25
927500 -- [-1743.601] (-1755.032) (-1743.549) (-1743.982) * (-1746.563) [-1742.109] (-1740.349) (-1740.075) -- 0:00:25
928000 -- [-1739.257] (-1745.360) (-1737.749) (-1740.359) * (-1738.759) [-1739.117] (-1744.962) (-1749.715) -- 0:00:25
928500 -- (-1743.479) (-1739.617) [-1747.549] (-1738.678) * (-1736.593) (-1744.925) (-1743.240) [-1737.975] -- 0:00:25
929000 -- (-1741.439) (-1741.785) [-1739.208] (-1742.477) * (-1753.562) (-1746.700) [-1746.386] (-1736.618) -- 0:00:25
929500 -- (-1747.956) (-1745.078) (-1745.793) [-1735.883] * (-1756.463) (-1744.202) (-1748.374) [-1746.946] -- 0:00:24
930000 -- (-1750.942) (-1751.725) (-1745.132) [-1735.636] * (-1744.889) (-1740.691) [-1745.025] (-1752.647) -- 0:00:24
Average standard deviation of split frequencies: 0.007142
930500 -- (-1749.682) (-1746.981) (-1745.598) [-1741.207] * (-1739.160) (-1741.296) (-1752.658) [-1740.545] -- 0:00:24
931000 -- (-1744.854) (-1741.633) [-1741.332] (-1747.452) * [-1738.402] (-1739.466) (-1739.997) (-1743.044) -- 0:00:24
931500 -- (-1740.658) (-1749.641) (-1739.948) [-1753.249] * [-1743.939] (-1744.539) (-1753.054) (-1739.425) -- 0:00:24
932000 -- (-1739.933) [-1738.833] (-1746.156) (-1746.342) * (-1747.455) (-1738.217) [-1742.333] (-1741.424) -- 0:00:24
932500 -- [-1741.105] (-1738.500) (-1744.781) (-1744.517) * [-1739.660] (-1740.686) (-1743.391) (-1752.399) -- 0:00:23
933000 -- (-1737.621) [-1732.442] (-1742.037) (-1750.084) * (-1736.122) (-1737.091) [-1744.614] (-1744.286) -- 0:00:23
933500 -- [-1741.662] (-1735.772) (-1747.974) (-1740.884) * (-1741.584) (-1743.021) [-1743.578] (-1738.272) -- 0:00:23
934000 -- (-1744.925) (-1739.314) (-1745.573) [-1740.154] * (-1741.992) [-1743.120] (-1739.633) (-1738.730) -- 0:00:23
934500 -- (-1740.952) [-1740.620] (-1742.203) (-1740.195) * [-1741.791] (-1741.595) (-1747.219) (-1736.990) -- 0:00:23
935000 -- (-1739.055) [-1737.178] (-1739.752) (-1743.900) * (-1745.987) [-1743.964] (-1744.382) (-1745.412) -- 0:00:22
Average standard deviation of split frequencies: 0.006648
935500 -- [-1740.298] (-1740.320) (-1748.482) (-1739.283) * [-1741.866] (-1747.714) (-1736.933) (-1747.972) -- 0:00:22
936000 -- [-1740.273] (-1741.873) (-1751.572) (-1733.892) * (-1736.462) (-1746.365) [-1738.804] (-1741.399) -- 0:00:22
936500 -- (-1747.446) (-1746.168) (-1742.284) [-1745.297] * (-1741.098) [-1741.164] (-1740.490) (-1741.738) -- 0:00:22
937000 -- (-1745.863) (-1738.341) [-1746.938] (-1745.767) * [-1741.338] (-1735.171) (-1740.559) (-1742.383) -- 0:00:22
937500 -- (-1741.337) (-1737.077) (-1746.892) [-1739.324] * (-1747.988) (-1760.777) [-1738.918] (-1742.596) -- 0:00:22
938000 -- (-1746.353) (-1741.548) (-1741.826) [-1741.058] * [-1740.042] (-1741.861) (-1741.583) (-1739.769) -- 0:00:21
938500 -- (-1749.174) [-1739.673] (-1741.772) (-1739.366) * (-1744.112) (-1749.582) [-1736.246] (-1734.975) -- 0:00:21
939000 -- (-1746.831) (-1744.152) [-1742.141] (-1744.752) * (-1745.779) (-1746.577) [-1743.729] (-1744.572) -- 0:00:21
939500 -- (-1750.577) (-1742.945) (-1745.550) [-1743.272] * (-1741.393) [-1738.697] (-1746.986) (-1751.028) -- 0:00:21
940000 -- (-1746.419) [-1738.626] (-1750.248) (-1746.296) * (-1739.613) [-1743.756] (-1747.118) (-1742.503) -- 0:00:21
Average standard deviation of split frequencies: 0.006465
940500 -- (-1736.361) [-1741.261] (-1743.283) (-1740.783) * (-1739.080) (-1741.161) [-1742.697] (-1746.856) -- 0:00:21
941000 -- (-1740.256) [-1742.424] (-1743.055) (-1737.399) * (-1738.998) (-1741.559) (-1749.949) [-1745.428] -- 0:00:20
941500 -- (-1739.131) (-1743.370) (-1750.073) [-1740.650] * [-1738.890] (-1742.249) (-1739.678) (-1748.257) -- 0:00:20
942000 -- (-1738.325) [-1736.768] (-1739.437) (-1745.073) * (-1736.966) (-1748.985) (-1746.826) [-1741.294] -- 0:00:20
942500 -- (-1738.038) (-1739.003) [-1738.466] (-1742.483) * [-1739.640] (-1751.108) (-1739.000) (-1741.589) -- 0:00:20
943000 -- (-1743.405) (-1739.351) (-1740.027) [-1740.941] * (-1747.814) [-1735.510] (-1745.069) (-1758.768) -- 0:00:20
943500 -- (-1740.020) (-1747.961) (-1739.238) [-1739.867] * (-1736.130) [-1740.116] (-1750.901) (-1750.965) -- 0:00:19
944000 -- (-1741.159) [-1747.696] (-1746.201) (-1744.351) * (-1745.684) (-1738.965) (-1742.135) [-1737.387] -- 0:00:19
944500 -- (-1734.337) [-1740.330] (-1751.268) (-1745.967) * (-1738.501) [-1735.508] (-1753.376) (-1744.384) -- 0:00:19
945000 -- (-1741.079) [-1740.424] (-1748.918) (-1746.028) * (-1743.090) [-1739.825] (-1758.599) (-1747.007) -- 0:00:19
Average standard deviation of split frequencies: 0.006129
945500 -- [-1747.997] (-1743.953) (-1744.598) (-1743.474) * [-1744.275] (-1745.896) (-1745.057) (-1740.012) -- 0:00:19
946000 -- (-1742.876) (-1751.198) [-1742.450] (-1738.777) * [-1743.455] (-1746.009) (-1744.113) (-1747.011) -- 0:00:19
946500 -- (-1739.997) (-1748.312) [-1738.227] (-1736.677) * (-1744.136) (-1741.710) (-1740.623) [-1738.373] -- 0:00:18
947000 -- (-1738.055) [-1744.394] (-1737.480) (-1743.190) * (-1738.185) (-1744.326) (-1742.309) [-1738.802] -- 0:00:18
947500 -- [-1735.950] (-1736.068) (-1750.242) (-1739.065) * [-1751.301] (-1749.165) (-1745.111) (-1738.765) -- 0:00:18
948000 -- (-1734.744) [-1741.043] (-1739.208) (-1746.068) * [-1742.070] (-1747.760) (-1748.669) (-1747.819) -- 0:00:18
948500 -- (-1741.960) (-1742.658) (-1744.040) [-1739.087] * (-1735.473) [-1739.015] (-1745.183) (-1748.735) -- 0:00:18
949000 -- (-1744.844) (-1741.620) (-1745.940) [-1739.470] * (-1745.240) (-1749.187) [-1744.852] (-1741.829) -- 0:00:18
949500 -- (-1740.517) (-1754.586) (-1751.235) [-1737.277] * (-1737.399) (-1757.497) (-1738.607) [-1746.741] -- 0:00:17
950000 -- [-1739.588] (-1746.403) (-1741.955) (-1745.540) * (-1733.219) (-1744.298) (-1740.261) [-1739.757] -- 0:00:17
Average standard deviation of split frequencies: 0.006248
950500 -- (-1746.516) (-1741.279) [-1743.677] (-1747.999) * (-1748.945) [-1749.449] (-1752.197) (-1739.844) -- 0:00:17
951000 -- (-1742.663) (-1750.198) (-1750.715) [-1740.981] * [-1738.114] (-1742.248) (-1751.259) (-1746.448) -- 0:00:17
951500 -- (-1746.827) [-1749.384] (-1745.831) (-1738.496) * (-1745.092) (-1738.227) [-1746.204] (-1743.784) -- 0:00:17
952000 -- (-1740.808) (-1742.433) (-1738.530) [-1738.472] * (-1736.135) (-1742.912) (-1739.035) [-1743.956] -- 0:00:16
952500 -- (-1748.803) (-1745.304) [-1740.616] (-1750.818) * (-1741.634) (-1742.991) [-1745.065] (-1740.938) -- 0:00:16
953000 -- (-1750.455) (-1743.377) (-1740.968) [-1741.801] * [-1736.384] (-1751.755) (-1754.143) (-1740.587) -- 0:00:16
953500 -- (-1746.089) (-1743.592) (-1737.922) [-1743.067] * (-1739.085) (-1749.486) (-1753.871) [-1736.546] -- 0:00:16
954000 -- [-1737.822] (-1742.825) (-1740.429) (-1744.610) * (-1746.528) (-1738.922) [-1740.562] (-1734.984) -- 0:00:16
954500 -- (-1743.520) (-1739.032) (-1742.630) [-1740.193] * (-1742.977) [-1741.525] (-1739.311) (-1741.041) -- 0:00:16
955000 -- (-1747.212) [-1741.072] (-1743.449) (-1740.157) * (-1741.715) (-1745.145) [-1743.168] (-1741.570) -- 0:00:15
Average standard deviation of split frequencies: 0.005967
955500 -- (-1741.276) (-1749.020) [-1741.016] (-1745.810) * [-1744.515] (-1740.836) (-1750.764) (-1735.749) -- 0:00:15
956000 -- (-1742.359) (-1740.929) [-1742.727] (-1745.526) * (-1743.072) (-1742.767) [-1735.894] (-1739.128) -- 0:00:15
956500 -- (-1736.206) (-1744.359) (-1744.521) [-1737.549] * (-1744.567) (-1742.526) [-1742.529] (-1740.388) -- 0:00:15
957000 -- (-1744.054) (-1743.657) [-1735.582] (-1740.451) * (-1746.985) [-1737.242] (-1740.697) (-1745.176) -- 0:00:15
957500 -- [-1742.181] (-1742.580) (-1737.912) (-1744.632) * [-1755.139] (-1737.442) (-1740.854) (-1744.535) -- 0:00:15
958000 -- (-1744.409) (-1742.578) (-1736.123) [-1741.540] * (-1745.628) (-1736.089) (-1752.009) [-1741.171] -- 0:00:14
958500 -- (-1744.922) [-1734.000] (-1748.464) (-1739.312) * [-1744.430] (-1743.835) (-1738.014) (-1740.846) -- 0:00:14
959000 -- (-1747.809) [-1739.079] (-1744.854) (-1741.765) * (-1748.526) (-1742.582) (-1743.365) [-1740.817] -- 0:00:14
959500 -- (-1748.662) (-1746.194) [-1749.937] (-1742.035) * (-1750.077) (-1741.114) [-1742.397] (-1735.286) -- 0:00:14
960000 -- (-1748.132) (-1739.691) (-1740.190) [-1742.103] * (-1746.534) [-1745.530] (-1747.969) (-1746.250) -- 0:00:14
Average standard deviation of split frequencies: 0.006134
960500 -- (-1735.390) (-1740.405) (-1742.489) [-1743.394] * [-1736.501] (-1744.841) (-1742.622) (-1747.915) -- 0:00:13
961000 -- (-1747.100) (-1735.106) (-1737.733) [-1746.575] * (-1744.563) (-1742.883) [-1741.673] (-1734.843) -- 0:00:13
961500 -- (-1744.526) [-1741.238] (-1752.146) (-1747.086) * (-1739.382) (-1736.502) [-1741.772] (-1736.525) -- 0:00:13
962000 -- (-1748.227) (-1740.147) (-1739.493) [-1738.719] * (-1746.824) (-1736.947) [-1754.827] (-1750.983) -- 0:00:13
962500 -- (-1742.030) (-1742.347) (-1750.769) [-1738.148] * (-1746.913) [-1740.676] (-1753.459) (-1742.801) -- 0:00:13
963000 -- (-1743.016) (-1742.241) (-1745.384) [-1742.880] * (-1744.858) (-1739.974) [-1744.695] (-1738.154) -- 0:00:13
963500 -- (-1749.929) (-1743.125) [-1740.091] (-1740.948) * [-1741.182] (-1748.174) (-1744.061) (-1740.545) -- 0:00:12
964000 -- (-1743.550) (-1746.639) [-1740.556] (-1749.389) * (-1734.500) (-1745.524) [-1738.857] (-1742.089) -- 0:00:12
964500 -- (-1743.959) (-1741.503) (-1743.533) [-1737.438] * (-1741.084) (-1740.399) [-1746.844] (-1747.619) -- 0:00:12
965000 -- [-1746.563] (-1754.030) (-1748.490) (-1741.756) * [-1739.171] (-1746.882) (-1740.800) (-1746.624) -- 0:00:12
Average standard deviation of split frequencies: 0.006930
965500 -- (-1741.854) (-1750.621) (-1743.472) [-1736.573] * [-1741.184] (-1752.416) (-1742.433) (-1744.077) -- 0:00:12
966000 -- [-1738.238] (-1745.969) (-1740.193) (-1739.079) * [-1739.970] (-1748.556) (-1744.717) (-1737.481) -- 0:00:12
966500 -- (-1742.729) (-1744.721) (-1739.916) [-1739.409] * (-1742.676) [-1750.926] (-1746.185) (-1741.535) -- 0:00:11
967000 -- [-1739.669] (-1745.701) (-1744.276) (-1747.683) * [-1736.313] (-1741.643) (-1745.359) (-1750.440) -- 0:00:11
967500 -- (-1744.797) (-1750.398) [-1737.351] (-1747.105) * [-1738.440] (-1744.624) (-1741.001) (-1740.613) -- 0:00:11
968000 -- (-1748.596) (-1747.986) [-1737.158] (-1746.069) * (-1748.036) (-1740.153) [-1744.591] (-1745.385) -- 0:00:11
968500 -- (-1741.203) (-1750.588) [-1740.170] (-1740.541) * (-1739.732) (-1747.535) [-1740.564] (-1741.033) -- 0:00:11
969000 -- (-1738.952) (-1742.029) (-1748.362) [-1739.229] * (-1740.103) (-1739.558) (-1747.891) [-1739.445] -- 0:00:10
969500 -- (-1741.460) (-1742.985) (-1743.156) [-1735.750] * (-1740.402) [-1747.046] (-1749.730) (-1743.760) -- 0:00:10
970000 -- (-1746.412) (-1733.128) [-1745.392] (-1736.840) * [-1741.330] (-1746.654) (-1745.040) (-1746.473) -- 0:00:10
Average standard deviation of split frequencies: 0.005925
970500 -- [-1742.266] (-1745.698) (-1743.621) (-1739.422) * (-1739.440) (-1743.052) (-1749.745) [-1738.793] -- 0:00:10
971000 -- (-1745.580) (-1741.252) (-1742.143) [-1739.649] * (-1750.951) (-1747.584) [-1741.113] (-1740.951) -- 0:00:10
971500 -- (-1756.486) (-1741.114) [-1743.440] (-1736.635) * (-1735.444) [-1747.417] (-1741.014) (-1740.406) -- 0:00:10
972000 -- (-1745.715) (-1742.564) [-1746.014] (-1738.331) * (-1739.702) (-1743.168) (-1739.129) [-1739.427] -- 0:00:09
972500 -- (-1752.311) [-1742.039] (-1743.133) (-1744.665) * [-1742.819] (-1743.388) (-1745.684) (-1739.345) -- 0:00:09
973000 -- (-1750.578) (-1749.717) [-1739.406] (-1740.886) * (-1747.584) (-1739.345) (-1734.952) [-1740.156] -- 0:00:09
973500 -- [-1751.903] (-1748.734) (-1739.200) (-1748.211) * [-1745.438] (-1739.578) (-1743.849) (-1738.102) -- 0:00:09
974000 -- (-1746.183) (-1745.413) [-1736.038] (-1740.795) * (-1749.161) [-1739.021] (-1747.040) (-1745.801) -- 0:00:09
974500 -- (-1740.377) [-1746.677] (-1737.849) (-1747.647) * (-1742.095) (-1747.501) [-1743.504] (-1749.036) -- 0:00:09
975000 -- (-1749.857) [-1737.430] (-1737.030) (-1736.022) * (-1753.519) [-1737.996] (-1745.977) (-1738.972) -- 0:00:08
Average standard deviation of split frequencies: 0.006182
975500 -- (-1736.731) [-1740.945] (-1751.810) (-1741.328) * (-1739.614) (-1746.105) (-1743.027) [-1741.254] -- 0:00:08
976000 -- [-1740.054] (-1746.307) (-1746.029) (-1750.093) * [-1740.767] (-1749.431) (-1742.125) (-1739.399) -- 0:00:08
976500 -- (-1743.826) [-1739.860] (-1744.575) (-1744.303) * (-1751.515) (-1745.257) [-1738.991] (-1743.649) -- 0:00:08
977000 -- (-1740.030) (-1748.282) [-1739.306] (-1739.215) * (-1744.656) (-1750.339) [-1742.100] (-1743.119) -- 0:00:08
977500 -- (-1739.518) (-1736.214) (-1752.685) [-1738.013] * (-1742.071) (-1751.715) (-1750.426) [-1746.834] -- 0:00:07
978000 -- [-1739.831] (-1742.925) (-1736.832) (-1741.627) * (-1743.019) (-1743.778) (-1741.650) [-1743.130] -- 0:00:07
978500 -- (-1743.111) (-1737.922) [-1738.302] (-1741.850) * (-1741.473) (-1744.048) [-1737.616] (-1749.363) -- 0:00:07
979000 -- (-1750.440) (-1743.122) (-1738.000) [-1744.189] * [-1743.212] (-1741.720) (-1737.971) (-1744.812) -- 0:00:07
979500 -- (-1748.351) (-1741.855) [-1735.290] (-1741.637) * (-1742.391) (-1757.040) [-1740.753] (-1747.513) -- 0:00:07
980000 -- (-1747.640) (-1742.101) [-1737.696] (-1745.677) * [-1748.613] (-1740.509) (-1747.006) (-1743.610) -- 0:00:07
Average standard deviation of split frequencies: 0.005624
980500 -- (-1747.448) [-1743.733] (-1743.250) (-1740.098) * (-1738.263) (-1737.993) [-1737.465] (-1746.326) -- 0:00:06
981000 -- (-1752.618) (-1747.583) [-1737.754] (-1749.163) * (-1748.339) [-1744.732] (-1739.962) (-1738.751) -- 0:00:06
981500 -- [-1745.329] (-1743.915) (-1741.764) (-1738.917) * (-1740.978) (-1747.134) (-1737.286) [-1739.025] -- 0:00:06
982000 -- (-1749.423) (-1740.988) [-1740.919] (-1744.422) * (-1746.010) (-1744.547) [-1747.794] (-1738.979) -- 0:00:06
982500 -- (-1749.316) (-1736.014) [-1750.550] (-1748.461) * (-1742.856) (-1748.525) [-1746.421] (-1742.767) -- 0:00:06
983000 -- (-1747.172) (-1743.079) [-1746.226] (-1743.399) * (-1744.314) (-1746.592) (-1749.325) [-1738.440] -- 0:00:06
983500 -- (-1735.732) (-1743.423) [-1738.968] (-1747.792) * [-1739.984] (-1740.398) (-1749.135) (-1736.135) -- 0:00:05
984000 -- [-1735.156] (-1741.093) (-1737.182) (-1742.942) * [-1739.695] (-1746.085) (-1742.564) (-1745.672) -- 0:00:05
984500 -- [-1745.911] (-1743.121) (-1742.208) (-1741.340) * (-1748.074) [-1742.381] (-1746.676) (-1740.750) -- 0:00:05
985000 -- [-1740.459] (-1749.667) (-1740.395) (-1745.780) * (-1740.919) (-1745.081) (-1749.726) [-1741.490] -- 0:00:05
Average standard deviation of split frequencies: 0.004781
985500 -- (-1754.834) (-1748.977) (-1742.639) [-1738.761] * [-1747.645] (-1747.899) (-1746.668) (-1748.780) -- 0:00:05
986000 -- (-1761.232) [-1756.116] (-1748.948) (-1740.876) * (-1742.819) (-1742.091) [-1741.742] (-1742.799) -- 0:00:04
986500 -- (-1758.518) (-1750.331) (-1736.659) [-1741.612] * (-1748.555) [-1739.769] (-1752.312) (-1744.248) -- 0:00:04
987000 -- (-1756.252) (-1742.572) [-1739.715] (-1740.652) * [-1742.418] (-1741.964) (-1744.239) (-1747.831) -- 0:00:04
987500 -- (-1746.643) [-1742.266] (-1741.947) (-1739.864) * (-1737.716) (-1746.155) [-1740.096] (-1744.910) -- 0:00:04
988000 -- (-1747.809) (-1747.783) [-1741.357] (-1741.295) * [-1738.598] (-1743.435) (-1748.807) (-1745.558) -- 0:00:04
988500 -- (-1740.936) (-1740.687) [-1740.984] (-1742.253) * (-1743.207) [-1735.446] (-1736.234) (-1746.962) -- 0:00:04
989000 -- (-1741.231) (-1741.287) [-1743.827] (-1737.255) * (-1744.529) (-1736.204) (-1751.463) [-1738.020] -- 0:00:03
989500 -- (-1745.688) (-1743.410) (-1743.021) [-1733.663] * (-1744.397) [-1739.662] (-1747.576) (-1740.737) -- 0:00:03
990000 -- (-1741.787) (-1745.840) (-1740.597) [-1735.350] * [-1748.998] (-1742.773) (-1752.442) (-1742.160) -- 0:00:03
Average standard deviation of split frequencies: 0.005044
990500 -- (-1755.025) (-1737.237) [-1739.381] (-1738.619) * [-1740.463] (-1745.654) (-1740.736) (-1742.503) -- 0:00:03
991000 -- (-1745.875) [-1744.846] (-1742.892) (-1740.313) * (-1744.558) (-1742.653) (-1749.221) [-1747.348] -- 0:00:03
991500 -- (-1751.697) (-1744.807) [-1740.101] (-1746.344) * (-1740.709) [-1737.987] (-1738.900) (-1748.866) -- 0:00:03
992000 -- (-1743.771) [-1753.851] (-1761.387) (-1745.677) * [-1737.533] (-1736.336) (-1741.183) (-1746.436) -- 0:00:02
992500 -- (-1739.759) (-1757.882) [-1737.658] (-1745.804) * [-1739.061] (-1751.191) (-1741.545) (-1745.610) -- 0:00:02
993000 -- (-1743.353) (-1753.702) (-1742.694) [-1741.073] * [-1746.850] (-1742.841) (-1740.339) (-1745.041) -- 0:00:02
993500 -- (-1743.246) [-1742.041] (-1740.439) (-1742.297) * (-1762.123) [-1741.291] (-1738.104) (-1746.087) -- 0:00:02
994000 -- (-1751.847) (-1750.631) (-1738.351) [-1736.365] * (-1749.341) (-1741.179) [-1740.854] (-1743.874) -- 0:00:02
994500 -- (-1746.403) (-1741.754) (-1743.627) [-1743.116] * (-1748.444) (-1739.591) [-1742.167] (-1746.484) -- 0:00:01
995000 -- (-1739.908) [-1738.579] (-1753.744) (-1738.502) * (-1746.439) (-1751.883) [-1739.347] (-1748.549) -- 0:00:01
Average standard deviation of split frequencies: 0.005159
995500 -- (-1742.490) [-1741.215] (-1746.356) (-1745.979) * [-1749.240] (-1748.028) (-1748.184) (-1745.347) -- 0:00:01
996000 -- (-1741.553) [-1740.418] (-1738.463) (-1746.969) * [-1740.172] (-1754.997) (-1737.957) (-1752.613) -- 0:00:01
996500 -- (-1743.729) (-1738.107) [-1740.318] (-1752.312) * (-1751.389) (-1741.556) [-1748.917] (-1741.481) -- 0:00:01
997000 -- (-1739.151) (-1743.703) [-1739.968] (-1735.690) * (-1741.296) [-1737.309] (-1752.307) (-1745.361) -- 0:00:01
997500 -- [-1744.082] (-1735.725) (-1746.781) (-1746.547) * (-1749.662) (-1738.363) [-1734.976] (-1737.056) -- 0:00:00
998000 -- [-1742.604] (-1742.092) (-1742.773) (-1756.219) * (-1744.099) (-1739.998) (-1735.925) [-1743.068] -- 0:00:00
998500 -- (-1744.122) (-1741.856) [-1738.686] (-1743.770) * (-1743.503) (-1739.110) (-1732.205) [-1741.418] -- 0:00:00
999000 -- (-1745.097) (-1742.416) [-1735.185] (-1744.421) * [-1743.064] (-1751.661) (-1743.022) (-1740.454) -- 0:00:00
999500 -- [-1741.163] (-1741.955) (-1739.199) (-1743.458) * [-1745.460] (-1749.770) (-1741.928) (-1741.572) -- 0:00:00
1000000 -- (-1739.854) [-1743.262] (-1742.435) (-1738.328) * [-1750.738] (-1744.390) (-1742.064) (-1741.862) -- 0:00:00
Average standard deviation of split frequencies: 0.004994
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1739.854079 -- 13.368949
Chain 1 -- -1739.854079 -- 13.368949
Chain 2 -- -1743.261741 -- 18.866721
Chain 2 -- -1743.261741 -- 18.866721
Chain 3 -- -1742.435358 -- 12.896530
Chain 3 -- -1742.435370 -- 12.896530
Chain 4 -- -1738.327928 -- 13.857627
Chain 4 -- -1738.327915 -- 13.857627
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1750.737644 -- 13.780897
Chain 1 -- -1750.737645 -- 13.780897
Chain 2 -- -1744.390421 -- 11.197214
Chain 2 -- -1744.390431 -- 11.197214
Chain 3 -- -1742.063800 -- 12.025863
Chain 3 -- -1742.063795 -- 12.025863
Chain 4 -- -1741.862375 -- 11.061427
Chain 4 -- -1741.862373 -- 11.061427
Analysis completed in 5 mins 53 seconds
Analysis used 352.04 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1731.01
Likelihood of best state for "cold" chain of run 2 was -1730.86
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
52.5 % ( 34 %) Dirichlet(Revmat{all})
65.2 % ( 50 %) Slider(Revmat{all})
27.2 % ( 35 %) Dirichlet(Pi{all})
29.0 % ( 25 %) Slider(Pi{all})
32.2 % ( 23 %) Multiplier(Alpha{1,2})
45.1 % ( 29 %) Multiplier(Alpha{3})
51.7 % ( 30 %) Slider(Pinvar{all})
14.9 % ( 17 %) ExtSPR(Tau{all},V{all})
6.9 % ( 8 %) ExtTBR(Tau{all},V{all})
27.9 % ( 18 %) NNI(Tau{all},V{all})
37.3 % ( 35 %) ParsSPR(Tau{all},V{all})
26.6 % ( 25 %) Multiplier(V{all})
38.4 % ( 47 %) Nodeslider(V{all})
25.6 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
53.3 % ( 46 %) Dirichlet(Revmat{all})
64.8 % ( 50 %) Slider(Revmat{all})
27.2 % ( 22 %) Dirichlet(Pi{all})
29.3 % ( 25 %) Slider(Pi{all})
32.0 % ( 24 %) Multiplier(Alpha{1,2})
45.8 % ( 22 %) Multiplier(Alpha{3})
51.6 % ( 26 %) Slider(Pinvar{all})
15.0 % ( 14 %) ExtSPR(Tau{all},V{all})
6.9 % ( 8 %) ExtTBR(Tau{all},V{all})
27.6 % ( 30 %) NNI(Tau{all},V{all})
36.9 % ( 36 %) ParsSPR(Tau{all},V{all})
26.5 % ( 24 %) Multiplier(V{all})
38.4 % ( 33 %) Nodeslider(V{all})
25.6 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.79 0.62 0.48
2 | 166616 0.81 0.65
3 | 166524 166536 0.83
4 | 165965 167400 166959
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.48
2 | 167325 0.81 0.65
3 | 165987 166760 0.82
4 | 166123 167227 166578
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1739.62
| 1 |
|2 2 1 2 2 1 |
| 1 1 1 2 1 |
| 2 2 1 2 2 1* |
| 1 11 12 2 2 1 2 2 1 1 1|
| 2 1 2 2 1 2 2 2 2 * 1 2 2 |
| 22 1* 1 21 21 1 1 11 1 2 1 1 1 |
| 1 1 1 2 22 1 12 |
| 1 222 211 * 11 2 1 12 2|
| 1 2 1 1 2 2 22 |
| 2 2 * 22 2 1 2 2 112 |
| 12 1 1 1 2 |
| |
| 2 |
|1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1743.42
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1737.20 -1749.67
2 -1737.25 -1749.06
--------------------------------------
TOTAL -1737.22 -1749.41
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.974883 0.018990 0.730584 1.259222 0.963939 1237.42 1369.21 1.000
r(A<->C){all} 0.099225 0.001052 0.039730 0.164490 0.096083 766.85 768.33 1.000
r(A<->G){all} 0.227105 0.001991 0.136875 0.311234 0.224785 653.38 678.63 1.001
r(A<->T){all} 0.222824 0.003058 0.123912 0.332708 0.219796 743.96 762.23 1.001
r(C<->G){all} 0.041914 0.000228 0.016191 0.074489 0.040591 879.78 1047.09 1.001
r(C<->T){all} 0.347358 0.003564 0.233241 0.465493 0.344458 317.59 477.79 1.002
r(G<->T){all} 0.061574 0.000735 0.012014 0.113350 0.058505 675.95 846.20 1.000
pi(A){all} 0.226813 0.000254 0.195399 0.257554 0.226252 1252.18 1319.69 1.000
pi(C){all} 0.305857 0.000323 0.271720 0.342168 0.305104 1054.36 1165.88 1.000
pi(G){all} 0.304103 0.000329 0.268566 0.339939 0.303865 923.59 1067.70 1.000
pi(T){all} 0.163226 0.000193 0.136876 0.191399 0.162807 882.02 948.42 1.001
alpha{1,2} 0.153694 0.001078 0.098619 0.220248 0.149927 1175.40 1289.94 1.000
alpha{3} 2.175489 0.679605 0.787195 3.804765 2.036216 1350.46 1375.04 1.000
pinvar{all} 0.434473 0.004640 0.299847 0.562677 0.438950 833.40 1167.20 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
Key to taxon bipartitions (saved to file "/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
--------------
1 -- .*******
2 -- .*......
3 -- ..*.....
4 -- ...*....
5 -- ....*...
6 -- .....*..
7 -- ......*.
8 -- .......*
9 -- .....***
10 -- ...*****
11 -- .....**.
12 -- .**.....
13 -- ...**...
14 -- ...*.***
15 -- .*.*****
16 -- ..******
17 -- ......**
18 -- ....****
--------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
9 3002 1.000000 0.000000 1.000000 1.000000 2
10 3001 0.999667 0.000471 0.999334 1.000000 2
11 2246 0.748168 0.007537 0.742838 0.753498 2
12 1767 0.588608 0.007066 0.583611 0.593604 2
13 1723 0.573951 0.009893 0.566955 0.580946 2
14 948 0.315789 0.009422 0.309127 0.322452 2
15 633 0.210859 0.003298 0.208528 0.213191 2
16 601 0.200200 0.010835 0.192538 0.207861 2
17 572 0.190540 0.000942 0.189873 0.191206 2
18 331 0.110260 0.000471 0.109927 0.110593 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.040329 0.000148 0.018695 0.064010 0.039308 1.000 2
length{all}[2] 0.005128 0.000015 0.000003 0.012674 0.004203 1.001 2
length{all}[3] 0.005062 0.000014 0.000001 0.012507 0.004207 1.000 2
length{all}[4] 0.058793 0.000330 0.025092 0.094074 0.057034 1.000 2
length{all}[5] 0.051839 0.000274 0.022987 0.083901 0.050479 1.000 2
length{all}[6] 0.213526 0.003130 0.114770 0.322686 0.207222 1.000 2
length{all}[7] 0.098454 0.001301 0.031003 0.170935 0.094727 1.000 2
length{all}[8] 0.246601 0.003712 0.140461 0.369894 0.239162 1.000 2
length{all}[9] 0.132103 0.001879 0.055739 0.216027 0.128263 1.000 2
length{all}[10] 0.053617 0.000404 0.017926 0.093511 0.051314 1.000 2
length{all}[11] 0.052625 0.001022 0.001115 0.111335 0.048237 1.001 2
length{all}[12] 0.006218 0.000029 0.000002 0.016684 0.004857 1.000 2
length{all}[13] 0.020455 0.000209 0.000018 0.048110 0.017556 1.000 2
length{all}[14] 0.016165 0.000150 0.000047 0.038820 0.013179 0.999 2
length{all}[15] 0.002959 0.000008 0.000002 0.008624 0.002174 1.003 2
length{all}[16] 0.003214 0.000011 0.000001 0.010206 0.002051 0.999 2
length{all}[17] 0.032528 0.000665 0.000002 0.082713 0.027013 0.998 2
length{all}[18] 0.010063 0.000099 0.000007 0.028374 0.006628 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004994
Maximum standard deviation of split frequencies = 0.010835
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------ C4 (4)
| /-----------------57----------------+
| | \------------------ C5 (5)
| |
|-------100-------+ /------------------ C6 (6)
+ | /--------75-------+
| | | \------------------ C7 (7)
| \-------100-------+
| \------------------------------------ C8 (8)
|
| /------------------ C2 (2)
\--------------------------59-------------------------+
\------------------ C3 (3)
Phylogram (based on average branch lengths):
/------- C1 (1)
|
| /---------- C4 (4)
| /--+
| | \--------- C5 (5)
| |
|-------+ /---------------------------------- C6 (6)
+ | /-------+
| | | \--------------- C7 (7)
| \---------------------+
| \--------------------------------------- C8 (8)
|
|/ C2 (2)
\+
\- C3 (3)
|---------------| 0.100 expected changes per site
Calculating tree probabilities...
Credible sets of trees (28 trees sampled):
50 % credible set contains 4 trees
90 % credible set contains 14 trees
95 % credible set contains 18 trees
99 % credible set contains 23 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 8 ls = 600
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Sites with gaps or missing data are removed.
33 ambiguity characters in seq. 1
33 ambiguity characters in seq. 2
33 ambiguity characters in seq. 3
33 ambiguity characters in seq. 4
36 ambiguity characters in seq. 5
42 ambiguity characters in seq. 6
39 ambiguity characters in seq. 7
54 ambiguity characters in seq. 8
22 sites are removed. 29 30 31 32 37 38 39 43 97 98 99 100 101 102 103 194 195 196 197 198 199 200
Sequences read..
Counting site patterns.. 0:00
122 patterns at 178 / 178 sites (100.0%), 0:00
Counting codons..
224 bytes for distance
119072 bytes for conP
16592 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 168
357216 bytes for conP, adjusted
0.066090 0.063946 0.022552 0.101580 0.069800 0.112444 0.057200 0.183212 0.150925 0.264332 0.011163 0.007290 0.003985 0.300000 1.300000
ntime & nrate & np: 13 2 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 15
lnL0 = -1820.017801
Iterating by ming2
Initial: fx= 1820.017801
x= 0.06609 0.06395 0.02255 0.10158 0.06980 0.11244 0.05720 0.18321 0.15092 0.26433 0.01116 0.00729 0.00398 0.30000 1.30000
1 h-m-p 0.0000 0.0001 292.7335 ++ 1811.978127 m 0.0001 20 | 0/15
2 h-m-p 0.0000 0.0000 1326.9197
h-m-p: 4.30508526e-21 2.15254263e-20 1.32691975e+03 1811.978127
.. | 0/15
3 h-m-p 0.0000 0.0001 441.5963 +CCCC 1809.780607 3 0.0001 60 | 0/15
4 h-m-p 0.0000 0.0001 303.7296 +CYYCCC 1805.750154 5 0.0001 87 | 0/15
5 h-m-p 0.0000 0.0001 1993.6611 ++ 1769.003864 m 0.0001 105 | 0/15
6 h-m-p 0.0000 0.0001 1303.2228 +CYCYYCCC 1754.066272 7 0.0001 135 | 0/15
7 h-m-p 0.0002 0.0009 490.2323 ++ 1726.766885 m 0.0009 153 | 0/15
8 h-m-p -0.0000 -0.0000 547.2143
h-m-p: -1.18412814e-20 -5.92064072e-20 5.47214340e+02 1726.766885
.. | 0/15
9 h-m-p 0.0000 0.0001 475.9279 +YCYCCC 1719.026685 5 0.0001 196 | 0/15
10 h-m-p 0.0001 0.0004 339.8882 +YYYCC 1713.127793 4 0.0003 220 | 0/15
11 h-m-p 0.0000 0.0001 1827.4633 YYYCC 1710.526623 4 0.0000 243 | 0/15
12 h-m-p 0.0000 0.0001 490.2652 ++ 1702.098722 m 0.0001 261 | 1/15
13 h-m-p 0.0001 0.0003 877.5624 ++ 1669.012711 m 0.0003 279 | 1/15
14 h-m-p 0.0000 0.0000 648.9863
h-m-p: 3.48486489e-20 1.74243245e-19 6.48986336e+02 1669.012711
.. | 1/15
15 h-m-p 0.0000 0.0002 1533.9263 +YYYCCC 1656.654319 5 0.0000 320 | 1/15
16 h-m-p 0.0000 0.0001 302.8363 +YCYYYCYCCC 1647.753928 9 0.0001 352 | 1/15
17 h-m-p 0.0000 0.0000 2745.0279 +YYCYYCC 1636.491239 6 0.0000 380 | 1/15
18 h-m-p 0.0001 0.0003 740.7648 ++ 1598.986093 m 0.0003 398 | 1/15
19 h-m-p 0.0000 0.0001 1860.9286 +YYCYCCC 1583.918121 6 0.0001 426 | 1/15
20 h-m-p 0.0000 0.0000 1159.2212 ++ 1579.907440 m 0.0000 444 | 1/15
21 h-m-p 0.0005 0.0029 44.1910 CCCC 1579.267363 3 0.0006 468 | 0/15
22 h-m-p 0.0000 0.0000 1318.4548 +YCCCC 1577.668870 4 0.0000 494 | 0/15
23 h-m-p 0.0003 0.0106 61.8479 ++YCCCC 1574.344662 4 0.0030 521 | 0/15
24 h-m-p 0.0002 0.0009 91.3415 ++ 1571.889164 m 0.0009 539 | 0/15
25 h-m-p 0.0006 0.0046 151.4349 YCCC 1568.308919 3 0.0014 562 | 0/15
26 h-m-p 0.0012 0.0073 169.4570 CCCC 1563.943031 3 0.0017 586 | 0/15
27 h-m-p 0.0011 0.0054 69.0783 YCCC 1563.127980 3 0.0008 609 | 0/15
28 h-m-p 0.0042 0.0248 13.7806 YCC 1562.887681 2 0.0020 630 | 0/15
29 h-m-p 0.0055 0.0964 5.0205 +YCC 1562.235590 2 0.0151 652 | 0/15
30 h-m-p 0.0034 0.0258 22.2495 CCCCC 1561.344859 4 0.0044 678 | 0/15
31 h-m-p 0.1586 0.7932 0.1307 +CCYC 1556.765220 3 0.6322 702 | 0/15
32 h-m-p 0.0392 0.1961 0.4012 +YCCC 1554.969323 3 0.1246 741 | 0/15
33 h-m-p 0.0874 0.4369 0.1202 ++ 1554.096761 m 0.4369 774 | 1/15
34 h-m-p 0.4136 8.0000 0.1270 +YCC 1552.211873 2 1.2161 811 | 1/15
35 h-m-p 1.6000 8.0000 0.0172 YCCC 1551.280277 3 3.2300 848 | 1/15
36 h-m-p 0.9849 8.0000 0.0563 +YCCC 1550.591083 3 2.7745 886 | 1/15
37 h-m-p 1.6000 8.0000 0.0084 +YC 1550.098103 1 4.7353 920 | 1/15
38 h-m-p 1.6000 8.0000 0.0156 YCCC 1549.490005 3 3.0500 957 | 1/15
39 h-m-p 1.6000 8.0000 0.0136 CCC 1549.190378 2 2.2924 993 | 1/15
40 h-m-p 1.6000 8.0000 0.0041 YC 1549.123658 1 3.8657 1026 | 1/15
41 h-m-p 1.4503 8.0000 0.0110 CC 1549.075972 1 2.1902 1060 | 1/15
42 h-m-p 1.6000 8.0000 0.0078 CC 1549.063586 1 2.4115 1094 | 1/15
43 h-m-p 1.6000 8.0000 0.0019 CC 1549.060096 1 1.8578 1128 | 1/15
44 h-m-p 1.6000 8.0000 0.0019 CC 1549.059273 1 1.9894 1162 | 1/15
45 h-m-p 1.6000 8.0000 0.0009 C 1549.059162 0 1.5940 1194 | 1/15
46 h-m-p 1.6000 8.0000 0.0001 +Y 1549.059097 0 4.9433 1227 | 1/15
47 h-m-p 1.6000 8.0000 0.0001 C 1549.059071 0 2.0130 1259 | 1/15
48 h-m-p 1.6000 8.0000 0.0000 C 1549.059066 0 1.8160 1291 | 1/15
49 h-m-p 1.6000 8.0000 0.0000 C 1549.059066 0 1.5922 1323 | 1/15
50 h-m-p 1.6000 8.0000 0.0000 Y 1549.059066 0 1.1570 1355 | 1/15
51 h-m-p 1.6000 8.0000 0.0000 C 1549.059066 0 1.6000 1387 | 1/15
52 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 1/15
53 h-m-p 0.0160 8.0000 0.0002 --------C 1549.059066 0 0.0000 1473
Out..
lnL = -1549.059066
1474 lfun, 1474 eigenQcodon, 19162 P(t)
Time used: 0:07
Model 1: NearlyNeutral
TREE # 1
(1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 168
0.066090 0.063946 0.022552 0.101580 0.069800 0.112444 0.057200 0.183212 0.150925 0.264332 0.011163 0.007290 0.003985 1.775528 0.700642 0.304419
ntime & nrate & np: 13 2 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 7.579555
np = 16
lnL0 = -1628.720983
Iterating by ming2
Initial: fx= 1628.720983
x= 0.06609 0.06395 0.02255 0.10158 0.06980 0.11244 0.05720 0.18321 0.15092 0.26433 0.01116 0.00729 0.00398 1.77553 0.70064 0.30442
1 h-m-p 0.0000 0.0002 267.1064 +++ 1618.306477 m 0.0002 22 | 0/16
2 h-m-p 0.0000 0.0003 1297.8512 ++ 1549.336550 m 0.0003 41 | 0/16
3 h-m-p 0.0001 0.0005 183.1529 +YCCC 1545.714840 3 0.0003 66 | 0/16
4 h-m-p 0.0000 0.0001 116.1978 ++ 1545.084932 m 0.0001 85 | 1/16
5 h-m-p 0.0002 0.0009 51.6435 +YYYYCYCCC 1543.321809 8 0.0007 116 | 1/16
6 h-m-p 0.0005 0.0032 71.0388 YCC 1542.109614 2 0.0009 138 | 1/16
7 h-m-p 0.0016 0.0110 39.8053 YCCC 1541.662623 3 0.0009 162 | 1/16
8 h-m-p 0.0017 0.0132 20.7955 CCC 1541.168583 2 0.0024 185 | 1/16
9 h-m-p 0.0035 0.0176 9.7991 CCCC 1540.475727 3 0.0054 210 | 1/16
10 h-m-p 0.0023 0.0115 13.3478 +YCCC 1538.331840 3 0.0066 235 | 1/16
11 h-m-p 0.0009 0.0047 45.1923 YCCCCC 1536.410196 5 0.0019 263 | 1/16
12 h-m-p 0.0024 0.0122 16.0014 CCC 1536.111431 2 0.0021 286 | 1/16
13 h-m-p 0.0077 0.0392 4.3936 CC 1536.081113 1 0.0025 307 | 1/16
14 h-m-p 0.0017 0.0669 6.6907 CC 1536.045448 1 0.0022 328 | 1/16
15 h-m-p 0.0047 0.6717 3.2063 +YCC 1535.933693 2 0.0137 351 | 1/16
16 h-m-p 0.0029 0.0695 15.2042 +CCCC 1535.337847 3 0.0134 377 | 1/16
17 h-m-p 0.0065 0.0323 31.4337 YC 1535.094630 1 0.0027 397 | 1/16
18 h-m-p 0.0829 0.5762 1.0393 YCCC 1534.250126 3 0.1926 421 | 1/16
19 h-m-p 1.0676 5.3380 0.0465 CC 1532.147797 1 1.3811 442 | 1/16
20 h-m-p 0.6119 3.0597 0.0496 YCCC 1530.615010 3 1.1594 481 | 1/16
21 h-m-p 0.2428 1.2138 0.0607 +YCYCC 1529.872109 4 0.7480 522 | 1/16
22 h-m-p 0.9920 5.7863 0.0458 CYC 1529.362570 2 0.9259 559 | 1/16
23 h-m-p 1.2317 8.0000 0.0344 YCC 1529.202435 2 0.8900 596 | 1/16
24 h-m-p 0.9876 6.8783 0.0310 CC 1529.151783 1 0.9239 632 | 1/16
25 h-m-p 1.6000 8.0000 0.0064 YC 1529.142241 1 1.0892 667 | 1/16
26 h-m-p 1.6000 8.0000 0.0021 YC 1529.141579 1 0.7056 702 | 1/16
27 h-m-p 0.7942 8.0000 0.0018 C 1529.141441 0 0.6928 736 | 1/16
28 h-m-p 1.6000 8.0000 0.0003 Y 1529.141434 0 0.9422 770 | 1/16
29 h-m-p 1.6000 8.0000 0.0000 Y 1529.141433 0 0.8611 804 | 1/16
30 h-m-p 1.6000 8.0000 0.0000 Y 1529.141433 0 0.9150 838 | 1/16
31 h-m-p 1.6000 8.0000 0.0000 Y 1529.141433 0 1.0258 872 | 1/16
32 h-m-p 1.6000 8.0000 0.0000 ---Y 1529.141433 0 0.0063 909
Out..
lnL = -1529.141433
910 lfun, 2730 eigenQcodon, 23660 P(t)
Time used: 0:15
Model 2: PositiveSelection
TREE # 1
(1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 168
initial w for M2:NSpselection reset.
0.066090 0.063946 0.022552 0.101580 0.069800 0.112444 0.057200 0.183212 0.150925 0.264332 0.011163 0.007290 0.003985 1.782985 0.878998 0.263736 0.186073 2.329016
ntime & nrate & np: 13 3 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.163272
np = 18
lnL0 = -1652.867921
Iterating by ming2
Initial: fx= 1652.867921
x= 0.06609 0.06395 0.02255 0.10158 0.06980 0.11244 0.05720 0.18321 0.15092 0.26433 0.01116 0.00729 0.00398 1.78298 0.87900 0.26374 0.18607 2.32902
1 h-m-p 0.0000 0.0006 279.4231 +++ 1630.958402 m 0.0006 24 | 0/18
2 h-m-p 0.0001 0.0003 567.7286 ++ 1601.939784 m 0.0003 45 | 1/18
3 h-m-p 0.0002 0.0010 450.0827 ++ 1579.522124 m 0.0010 66 | 2/18
4 h-m-p 0.0001 0.0006 96.1026 ++ 1576.064228 m 0.0006 87 | 2/18
5 h-m-p 0.0000 0.0000 1559.0638 YCCCC 1573.893239 4 0.0000 115 | 2/18
6 h-m-p 0.0005 0.0073 72.3069 +YCYCCC 1559.977898 5 0.0054 146 | 1/18
7 h-m-p 0.0010 0.0049 196.7730 YYCYCCC 1559.000516 6 0.0001 176 | 1/18
8 h-m-p 0.0001 0.0029 205.9823 ++YYCCC 1552.588178 4 0.0014 205 | 1/18
9 h-m-p 0.0007 0.0037 150.4613 +YCCCC 1546.763816 4 0.0020 234 | 1/18
10 h-m-p 0.0013 0.0065 135.1821 YCC 1541.813635 2 0.0026 258 | 1/18
11 h-m-p 0.0011 0.0055 119.3919 YCCC 1537.113321 3 0.0027 284 | 1/18
12 h-m-p 0.0021 0.0105 25.3643 YYYC 1536.660941 3 0.0020 308 | 1/18
13 h-m-p 0.0045 0.0227 9.4568 YYC 1536.506546 2 0.0039 331 | 1/18
14 h-m-p 0.0053 0.1129 6.9702 +YCCC 1536.199867 3 0.0148 358 | 1/18
15 h-m-p 0.0030 0.0149 25.4400 YCYCCC 1535.643664 5 0.0072 387 | 1/18
16 h-m-p 0.0011 0.0053 53.4375 YCYCCC 1535.204785 5 0.0027 416 | 1/18
17 h-m-p 0.0210 0.1775 6.7394 CCCC 1534.796480 3 0.0267 443 | 1/18
18 h-m-p 0.0039 0.0533 45.6901 +YYYYC 1533.046726 4 0.0155 469 | 1/18
19 h-m-p 0.4822 2.4110 1.1356 YCC 1532.123461 2 0.3463 493 | 1/18
20 h-m-p 0.1395 0.6977 1.9689 CYC 1531.511271 2 0.1703 517 | 1/18
21 h-m-p 0.2371 1.1853 0.3274 +YYCCC 1530.542338 4 0.7550 545 | 1/18
22 h-m-p 0.6378 5.4161 0.3876 CCCC 1529.980712 3 0.4959 589 | 1/18
23 h-m-p 0.4929 8.0000 0.3899 YC 1529.749806 1 1.1396 628 | 1/18
24 h-m-p 0.8669 8.0000 0.5125 CCCC 1529.536002 3 1.2077 672 | 1/18
25 h-m-p 1.2738 8.0000 0.4860 CCC 1529.395278 2 0.9386 714 | 1/18
26 h-m-p 1.2350 8.0000 0.3693 CCC 1529.288855 2 1.3335 756 | 1/18
27 h-m-p 1.0045 8.0000 0.4903 CCC 1529.217941 2 1.2543 798 | 1/18
28 h-m-p 1.5051 8.0000 0.4086 CC 1529.179363 1 1.7959 838 | 1/18
29 h-m-p 1.6000 8.0000 0.3378 CCC 1529.162385 2 1.3197 880 | 1/18
30 h-m-p 1.0592 8.0000 0.4208 C 1529.154818 0 1.0592 918 | 1/18
31 h-m-p 1.6000 8.0000 0.2583 YC 1529.151956 1 1.1893 957 | 1/18
32 h-m-p 1.3281 8.0000 0.2313 CC 1529.150071 1 1.9080 997 | 1/18
33 h-m-p 1.4951 8.0000 0.2952 CYC 1529.147782 2 1.9851 1038 | 1/18
34 h-m-p 1.2714 8.0000 0.4609 CC 1529.145605 1 1.8639 1078 | 1/18
35 h-m-p 1.6000 8.0000 0.4969 C 1529.144777 0 1.4725 1116 | 1/18
36 h-m-p 1.1027 8.0000 0.6635 YC 1529.143548 1 2.4836 1155 | 1/18
37 h-m-p 1.3494 8.0000 1.2212 CC 1529.142386 1 1.7140 1195 | 1/18
38 h-m-p 1.6000 8.0000 0.8074 YC 1529.141846 1 1.2150 1217 | 1/18
39 h-m-p 0.9770 8.0000 1.0041 YC 1529.141617 1 1.7885 1256 | 1/18
40 h-m-p 1.6000 8.0000 0.2216 Y 1529.141552 0 1.2167 1277 | 1/18
41 h-m-p 0.3567 8.0000 0.7559 +Y 1529.141500 0 2.6183 1316 | 1/18
42 h-m-p 1.6000 8.0000 0.5040 C 1529.141457 0 1.7366 1354 | 1/18
43 h-m-p 1.4693 8.0000 0.5957 Y 1529.141444 0 2.8509 1392 | 1/18
44 h-m-p 1.6000 8.0000 0.5986 C 1529.141438 0 1.8241 1430 | 1/18
45 h-m-p 1.6000 8.0000 0.5879 C 1529.141435 0 2.3227 1468 | 1/18
46 h-m-p 1.6000 8.0000 0.6409 C 1529.141434 0 1.9854 1506 | 1/18
47 h-m-p 1.6000 8.0000 0.6201 C 1529.141434 0 2.4705 1544 | 1/18
48 h-m-p 1.6000 8.0000 0.7043 C 1529.141434 0 2.4675 1582 | 1/18
49 h-m-p 1.6000 8.0000 1.0147 Y 1529.141433 0 2.6199 1620 | 1/18
50 h-m-p 1.0013 8.0000 2.6551 -----Y 1529.141433 0 0.0002 1646 | 1/18
51 h-m-p 0.0160 8.0000 0.2024 ++C 1529.141433 0 0.2282 1669 | 1/18
52 h-m-p 1.6000 8.0000 0.0000 Y 1529.141433 0 0.8199 1707 | 1/18
53 h-m-p 1.0773 8.0000 0.0000 C 1529.141433 0 1.1263 1745 | 1/18
54 h-m-p 1.3191 8.0000 0.0000 C 1529.141433 0 1.3191 1783 | 1/18
55 h-m-p 1.6000 8.0000 0.0000 C 1529.141433 0 1.6000 1821 | 1/18
56 h-m-p 1.6000 8.0000 0.0000 -C 1529.141433 0 0.1000 1860 | 1/18
57 h-m-p 0.0469 8.0000 0.0000 ------C 1529.141433 0 0.0000 1904
Out..
lnL = -1529.141433
1905 lfun, 7620 eigenQcodon, 74295 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1542.208727 S = -1476.458935 -57.261514
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 122 patterns 0:42
did 20 / 122 patterns 0:42
did 30 / 122 patterns 0:42
did 40 / 122 patterns 0:42
did 50 / 122 patterns 0:42
did 60 / 122 patterns 0:42
did 70 / 122 patterns 0:42
did 80 / 122 patterns 0:42
did 90 / 122 patterns 0:42
did 100 / 122 patterns 0:42
did 110 / 122 patterns 0:42
did 120 / 122 patterns 0:42
did 122 / 122 patterns 0:42
Time used: 0:42
Model 3: discrete
TREE # 1
(1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 168
0.066090 0.063946 0.022552 0.101580 0.069800 0.112444 0.057200 0.183212 0.150925 0.264332 0.011163 0.007290 0.003985 1.782985 0.062503 0.014820 0.028308 0.066095 0.113410
ntime & nrate & np: 13 4 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 18.221222
np = 19
lnL0 = -1551.102389
Iterating by ming2
Initial: fx= 1551.102389
x= 0.06609 0.06395 0.02255 0.10158 0.06980 0.11244 0.05720 0.18321 0.15092 0.26433 0.01116 0.00729 0.00398 1.78299 0.06250 0.01482 0.02831 0.06610 0.11341
1 h-m-p 0.0000 0.0001 209.6923 ++ 1546.527420 m 0.0001 24 | 1/19
2 h-m-p 0.0000 0.0000 1230.1982 ++ 1543.324278 m 0.0000 46 | 2/19
3 h-m-p 0.0000 0.0001 464.6105 +YYYCCC 1542.087614 5 0.0000 76 | 2/19
4 h-m-p 0.0000 0.0001 1025.6529 ++ 1535.077278 m 0.0001 98 | 3/19
5 h-m-p 0.0005 0.0027 43.7361 YC 1533.452653 1 0.0011 121 | 3/19
6 h-m-p 0.0009 0.0045 30.3545 CYCC 1532.354943 3 0.0012 148 | 3/19
7 h-m-p 0.0010 0.0051 21.0553 YYC 1532.106854 2 0.0009 172 | 3/19
8 h-m-p 0.0015 0.0139 12.3647 YCC 1532.052020 2 0.0009 197 | 3/19
9 h-m-p 0.0014 0.0510 8.0557 +CCC 1531.911727 2 0.0059 224 | 3/19
10 h-m-p 0.0010 0.0061 45.7674 YCCC 1531.578688 3 0.0026 251 | 3/19
11 h-m-p 0.0019 0.0228 62.8802 +CYC 1530.416176 2 0.0072 277 | 3/19
12 h-m-p 0.0030 0.0151 121.0218 YCCC 1529.842940 3 0.0021 304 | 3/19
13 h-m-p 0.0030 0.0151 19.4442 YCC 1529.752354 2 0.0021 329 | 3/19
14 h-m-p 0.0053 0.0425 7.6113 CC 1529.736531 1 0.0012 353 | 2/19
15 h-m-p 0.0009 0.0808 10.0226 -YC 1529.732582 1 0.0001 377 | 2/19
16 h-m-p 0.0015 0.7449 2.2672 ++YCCC 1529.617427 3 0.0507 406 | 2/19
17 h-m-p 0.0026 0.0382 44.4914 +YYCC 1529.207885 3 0.0092 433 | 2/19
18 h-m-p 0.2485 1.2427 0.7660 -CC 1529.199998 1 0.0147 458 | 1/19
19 h-m-p 0.0019 0.5525 5.9858 CCC 1529.192655 2 0.0004 501 | 1/19
20 h-m-p 0.0015 0.7429 2.7191 ++YCCC 1529.089501 3 0.0494 530 | 1/19
21 h-m-p 0.6934 3.4672 0.1402 CCC 1528.536727 2 0.8852 556 | 1/19
22 h-m-p 0.6616 3.3078 0.1774 +CCC 1528.191168 2 2.4158 601 | 1/19
23 h-m-p 0.0671 0.3357 0.1931 ++ 1528.146953 m 0.3357 641 | 2/19
24 h-m-p 0.2379 8.0000 0.2726 +CCC 1528.027998 2 0.9665 686 | 2/19
25 h-m-p 1.6000 8.0000 0.0235 YCC 1528.013981 2 1.2265 728 | 2/19
26 h-m-p 0.8376 8.0000 0.0344 CC 1527.997876 1 1.2299 769 | 2/19
27 h-m-p 0.7319 8.0000 0.0579 CC 1527.994789 1 0.9076 810 | 2/19
28 h-m-p 1.6000 8.0000 0.0070 CC 1527.993499 1 1.3616 851 | 2/19
29 h-m-p 1.6000 8.0000 0.0043 C 1527.993105 0 1.7165 890 | 2/19
30 h-m-p 1.6000 8.0000 0.0003 Y 1527.993028 0 2.6621 929 | 2/19
31 h-m-p 1.1758 8.0000 0.0006 C 1527.993014 0 1.7309 968 | 2/19
32 h-m-p 0.8225 8.0000 0.0012 ++ 1527.992963 m 8.0000 1007 | 2/19
33 h-m-p 0.1205 8.0000 0.0796 ++YC 1527.992462 1 1.9532 1049 | 2/19
34 h-m-p 1.1641 8.0000 0.1336 CYC 1527.991562 2 1.6744 1091 | 2/19
35 h-m-p 0.5716 8.0000 0.3912 YYC 1527.990846 2 0.3844 1132 | 2/19
36 h-m-p 1.0954 8.0000 0.1373 CCC 1527.987277 2 1.5711 1175 | 2/19
37 h-m-p 1.6000 8.0000 0.1043 C 1527.986520 0 0.4582 1214 | 2/19
38 h-m-p 0.4644 8.0000 0.1029 +YCCCC 1527.983003 4 2.6577 1261 | 2/19
39 h-m-p 1.6000 8.0000 0.1294 YYYC 1527.978815 3 1.6100 1303 | 1/19
40 h-m-p 0.0195 2.0328 10.6570 --C 1527.978772 0 0.0005 1344 | 1/19
41 h-m-p 0.0108 0.0541 0.0677 ++ 1527.977767 m 0.0541 1366 | 2/19
42 h-m-p 0.0163 8.0000 0.2242 ++YYC 1527.972249 2 0.3634 1410 | 2/19
43 h-m-p 0.1152 8.0000 0.7077 +YYCC 1527.963202 3 0.3527 1454 | 2/19
44 h-m-p 1.3221 8.0000 0.1888 CCC 1527.961005 2 0.4914 1497 | 1/19
45 h-m-p 0.0013 0.6279 93.4184 C 1527.960752 0 0.0003 1536 | 1/19
46 h-m-p 0.0966 0.4829 0.0173 ++ 1527.955512 m 0.4829 1558 | 2/19
47 h-m-p 0.1889 8.0000 0.0441 +YCC 1527.947771 2 1.2622 1602 | 2/19
48 h-m-p 0.1254 8.0000 0.4443 +YYCC 1527.936988 3 0.4403 1646 | 2/19
49 h-m-p 1.2407 8.0000 0.1577 YCYC 1527.929770 3 0.7823 1689 | 1/19
50 h-m-p 0.0002 0.0672 504.2252 YC 1527.925367 1 0.0002 1729 | 1/19
51 h-m-p 0.2429 1.2146 0.0403 ++ 1527.905468 m 1.2146 1751 | 2/19
52 h-m-p 0.6469 8.0000 0.0757 +YCYC 1527.885174 3 1.4920 1796 | 2/19
53 h-m-p 0.1279 8.0000 0.8832 CYCCC 1527.859208 4 0.2152 1842 | 2/19
54 h-m-p 1.2119 8.0000 0.1568 YYC 1527.829954 2 0.9497 1883 | 1/19
55 h-m-p 0.0001 0.0155 1280.2185 CCC 1527.804388 2 0.0001 1926 | 1/19
56 h-m-p 0.5382 2.6911 0.1262 YC 1527.769399 1 0.9327 1949 | 1/19
57 h-m-p 0.4425 2.2127 0.0635 ++ 1527.709696 m 2.2127 1989 | 2/19
58 h-m-p 0.0007 0.0468 197.0382 +YCCCCC 1527.497101 5 0.0033 2039 | 2/19
59 h-m-p 1.2802 8.0000 0.5040 CYCCC 1527.199698 4 1.9584 2068 | 1/19
60 h-m-p 0.0000 0.0005 29546.5860 CYC 1526.895524 2 0.0000 2110 | 1/19
61 h-m-p 1.6000 8.0000 0.2907 YCCC 1526.672279 3 0.8214 2137 | 1/19
62 h-m-p 0.4118 2.0588 0.5398 +YCCC 1526.435989 3 1.1693 2183 | 1/19
63 h-m-p 0.3052 1.5262 0.0874 ++ 1526.379287 m 1.5262 2223 | 2/19
64 h-m-p 1.3544 8.0000 0.0985 YC 1526.372043 1 0.9075 2264 | 2/19
65 h-m-p 0.7775 8.0000 0.1150 YC 1526.369625 1 0.3527 2304 | 2/19
66 h-m-p 1.5098 8.0000 0.0269 C 1526.368530 0 1.4315 2343 | 2/19
67 h-m-p 1.6000 8.0000 0.0052 ++ 1526.364226 m 8.0000 2382 | 2/19
68 h-m-p 1.5259 8.0000 0.0274 C 1526.362963 0 1.4520 2421 | 2/19
69 h-m-p 1.6000 8.0000 0.0021 +C 1526.362274 0 5.7868 2461 | 2/19
70 h-m-p 1.6000 8.0000 0.0044 ++ 1526.355401 m 8.0000 2500 | 2/19
71 h-m-p 0.2251 8.0000 0.1573 +CCC 1526.342559 2 1.1974 2544 | 2/19
72 h-m-p 1.6000 8.0000 0.0176 YC 1526.342171 1 1.2237 2584 | 2/19
73 h-m-p 1.6000 8.0000 0.0023 Y 1526.342164 0 1.0475 2623 | 2/19
74 h-m-p 1.6000 8.0000 0.0002 Y 1526.342164 0 1.0217 2662 | 2/19
75 h-m-p 1.6000 8.0000 0.0000 Y 1526.342164 0 1.2277 2701 | 2/19
76 h-m-p 1.6000 8.0000 0.0000 C 1526.342164 0 0.3955 2740 | 2/19
77 h-m-p 0.6195 8.0000 0.0000 -C 1526.342164 0 0.0387 2780
Out..
lnL = -1526.342164
2781 lfun, 11124 eigenQcodon, 108459 P(t)
Time used: 1:19
Model 7: beta
TREE # 1
(1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 168
0.066090 0.063946 0.022552 0.101580 0.069800 0.112444 0.057200 0.183212 0.150925 0.264332 0.011163 0.007290 0.003985 1.764069 0.942968 1.067294
ntime & nrate & np: 13 1 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 8.067758
np = 16
lnL0 = -1620.560728
Iterating by ming2
Initial: fx= 1620.560728
x= 0.06609 0.06395 0.02255 0.10158 0.06980 0.11244 0.05720 0.18321 0.15092 0.26433 0.01116 0.00729 0.00398 1.76407 0.94297 1.06729
1 h-m-p 0.0000 0.0002 188.6923 +++ 1617.615071 m 0.0002 22 | 0/16
2 h-m-p 0.0001 0.0005 223.2878 ++ 1611.101029 m 0.0005 41 | 0/16
3 h-m-p 0.0003 0.0042 328.4197 YYCCCCC 1608.907235 6 0.0003 70 | 0/16
4 h-m-p 0.0001 0.0006 396.9035 ++ 1592.994938 m 0.0006 89 | 0/16
5 h-m-p 0.0000 0.0001 4297.5651 ++ 1560.953811 m 0.0001 108 | 0/16
6 h-m-p 0.0000 0.0002 1372.6975 YCYCCCC 1553.404142 6 0.0001 137 | 0/16
7 h-m-p 0.0009 0.0046 44.3956 +YCCC 1550.569537 3 0.0029 162 | 0/16
8 h-m-p 0.0001 0.0006 161.0245 +YC 1549.557855 1 0.0004 183 | 0/16
9 h-m-p 0.0016 0.0128 36.7125 CCC 1548.458111 2 0.0024 206 | 0/16
10 h-m-p 0.0027 0.0154 33.7207 CCYC 1547.572193 3 0.0026 230 | 0/16
11 h-m-p 0.0055 0.0642 16.1052 YCCC 1546.559088 3 0.0092 254 | 0/16
12 h-m-p 0.0039 0.0210 38.2380 YCY 1546.064439 2 0.0021 276 | 0/16
13 h-m-p 0.0073 0.0522 11.1524 YCC 1545.796300 2 0.0049 298 | 0/16
14 h-m-p 0.0078 0.0392 6.0029 YCCC 1545.667861 3 0.0042 322 | 0/16
15 h-m-p 0.0146 0.2045 1.7163 +YCYCCC 1540.301407 5 0.1345 350 | 0/16
16 h-m-p 0.0005 0.0025 30.4776 ++ 1537.776397 m 0.0025 369 | 1/16
17 h-m-p 0.0292 0.2927 2.5560 +CYCCCC 1531.875649 5 0.1746 399 | 1/16
18 h-m-p 0.2655 1.3274 0.9290 CCCC 1530.753359 3 0.2977 424 | 1/16
19 h-m-p 0.1951 1.1244 1.4179 YYC 1530.222530 2 0.1609 460 | 1/16
20 h-m-p 1.6000 8.0000 0.1105 CCC 1529.885229 2 1.4390 483 | 1/16
21 h-m-p 0.5943 7.5451 0.2675 +YYYYY 1528.982817 4 2.3288 522 | 1/16
22 h-m-p 0.3156 1.5780 0.8725 CYCYC 1528.265291 4 0.5911 562 | 1/16
23 h-m-p 0.4637 2.3183 0.1781 YYYCC 1527.884633 4 0.4470 601 | 1/16
24 h-m-p 0.6803 8.0000 0.1171 CCC 1527.820290 2 0.6392 639 | 1/16
25 h-m-p 1.6000 8.0000 0.0386 YC 1527.805702 1 0.9200 674 | 1/16
26 h-m-p 1.6000 8.0000 0.0190 YC 1527.799910 1 0.9231 709 | 1/16
27 h-m-p 1.6000 8.0000 0.0067 CC 1527.791810 1 1.8454 745 | 1/16
28 h-m-p 1.6000 8.0000 0.0071 C 1527.784410 0 1.5643 779 | 1/16
29 h-m-p 1.6000 8.0000 0.0064 YC 1527.777865 1 1.0753 814 | 1/16
30 h-m-p 1.4325 8.0000 0.0048 +YC 1527.767995 1 4.4917 850 | 1/16
31 h-m-p 1.6000 8.0000 0.0080 CC 1527.756046 1 2.3513 886 | 1/16
32 h-m-p 1.6000 8.0000 0.0086 CC 1527.743495 1 1.9527 922 | 1/16
33 h-m-p 1.6000 8.0000 0.0046 CC 1527.734816 1 1.4013 958 | 1/16
34 h-m-p 1.6000 8.0000 0.0015 YC 1527.734599 1 1.0475 993 | 1/16
35 h-m-p 1.6000 8.0000 0.0005 Y 1527.734591 0 1.0187 1027 | 1/16
36 h-m-p 1.6000 8.0000 0.0001 Y 1527.734591 0 1.0082 1061 | 1/16
37 h-m-p 1.6000 8.0000 0.0000 Y 1527.734591 0 1.2228 1095 | 1/16
38 h-m-p 1.6000 8.0000 0.0000 --Y 1527.734591 0 0.0250 1131
Out..
lnL = -1527.734591
1132 lfun, 12452 eigenQcodon, 147160 P(t)
Time used: 2:10
Model 8: beta&w>1
TREE # 1
(1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 168
initial w for M8:NSbetaw>1 reset.
0.066090 0.063946 0.022552 0.101580 0.069800 0.112444 0.057200 0.183212 0.150925 0.264332 0.011163 0.007290 0.003985 1.763258 0.900000 1.091300 1.180709 2.396835
ntime & nrate & np: 13 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.285871
np = 18
lnL0 = -1638.041132
Iterating by ming2
Initial: fx= 1638.041132
x= 0.06609 0.06395 0.02255 0.10158 0.06980 0.11244 0.05720 0.18321 0.15092 0.26433 0.01116 0.00729 0.00398 1.76326 0.90000 1.09130 1.18071 2.39683
1 h-m-p 0.0000 0.0003 274.3733 +++ 1626.237329 m 0.0003 24 | 0/18
2 h-m-p 0.0000 0.0002 366.4345 ++ 1619.197759 m 0.0002 45 | 0/18
3 h-m-p 0.0000 0.0000 231.8940
h-m-p: 0.00000000e+00 0.00000000e+00 2.31893952e+02 1619.197759
.. | 0/18
4 h-m-p 0.0000 0.0002 192.1518 ++YCCC 1617.456387 3 0.0001 91 | 0/18
5 h-m-p 0.0000 0.0001 148.8788 ++ 1616.801559 m 0.0001 112 | 0/18
6 h-m-p -0.0000 -0.0000 235.5081
h-m-p: -8.91722483e-22 -4.45861242e-21 2.35508089e+02 1616.801559
.. | 0/18
7 h-m-p 0.0000 0.0002 210.6839 +CYCC 1616.189291 3 0.0000 157 | 0/18
8 h-m-p 0.0000 0.0002 133.5138 +YYCYCC 1615.247503 5 0.0001 186 | 0/18
9 h-m-p 0.0000 0.0001 173.7629 ++ 1613.614692 m 0.0001 207 | 0/18
10 h-m-p 0.0000 0.0000 3168.2123 ++ 1604.666685 m 0.0000 228 | 0/18
11 h-m-p 0.0001 0.0006 1829.9803 +CYYCYYCCC 1533.343042 8 0.0005 263 | 0/18
12 h-m-p 0.0000 0.0000 203.4645 ++ 1532.864216 m 0.0000 284 | 1/18
13 h-m-p 0.0002 0.0028 38.6948 +CCC 1531.620755 2 0.0009 310 | 1/18
14 h-m-p 0.0025 0.0154 14.3784 YC 1531.525838 1 0.0010 332 | 1/18
15 h-m-p 0.0008 0.0158 19.4162 YC 1531.355165 1 0.0019 354 | 1/18
16 h-m-p 0.0012 0.0162 31.6142 CCC 1531.203158 2 0.0012 379 | 1/18
17 h-m-p 0.0021 0.0235 18.2812 +YCCC 1530.873648 3 0.0054 406 | 1/18
18 h-m-p 0.0021 0.0105 46.6679 YC 1530.712339 1 0.0011 428 | 1/18
19 h-m-p 0.0043 0.0244 12.2136 YCC 1530.614939 2 0.0030 452 | 1/18
20 h-m-p 0.0048 0.0458 7.6271 CC 1530.591154 1 0.0014 475 | 1/18
21 h-m-p 0.0052 0.6996 2.0168 +CYC 1530.455704 2 0.0211 500 | 1/18
22 h-m-p 0.0043 0.1115 9.9055 +YCCCC 1528.415794 4 0.0430 529 | 1/18
23 h-m-p 0.0069 0.0346 17.2408 CCC 1528.233673 2 0.0026 554 | 1/18
24 h-m-p 0.0187 1.0837 2.3964 +CCCC 1527.690958 3 0.1010 582 | 1/18
25 h-m-p 0.2916 1.4579 0.4919 +YCCC 1526.991743 3 0.7723 609 | 1/18
26 h-m-p 1.6000 8.0000 0.0953 CC 1526.856238 1 1.5509 649 | 1/18
27 h-m-p 1.6000 8.0000 0.0453 CCC 1526.819868 2 1.2552 691 | 1/18
28 h-m-p 0.4514 8.0000 0.1259 +CY 1526.786893 1 1.7708 732 | 1/18
29 h-m-p 1.6000 8.0000 0.0553 YC 1526.752267 1 3.0889 771 | 1/18
30 h-m-p 1.6000 8.0000 0.0748 CC 1526.723125 1 2.2153 811 | 1/18
31 h-m-p 1.6000 8.0000 0.0959 CCC 1526.689458 2 2.0947 853 | 1/18
32 h-m-p 1.6000 8.0000 0.0930 CCC 1526.654113 2 2.0137 895 | 1/18
33 h-m-p 1.6000 8.0000 0.0869 CC 1526.632323 1 1.6210 935 | 1/18
34 h-m-p 1.6000 8.0000 0.0407 YC 1526.625343 1 1.1315 974 | 1/18
35 h-m-p 0.7496 8.0000 0.0615 C 1526.624094 0 0.7456 1012 | 1/18
36 h-m-p 1.6000 8.0000 0.0235 YC 1526.623820 1 0.9298 1051 | 1/18
37 h-m-p 1.6000 8.0000 0.0023 Y 1526.623801 0 0.9071 1089 | 1/18
38 h-m-p 1.6000 8.0000 0.0012 Y 1526.623800 0 0.8693 1127 | 1/18
39 h-m-p 1.6000 8.0000 0.0000 Y 1526.623800 0 1.0719 1165 | 1/18
40 h-m-p 1.6000 8.0000 0.0000 Y 1526.623800 0 0.9131 1203 | 1/18
41 h-m-p 1.6000 8.0000 0.0000 C 1526.623800 0 1.2937 1241 | 1/18
42 h-m-p 1.6000 8.0000 0.0000 ---------Y 1526.623800 0 0.0000 1288
Out..
lnL = -1526.623800
1289 lfun, 15468 eigenQcodon, 184327 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1545.771310 S = -1477.457710 -60.408584
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 122 patterns 3:15
did 20 / 122 patterns 3:15
did 30 / 122 patterns 3:15
did 40 / 122 patterns 3:16
did 50 / 122 patterns 3:16
did 60 / 122 patterns 3:16
did 70 / 122 patterns 3:16
did 80 / 122 patterns 3:16
did 90 / 122 patterns 3:17
did 100 / 122 patterns 3:17
did 110 / 122 patterns 3:17
did 120 / 122 patterns 3:17
did 122 / 122 patterns 3:17
Time used: 3:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=8, Len=200
D_melanogaster_sisA-PA MERSHLYLPTLSYAAMGHVYAPYRGSSSPALSTASS---TSS-KPEQIEE
D_sechellia_sisA-PA MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSTASS---TSS-KPEQIEE
D_simulans_sisA-PA MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSTASS---TSS-KPEQIEE
D_yakuba_sisA-PA MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSAVSS---TSSSKPEQIEE
D_erecta_sisA-PA MERSHLYLPTLSYAAMGHVYAPYRGSSSPALSAASS---SSS-KPEQIEE
D_biarmipes_sisA-PA MERSHLYLPTLSYAAMGHLYAPYHGSSSPALSSASSSSASSSSRPEQIEE
D_suzukii_sisA-PA MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSSSSS---ASSSRPEQIEE
D_eugracilis_sisA-PA MERSHLYLPNLSYAAMGHVYAPYHGSSS----TASA---TSS-KPEHIEE
*********.********:****:**** : *: :** :**:***
D_melanogaster_sisA-PA LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRG
D_sechellia_sisA-PA LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRG
D_simulans_sisA-PA LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRG
D_yakuba_sisA-PA LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTEIAME-RG
D_erecta_sisA-PA LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAME-RA
D_biarmipes_sisA-PA LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKVEAEQ----
D_suzukii_sisA-PA LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAME---
D_eugracilis_sisA-PA LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPTLKTEIAVD---
**************************************.**.*
D_melanogaster_sisA-PA SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
D_sechellia_sisA-PA SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
D_simulans_sisA-PA SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
D_yakuba_sisA-PA SGSGSGSCSGSEVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
D_erecta_sisA-PA SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
D_biarmipes_sisA-PA ---GSGSGSGSDMKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
D_suzukii_sisA-PA QGSGSGSGSGSDMKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
D_eugracilis_sisA-PA TGSVSGSGSGSDIKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK
*** ***::*************************************
D_melanogaster_sisA-PA KSAVMLDTMRDVIAQAERQLLERGYPAATLERMRATFGLEMEQ-------
D_sechellia_sisA-PA KSAVMLDTMRDVIAQAEKQLLERGFPAATLERMRATFGLEMEQ-------
D_simulans_sisA-PA KSAVMLDTMRDVIAQAERQLLERGFPAATLERMRATFGLEMEQ-------
D_yakuba_sisA-PA KSAVMLDTMRDVIAQAERQLLERGFPAATLERMRATFGLEMEQ-------
D_erecta_sisA-PA KSAVMLDTMRDVIAQAERQLLERGLSAATLERMRATFGLEMEQo------
D_biarmipes_sisA-PA KSALMLDTMRDVIAQAERQLLERGFPADALERMRSTFGLGMEQooo----
D_suzukii_sisA-PA KSAVMLDTMRDVIAQAERQLLERGFPADALERMRTTFGLAMEQoo-----
D_eugracilis_sisA-PA KSAVMLDTMRDVIAQAERQLLERGFPAAAIERMRTTFGLEMEQooooooo
***:*************:****** .* ::****:**** ***
>D_melanogaster_sisA-PA ATGGAACGGAGTCATCTTTACTTGCCCACTCTGAGCTACGCGGCCATGGG TCACGTATACGCACCGTATCGCGGAAGCAGTTCACCCGCACTATCGACAG CATCGTCA---------ACATCATCG---AAGCCGGAGCAGATCGAGGAG CTGGTGTCCCAGCAGCTGCATCATCTCAAAATGCACTACGCCGACGAGGA GCAACGCTACGTAGACCAGATGCTCCTGGAGAATCCCATTGTTGTGGAGC GCCGTGCACCGCCGCCGCTGAAAACGGAGCTTGCTATGGATTGCCGCGGA TCGGGTTCCGGATCAGGTTCCGGTTCTGGTTCGGATGTCAAGGATGCCCA GCGTCAGAGGGCCGAGTCGTGCCGCAAATCCCGCTACAACAACAAGATCA AGAAGGCCAAGCTGCGCTTCCGGCACAAATTCGTCAGCGGGCAGCTGAAG AAGAGCGCCGTCATGTTGGACACGATGCGGGATGTGATTGCCCAGGCGGA GAGGCAGCTGCTCGAGCGGGGATATCCCGCCGCCACACTCGAGCGGATGC GGGCCACTTTCGGCCTGGAAATGGAGCAG--------------------- >D_sechellia_sisA-PA ATGGAACGGAGTCATCTTTATTTGCCCACCCTGAGCTACGCGGCCATGGG TCACGTATACGCACCGTATCACGGAAGCAGCTCACCCGCACTATCAACAG CATCGTCA---------ACATCATCG---AAGCCGGAGCAGATCGAGGAG CTGGTGTCCCAGCAGCTGCATCATCTCAAGATGCACTACGCCGACGAGGA GCAACGCTACGTGGACCAGATGCTCCTCGAGAATCCCATTGTTGTGGAGC GCCGTGCACCGCCGCCGCTGAAAACGGAGCTTGCCATGGATTGCCGCGGA TCGGGTTCCGGATCAGGTTCCGGTTCTGGTTCGGATGTCAAGGATGCCCA GCGCCAGAGGGCCGAGTCGTGCCGCAAATCCCGCTACAACAACAAGATCA AGAAGGCCAAGCTGCGCTTCCGGCACAAATTCGTCAGCGGGCAGCTGAAG AAGAGCGCCGTCATGTTGGACACGATGCGGGATGTGATTGCCCAGGCGGA GAAGCAGCTGCTCGAGCGGGGATTCCCCGCCGCCACCCTCGAGCGGATGC GGGCCACCTTCGGCCTGGAAATGGAGCAG--------------------- >D_simulans_sisA-PA ATGGAACGGAGTCATCTTTATTTGCCCACCCTGAGCTACGCGGCCATGGG TCACGTATACGCACCGTATCACGGAAGCAGCTCACCCGCACTATCAACAG CATCGTCA---------ACATCATCG---AAGCCGGAGCAGATCGAGGAG CTGGTGTCCCAGCAGCTGCATCATCTCAAGATGCACTACGCCGACGAGGA GCAACGCTACGTGGACCAGATGCTCCTCGAGAATCCCATTGTTGTGGAAC GCCGTGCACCGCCGCCGCTGAAAACGGAGCTTGCCATGGATTGCCGCGGA TCGGGTTCCGGATCAGGTTCCGGTTCTGGTTCGGATGTCAAGGATGCCCA GCGCCAGAGGGCCGAGTCGTGCCGCAAATCCCGCTACAACAACAAGATCA AGAAGGCCAAGCTGCGCTTCCGGCACAAATTCGTCAGCGGGCAGCTGAAG AAGAGCGCCGTCATGTTGGACACGATGCGGGATGTGATTGCCCAGGCGGA GAGGCAGCTGCTCGAGCGGGGATTCCCCGCCGCCACCCTCGAGCGGATGC GGGCCACCTTCGGCCTGGAAATGGAGCAG--------------------- >D_yakuba_sisA-PA ATGGAACGGAGTCATCTATACTTGCCTACCCTGAGCTATGCGGCCATGGG TCACGTATACGCCCCGTATCACGGGAGCAGCTCACCCGCTCTATCAGCAG TATCGTCA---------ACATCATCATCGAAGCCGGAGCAAATCGAGGAG CTGGTGTCCCAGCAGCTGCATCATCTCAAGATGCACTACGCCGACGAGGA GCAACGCTATGTGGACCAGATGCTCCTGGAGAATCCCATTGTTGTGGAGC GCCGTGCACCGCCGCCGCTGAAAACGGAGATCGCCATGGAA---CGGGGA TCGGGTTCCGGATCAGGTTCCTGCTCTGGATCGGAGGTGAAGGATGCCCA GCGCCAGAGGGCCGAGTCCTGCCGCAAGTCCCGCTACAACAACAAGATCA AGAAGGCCAAGCTGCGCTTCCGGCACAAATTCGTTAGCGGACAGCTGAAG AAGAGCGCCGTCATGTTGGACACGATGCGGGATGTGATAGCGCAGGCGGA GCGGCAGCTACTCGAGCGGGGATTCCCCGCCGCCACCCTAGAGCGCATGC GTGCCACCTTTGGCCTGGAAATGGAGCAG--------------------- >D_erecta_sisA-PA ATGGAACGGAGTCATCTTTACTTGCCCACCCTGAGCTACGCGGCCATGGG TCACGTATACGCGCCGTATCGCGGCAGCAGCTCACCCGCTCTATCAGCAG CTTCGTCG---------TCATCGTCG---AAGCCGGAGCAGATCGAGGAG CTGGTGTCCCAGCAGCTGCACCATCTCAAGATGCACTACGCCGACGAGGA GCAACGCTATGTGGACCAGATGCTCCTCGAGAATCCCATTGTTGTGGAGC GCCGCGCACCGCCGCCGCTGAAAACGGAGCTTGCCATGGAA---CGGGCA TCGGGTTCTGGATCAGGTTCCGGCTCTGGATCGGATGTGAAGGATGCACA GCGCCAGAGGGCCGAGTCCTGCCGCAAGTCCCGCTACAACAACAAGATCA AGAAGGCCAAGCTGCGCTTCCGGCACAAATTCGTCAGCGGGCAGCTGAAG AAGAGCGCCGTCATGTTGGACACGATGCGGGATGTGATCGCGCAGGCGGA GCGGCAGCTGCTCGAGCGGGGATTATCCGCCGCCACCCTCGAGCGCATGC GTGCCACCTTTGGCCTGGAAATGGAGCAG--------------------- >D_biarmipes_sisA-PA ATGGAACGGAGCCATCTTTATCTGCCCACTCTGAGCTACGCGGCCATGGG TCACCTATACGCCCCGTACCACGGCAGCAGCTCGCCCGCCCTATCATCAG CGTCGTCCTCCTCCGCATCGTCGTCCTCGAGGCCGGAACAGATCGAGGAG CTGGTGTCCCAGCAGCTGCACCACCTCAAGATGCACTACGCCGACGAGGA GCAGCGCTACGTGGACCAGATGCTGCTGGAGAATCCCATTGTGGTGGAGC GCCGGGCACCGCCGCCGCTGAAAGTAGAGGCGGAGCAA------------ ---------GGATCGGGATCCGGATCCGGTTCGGACATGAAGGATGCCCA GCGGCAGCGGGCCGAGTCCTGCCGCAAGTCGCGCTACAACAACAAGATCA AGAAGGCCAAGCTGCGCTTCCGGCACAAGTTCGTCAGCGGGCAGCTGAAG AAGAGCGCCCTGATGTTGGACACGATGCGGGATGTGATTGCGCAGGCGGA GCGGCAGCTCCTCGAGCGGGGCTTCCCCGCCGACGCGCTCGAGCGCATGC GCAGCACCTTCGGCCTGGGAATGGAGCAG--------------------- >D_suzukii_sisA-PA ATGGAACGGAGCCATCTTTATTTGCCCACTCTGAGCTACGCGGCCATGGG TCACGTATACGCCCCGTATCACGGAAGCAGCTCACCCGCATTGTCATCAT CATCCTCT---------GCATCGTCATCGAGGCCAGAACAGATCGAGGAG CTGGTGTCCCAGCAGTTGCACCATCTCAAGATGCACTACGCCGACGAGGA GCAGCGCTACGTGGACCAGATGCTGCTGGAGAATCCCATTGTTGTGGAAC GCCGAGCACCGCCACCGTTGAAAACAGAGTTGGCCATGGAA--------- CAGGGATCGGGTTCTGGATCAGGTTCCGGATCGGACATGAAGGATGCCCA ACGTCAGCGGGCCGAGTCCTGCCGCAAGTCCCGATACAACAACAAGATCA AGAAGGCCAAGCTGCGCTTCCGGCACAAGTTCGTCAGCGGTCAGCTGAAG AAGAGCGCCGTAATGTTGGACACGATGCGGGATGTGATTGCGCAGGCGGA GCGGCAGCTCCTCGAACGGGGATTCCCCGCCGACGCCCTCGAGCGCATGC GCACCACTTTCGGCTTGGCCATGGAACAG--------------------- >D_eugracilis_sisA-PA ATGGAACGGAGTCATCTGTATTTGCCTAACCTGAGCTACGCGGCCATGGG TCACGTATACGCCCCGTATCACGGAAGCAGTTCA------------ACCG CTTCGGCA---------ACATCATCG---AAACCCGAACATATCGAGGAG CTAGTGTCCCAGCAACTGCATCATCTCAAGATGCACTACGCCGACGAAGA GCAGCGCTACGTGGACCAGATGCTGCTGGAGAATCCCATTGTTGTGGAAC GCCGAGCACCGCCTACGCTGAAAACAGAGATTGCCGTTGAC--------- ACCGGATCAGTTTCTGGATCCGGTTCCGGATCGGACATCAAGGATGCACA GCGTCAGCGGGCAGAGTCATGCCGCAAGTCGCGGTACAACAACAAGATCA AGAAGGCCAAGCTGCGTTTCCGACACAAATTCGTCAGCGGACAGCTAAAG AAGAGCGCCGTTATGTTGGACACGATGCGGGATGTGATCGCGCAGGCGGA GAGGCAACTACTCGAACGGGGCTTTCCCGCCGCTGCTATCGAGCGCATGC GCACCACCTTCGGCCTGGAAATGGAGCAG---------------------
>D_melanogaster_sisA-PA MERSHLYLPTLSYAAMGHVYAPYRGSSSPALSTASS---TSS-KPEQIEE LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRG SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK KSAVMLDTMRDVIAQAERQLLERGYPAATLERMRATFGLEMEQ >D_sechellia_sisA-PA MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSTASS---TSS-KPEQIEE LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRG SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK KSAVMLDTMRDVIAQAEKQLLERGFPAATLERMRATFGLEMEQ >D_simulans_sisA-PA MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSTASS---TSS-KPEQIEE LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAMDCRG SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK KSAVMLDTMRDVIAQAERQLLERGFPAATLERMRATFGLEMEQ >D_yakuba_sisA-PA MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSAVSS---TSSSKPEQIEE LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTEIAME-RG SGSGSGSCSGSEVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK KSAVMLDTMRDVIAQAERQLLERGFPAATLERMRATFGLEMEQ >D_erecta_sisA-PA MERSHLYLPTLSYAAMGHVYAPYRGSSSPALSAASS---SSS-KPEQIEE LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAME-RA SGSGSGSGSGSDVKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK KSAVMLDTMRDVIAQAERQLLERGLSAATLERMRATFGLEMEQ >D_biarmipes_sisA-PA MERSHLYLPTLSYAAMGHLYAPYHGSSSPALSSASSSSASSSSRPEQIEE LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKVEAEQ---- ---GSGSGSGSDMKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK KSALMLDTMRDVIAQAERQLLERGFPADALERMRSTFGLGMEQ >D_suzukii_sisA-PA MERSHLYLPTLSYAAMGHVYAPYHGSSSPALSSSSS---ASSSRPEQIEE LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPPLKTELAME--- QGSGSGSGSGSDMKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK KSAVMLDTMRDVIAQAERQLLERGFPADALERMRTTFGLAMEQ >D_eugracilis_sisA-PA MERSHLYLPNLSYAAMGHVYAPYHGSSS----TASA---TSS-KPEHIEE LVSQQLHHLKMHYADEEQRYVDQMLLENPIVVERRAPPTLKTEIAVD--- TGSVSGSGSGSDIKDAQRQRAESCRKSRYNNKIKKAKLRFRHKFVSGQLK KSAVMLDTMRDVIAQAERQLLERGFPAAAIERMRTTFGLEMEQ
#NEXUS
[ID: 4570485281]
begin taxa;
dimensions ntax=8;
taxlabels
D_melanogaster_sisA-PA
D_sechellia_sisA-PA
D_simulans_sisA-PA
D_yakuba_sisA-PA
D_erecta_sisA-PA
D_biarmipes_sisA-PA
D_suzukii_sisA-PA
D_eugracilis_sisA-PA
;
end;
begin trees;
translate
1 D_melanogaster_sisA-PA,
2 D_sechellia_sisA-PA,
3 D_simulans_sisA-PA,
4 D_yakuba_sisA-PA,
5 D_erecta_sisA-PA,
6 D_biarmipes_sisA-PA,
7 D_suzukii_sisA-PA,
8 D_eugracilis_sisA-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.03930825,((4:0.0570335,5:0.05047887)0.574:0.01755618,((6:0.2072223,7:0.09472689)0.748:0.04823683,8:0.2391622)1.000:0.1282629)1.000:0.05131443,(2:0.004203277,3:0.004207026)0.589:0.004856868);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.03930825,((4:0.0570335,5:0.05047887):0.01755618,((6:0.2072223,7:0.09472689):0.04823683,8:0.2391622):0.1282629):0.05131443,(2:0.004203277,3:0.004207026):0.004856868);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1737.20 -1749.67
2 -1737.25 -1749.06
--------------------------------------
TOTAL -1737.22 -1749.41
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/392/sisA-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.974883 0.018990 0.730584 1.259222 0.963939 1237.42 1369.21 1.000
r(A<->C){all} 0.099225 0.001052 0.039730 0.164490 0.096083 766.85 768.33 1.000
r(A<->G){all} 0.227105 0.001991 0.136875 0.311234 0.224785 653.38 678.63 1.001
r(A<->T){all} 0.222824 0.003058 0.123912 0.332708 0.219796 743.96 762.23 1.001
r(C<->G){all} 0.041914 0.000228 0.016191 0.074489 0.040591 879.78 1047.09 1.001
r(C<->T){all} 0.347358 0.003564 0.233241 0.465493 0.344458 317.59 477.79 1.002
r(G<->T){all} 0.061574 0.000735 0.012014 0.113350 0.058505 675.95 846.20 1.000
pi(A){all} 0.226813 0.000254 0.195399 0.257554 0.226252 1252.18 1319.69 1.000
pi(C){all} 0.305857 0.000323 0.271720 0.342168 0.305104 1054.36 1165.88 1.000
pi(G){all} 0.304103 0.000329 0.268566 0.339939 0.303865 923.59 1067.70 1.000
pi(T){all} 0.163226 0.000193 0.136876 0.191399 0.162807 882.02 948.42 1.001
alpha{1,2} 0.153694 0.001078 0.098619 0.220248 0.149927 1175.40 1289.94 1.000
alpha{3} 2.175489 0.679605 0.787195 3.804765 2.036216 1350.46 1375.04 1.000
pinvar{all} 0.434473 0.004640 0.299847 0.562677 0.438950 833.40 1167.20 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/392/sisA-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 8 ls = 178
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 1 1 0 | Ser TCT 1 1 1 1 1 0 | Tyr TAT 2 2 2 3 2 1 | Cys TGT 0 0 0 0 0 0
TTC 3 4 4 3 2 4 | TCC 3 3 3 4 5 6 | TAC 6 5 5 4 5 6 | TGC 1 1 1 2 1 1
Leu TTA 0 0 0 0 1 0 | TCA 4 4 4 5 3 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 1 | TCG 4 4 4 2 5 7 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 0 2 1 | Pro CCT 0 0 0 1 0 0 | His CAT 3 3 3 3 2 1 | Arg CGT 2 1 1 2 1 0
CTC 4 5 5 3 5 4 | CCC 3 3 3 2 2 3 | CAC 3 4 4 4 4 6 | CGC 6 6 6 7 9 7
CTA 0 0 0 3 0 1 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 2 1 1 | CGA 0 0 0 0 0 0
CTG 9 8 8 8 8 11 | CCG 5 5 5 5 5 5 | CAG 10 10 10 9 10 11 | CGG 6 6 6 5 5 8
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 1 1 2 | Thr ACT 2 0 0 0 0 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 2 1 1 1 1 0
ATC 2 2 2 3 3 2 | ACC 0 3 3 3 3 1 | AAC 2 2 2 2 2 2 | AGC 4 5 5 5 5 7
ATA 0 0 0 1 0 0 | ACA 3 2 2 1 0 0 | Lys AAA 4 3 3 2 2 1 | Arg AGA 0 0 0 0 0 0
Met ATG 9 9 9 9 9 9 | ACG 2 2 2 2 2 1 | AAG 8 10 9 10 10 10 | AGG 2 1 2 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 2 1 0 | Ala GCT 1 0 0 0 1 0 | Asp GAT 3 3 3 2 3 2 | Gly GGT 4 4 4 2 2 2
GTC 3 3 3 1 2 1 | GCC 10 11 11 11 9 8 | GAC 3 3 3 3 3 5 | GGC 1 1 1 1 3 3
GTA 2 1 1 2 1 1 | GCA 3 3 3 2 3 1 | Glu GAA 2 2 3 2 2 2 | GGA 3 3 3 4 3 4
GTG 3 4 4 5 5 5 | GCG 2 2 2 3 4 6 | GAG 13 13 12 14 13 13 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------
Phe TTT 0 1 | Ser TCT 2 1 | Tyr TAT 2 2 | Cys TGT 0 0
TTC 4 3 | TCC 5 3 | TAC 5 5 | TGC 1 1
Leu TTA 0 0 | TCA 5 3 | *** TAA 0 0 | *** TGA 0 0
TTG 6 2 | TCG 2 4 | TAG 0 0 | Trp TGG 0 0
----------------------------------------------------------------------
Leu CTT 1 0 | Pro CCT 0 2 | His CAT 2 4 | Arg CGT 1 2
CTC 4 2 | CCC 3 3 | CAC 5 4 | CGC 6 5
CTA 0 3 | CCA 2 0 | Gln CAA 1 2 | CGA 2 2
CTG 6 8 | CCG 3 2 | CAG 10 8 | CGG 6 5
----------------------------------------------------------------------
Ile ATT 2 2 | Thr ACT 2 0 | Asn AAT 1 1 | Ser AGT 0 2
ATC 2 5 | ACC 1 3 | AAC 2 3 | AGC 6 4
ATA 0 0 | ACA 1 2 | Lys AAA 1 3 | Arg AGA 0 0
Met ATG 10 8 | ACG 1 2 | AAG 10 9 | AGG 1 1
----------------------------------------------------------------------
Val GTT 1 4 | Ala GCT 0 3 | Asp GAT 2 2 | Gly GGT 4 2
GTC 1 1 | GCC 11 7 | GAC 5 4 | GGC 1 2
GTA 2 1 | GCA 2 4 | Glu GAA 5 6 | GGA 4 4
GTG 4 4 | GCG 3 3 | GAG 9 9 | GGG 0 0
----------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_sisA-PA
position 1: T:0.14607 C:0.30337 A:0.24157 G:0.30899
position 2: T:0.23596 C:0.24157 A:0.34270 G:0.17978
position 3: T:0.14607 C:0.30337 A:0.12360 G:0.42697
Average T:0.17603 C:0.28277 A:0.23596 G:0.30524
#2: D_sechellia_sisA-PA
position 1: T:0.14607 C:0.30337 A:0.24157 G:0.30899
position 2: T:0.24157 C:0.24157 A:0.34831 G:0.16854
position 3: T:0.11798 C:0.34270 A:0.10674 G:0.43258
Average T:0.16854 C:0.29588 A:0.23221 G:0.30337
#3: D_simulans_sisA-PA
position 1: T:0.14607 C:0.30337 A:0.24157 G:0.30899
position 2: T:0.24157 C:0.24157 A:0.34270 G:0.17416
position 3: T:0.11798 C:0.34270 A:0.11236 G:0.42697
Average T:0.16854 C:0.29588 A:0.23221 G:0.30337
#4: D_yakuba_sisA-PA
position 1: T:0.15169 C:0.30337 A:0.23596 G:0.30899
position 2: T:0.24719 C:0.23596 A:0.34270 G:0.17416
position 3: T:0.11236 C:0.32584 A:0.13483 G:0.42697
Average T:0.17041 C:0.28839 A:0.23783 G:0.30337
#5: D_erecta_sisA-PA
position 1: T:0.15730 C:0.30337 A:0.22472 G:0.31461
position 2: T:0.24157 C:0.24157 A:0.33708 G:0.17978
position 3: T:0.10674 C:0.35393 A:0.08989 G:0.44944
Average T:0.16854 C:0.29963 A:0.21723 G:0.31461
#6: D_biarmipes_sisA-PA
position 1: T:0.15169 C:0.33146 A:0.21348 G:0.30337
position 2: T:0.23596 C:0.22472 A:0.34831 G:0.19101
position 3: T:0.06180 C:0.37079 A:0.06742 G:0.50000
Average T:0.14981 C:0.30899 A:0.20974 G:0.33146
#7: D_suzukii_sisA-PA
position 1: T:0.17978 C:0.29213 A:0.22472 G:0.30337
position 2: T:0.24157 C:0.24157 A:0.33708 G:0.17978
position 3: T:0.11236 C:0.34831 A:0.14045 G:0.39888
Average T:0.17790 C:0.29401 A:0.23408 G:0.29401
#8: D_eugracilis_sisA-PA
position 1: T:0.14045 C:0.29213 A:0.25281 G:0.31461
position 2: T:0.24719 C:0.23596 A:0.34831 G:0.16854
position 3: T:0.15730 C:0.30899 A:0.16854 G:0.36517
Average T:0.18165 C:0.27903 A:0.25655 G:0.28277
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 3 | Ser S TCT 8 | Tyr Y TAT 16 | Cys C TGT 0
TTC 27 | TCC 32 | TAC 41 | TGC 9
Leu L TTA 1 | TCA 29 | *** * TAA 0 | *** * TGA 0
TTG 19 | TCG 32 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 10 | Pro P CCT 3 | His H CAT 21 | Arg R CGT 10
CTC 32 | CCC 22 | CAC 34 | CGC 52
CTA 7 | CCA 2 | Gln Q CAA 10 | CGA 4
CTG 66 | CCG 35 | CAG 78 | CGG 47
------------------------------------------------------------------------------
Ile I ATT 14 | Thr T ACT 5 | Asn N AAT 8 | Ser S AGT 8
ATC 21 | ACC 17 | AAC 17 | AGC 41
ATA 1 | ACA 11 | Lys K AAA 19 | Arg R AGA 0
Met M ATG 72 | ACG 14 | AAG 76 | AGG 10
------------------------------------------------------------------------------
Val V GTT 11 | Ala A GCT 5 | Asp D GAT 20 | Gly G GGT 24
GTC 15 | GCC 78 | GAC 29 | GGC 13
GTA 11 | GCA 21 | Glu E GAA 24 | GGA 28
GTG 34 | GCG 25 | GAG 96 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15239 C:0.30407 A:0.23455 G:0.30899
position 2: T:0.24157 C:0.23806 A:0.34340 G:0.17697
position 3: T:0.11657 C:0.33708 A:0.11798 G:0.42837
Average T:0.17018 C:0.29307 A:0.23198 G:0.30478
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_sisA-PA
D_sechellia_sisA-PA 0.0823 (0.0074 0.0904)
D_simulans_sisA-PA 0.0500 (0.0050 0.0991) 0.3157 (0.0025 0.0078)
D_yakuba_sisA-PA 0.0561 (0.0175 0.3118) 0.0704 (0.0162 0.2303) 0.0506 (0.0124 0.2460)
D_erecta_sisA-PA 0.0470 (0.0125 0.2653) 0.0909 (0.0162 0.1785) 0.0645 (0.0125 0.1932) 0.1157 (0.0200 0.1732)
D_biarmipes_sisA-PA 0.1133 (0.0552 0.4871) 0.1259 (0.0537 0.4268) 0.1114 (0.0498 0.4469) 0.1201 (0.0573 0.4774) 0.1356 (0.0538 0.3970)
D_suzukii_sisA-PA 0.0617 (0.0328 0.5312) 0.0653 (0.0314 0.4818) 0.0583 (0.0276 0.4737) 0.0739 (0.0366 0.4954) 0.0713 (0.0341 0.4781) 0.0992 (0.0349 0.3521)
D_eugracilis_sisA-PA 0.0605 (0.0342 0.5650) 0.0586 (0.0315 0.5374) 0.0556 (0.0290 0.5210) 0.0679 (0.0380 0.5600) 0.0777 (0.0433 0.5572) 0.1088 (0.0601 0.5517) 0.0916 (0.0432 0.4710)
Model 0: one-ratio
TREE # 1: (1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 168
lnL(ntime: 13 np: 15): -1549.059066 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..13 13..6 13..7 12..8 9..14 14..2 14..3
0.079002 0.051797 0.046210 0.105251 0.083234 0.134535 0.110182 0.276765 0.110057 0.275366 0.000004 0.006621 0.005021 1.775528 0.056616
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.28404
(1: 0.079002, ((4: 0.105251, 5: 0.083234): 0.046210, ((6: 0.276765, 7: 0.110057): 0.110182, 8: 0.275366): 0.134535): 0.051797, (2: 0.006621, 3: 0.005021): 0.000004);
(D_melanogaster_sisA-PA: 0.079002, ((D_yakuba_sisA-PA: 0.105251, D_erecta_sisA-PA: 0.083234): 0.046210, ((D_biarmipes_sisA-PA: 0.276765, D_suzukii_sisA-PA: 0.110057): 0.110182, D_eugracilis_sisA-PA: 0.275366): 0.134535): 0.051797, (D_sechellia_sisA-PA: 0.006621, D_simulans_sisA-PA: 0.005021): 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.77553
omega (dN/dS) = 0.05662
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.079 428.3 105.7 0.0566 0.0061 0.1082 2.6 11.4
9..10 0.052 428.3 105.7 0.0566 0.0040 0.0709 1.7 7.5
10..11 0.046 428.3 105.7 0.0566 0.0036 0.0633 1.5 6.7
11..4 0.105 428.3 105.7 0.0566 0.0082 0.1442 3.5 15.2
11..5 0.083 428.3 105.7 0.0566 0.0065 0.1140 2.8 12.1
10..12 0.135 428.3 105.7 0.0566 0.0104 0.1843 4.5 19.5
12..13 0.110 428.3 105.7 0.0566 0.0085 0.1509 3.7 16.0
13..6 0.277 428.3 105.7 0.0566 0.0215 0.3791 9.2 40.1
13..7 0.110 428.3 105.7 0.0566 0.0085 0.1507 3.7 15.9
12..8 0.275 428.3 105.7 0.0566 0.0214 0.3772 9.1 39.9
9..14 0.000 428.3 105.7 0.0566 0.0000 0.0000 0.0 0.0
14..2 0.007 428.3 105.7 0.0566 0.0005 0.0091 0.2 1.0
14..3 0.005 428.3 105.7 0.0566 0.0004 0.0069 0.2 0.7
tree length for dN: 0.0996
tree length for dS: 1.7588
Time used: 0:07
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 168
lnL(ntime: 13 np: 16): -1529.141433 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..13 13..6 13..7 12..8 9..14 14..2 14..3
0.084763 0.057224 0.047003 0.111425 0.088584 0.150436 0.114465 0.297502 0.121368 0.301906 0.000004 0.006902 0.005474 1.782985 0.923114 0.022258
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.38706
(1: 0.084763, ((4: 0.111425, 5: 0.088584): 0.047003, ((6: 0.297502, 7: 0.121368): 0.114465, 8: 0.301906): 0.150436): 0.057224, (2: 0.006902, 3: 0.005474): 0.000004);
(D_melanogaster_sisA-PA: 0.084763, ((D_yakuba_sisA-PA: 0.111425, D_erecta_sisA-PA: 0.088584): 0.047003, ((D_biarmipes_sisA-PA: 0.297502, D_suzukii_sisA-PA: 0.121368): 0.114465, D_eugracilis_sisA-PA: 0.301906): 0.150436): 0.057224, (D_sechellia_sisA-PA: 0.006902, D_simulans_sisA-PA: 0.005474): 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.78298
dN/dS (w) for site classes (K=2)
p: 0.92311 0.07689
w: 0.02226 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.085 428.2 105.8 0.0974 0.0100 0.1023 4.3 10.8
9..10 0.057 428.2 105.8 0.0974 0.0067 0.0691 2.9 7.3
10..11 0.047 428.2 105.8 0.0974 0.0055 0.0567 2.4 6.0
11..4 0.111 428.2 105.8 0.0974 0.0131 0.1345 5.6 14.2
11..5 0.089 428.2 105.8 0.0974 0.0104 0.1069 4.5 11.3
10..12 0.150 428.2 105.8 0.0974 0.0177 0.1816 7.6 19.2
12..13 0.114 428.2 105.8 0.0974 0.0135 0.1381 5.8 14.6
13..6 0.298 428.2 105.8 0.0974 0.0350 0.3591 15.0 38.0
13..7 0.121 428.2 105.8 0.0974 0.0143 0.1465 6.1 15.5
12..8 0.302 428.2 105.8 0.0974 0.0355 0.3644 15.2 38.5
9..14 0.000 428.2 105.8 0.0974 0.0000 0.0000 0.0 0.0
14..2 0.007 428.2 105.8 0.0974 0.0008 0.0083 0.3 0.9
14..3 0.005 428.2 105.8 0.0974 0.0006 0.0066 0.3 0.7
Time used: 0:15
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 168
lnL(ntime: 13 np: 18): -1529.141433 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..13 13..6 13..7 12..8 9..14 14..2 14..3
0.084763 0.057224 0.047003 0.111425 0.088584 0.150436 0.114465 0.297502 0.121368 0.301906 0.000004 0.006902 0.005474 1.782985 0.923114 0.076886 0.022258 9.073917
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.38706
(1: 0.084763, ((4: 0.111425, 5: 0.088584): 0.047003, ((6: 0.297502, 7: 0.121368): 0.114465, 8: 0.301906): 0.150436): 0.057224, (2: 0.006902, 3: 0.005474): 0.000004);
(D_melanogaster_sisA-PA: 0.084763, ((D_yakuba_sisA-PA: 0.111425, D_erecta_sisA-PA: 0.088584): 0.047003, ((D_biarmipes_sisA-PA: 0.297502, D_suzukii_sisA-PA: 0.121368): 0.114465, D_eugracilis_sisA-PA: 0.301906): 0.150436): 0.057224, (D_sechellia_sisA-PA: 0.006902, D_simulans_sisA-PA: 0.005474): 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.78299
dN/dS (w) for site classes (K=3)
p: 0.92311 0.07689 0.00000
w: 0.02226 1.00000 9.07392
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.085 428.2 105.8 0.0974 0.0100 0.1023 4.3 10.8
9..10 0.057 428.2 105.8 0.0974 0.0067 0.0691 2.9 7.3
10..11 0.047 428.2 105.8 0.0974 0.0055 0.0567 2.4 6.0
11..4 0.111 428.2 105.8 0.0974 0.0131 0.1345 5.6 14.2
11..5 0.089 428.2 105.8 0.0974 0.0104 0.1069 4.5 11.3
10..12 0.150 428.2 105.8 0.0974 0.0177 0.1816 7.6 19.2
12..13 0.114 428.2 105.8 0.0974 0.0135 0.1381 5.8 14.6
13..6 0.298 428.2 105.8 0.0974 0.0350 0.3591 15.0 38.0
13..7 0.121 428.2 105.8 0.0974 0.0143 0.1465 6.1 15.5
12..8 0.302 428.2 105.8 0.0974 0.0355 0.3644 15.2 38.5
9..14 0.000 428.2 105.8 0.0974 0.0000 0.0000 0.0 0.0
14..2 0.007 428.2 105.8 0.0974 0.0008 0.0083 0.3 0.9
14..3 0.005 428.2 105.8 0.0974 0.0006 0.0066 0.3 0.7
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_sisA-PA)
Pr(w>1) post mean +- SE for w
29 T 0.526 1.664 +- 1.205
33 T 0.632 1.903 +- 1.230
86 L 0.805 2.324 +- 1.520
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.489 0.252 0.122 0.061 0.032 0.018 0.011 0.007 0.005 0.004
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005 0.995
sum of density on p0-p1 = 1.000000
Time used: 0:42
Model 3: discrete (3 categories)
TREE # 1: (1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 168
lnL(ntime: 13 np: 19): -1526.342164 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..13 13..6 13..7 12..8 9..14 14..2 14..3
0.086652 0.059042 0.048006 0.113935 0.091524 0.158364 0.112991 0.299919 0.120773 0.305132 0.000004 0.007089 0.005598 1.764069 0.778626 0.205189 0.000001 0.268987 2.281845
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.40903
(1: 0.086652, ((4: 0.113935, 5: 0.091524): 0.048006, ((6: 0.299919, 7: 0.120773): 0.112991, 8: 0.305132): 0.158364): 0.059042, (2: 0.007089, 3: 0.005598): 0.000004);
(D_melanogaster_sisA-PA: 0.086652, ((D_yakuba_sisA-PA: 0.113935, D_erecta_sisA-PA: 0.091524): 0.048006, ((D_biarmipes_sisA-PA: 0.299919, D_suzukii_sisA-PA: 0.120773): 0.112991, D_eugracilis_sisA-PA: 0.305132): 0.158364): 0.059042, (D_sechellia_sisA-PA: 0.007089, D_simulans_sisA-PA: 0.005598): 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.76407
dN/dS (w) for site classes (K=3)
p: 0.77863 0.20519 0.01619
w: 0.00000 0.26899 2.28184
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.087 428.4 105.6 0.0921 0.0098 0.1063 4.2 11.2
9..10 0.059 428.4 105.6 0.0921 0.0067 0.0724 2.9 7.7
10..11 0.048 428.4 105.6 0.0921 0.0054 0.0589 2.3 6.2
11..4 0.114 428.4 105.6 0.0921 0.0129 0.1398 5.5 14.8
11..5 0.092 428.4 105.6 0.0921 0.0103 0.1123 4.4 11.9
10..12 0.158 428.4 105.6 0.0921 0.0179 0.1943 7.7 20.5
12..13 0.113 428.4 105.6 0.0921 0.0128 0.1386 5.5 14.6
13..6 0.300 428.4 105.6 0.0921 0.0339 0.3680 14.5 38.9
13..7 0.121 428.4 105.6 0.0921 0.0137 0.1482 5.8 15.6
12..8 0.305 428.4 105.6 0.0921 0.0345 0.3744 14.8 39.5
9..14 0.000 428.4 105.6 0.0921 0.0000 0.0000 0.0 0.0
14..2 0.007 428.4 105.6 0.0921 0.0008 0.0087 0.3 0.9
14..3 0.006 428.4 105.6 0.0921 0.0006 0.0069 0.3 0.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_sisA-PA)
Pr(w>1) post mean +- SE for w
33 T 0.759 1.797
86 L 0.971* 2.224
Time used: 1:19
Model 7: beta (10 categories)
TREE # 1: (1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 168
lnL(ntime: 13 np: 16): -1527.734591 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..13 13..6 13..7 12..8 9..14 14..2 14..3
0.084093 0.055878 0.047610 0.110931 0.087738 0.147365 0.112810 0.295938 0.119473 0.299529 0.000004 0.006888 0.005390 1.763258 0.078677 0.844983
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.37365
(1: 0.084093, ((4: 0.110931, 5: 0.087738): 0.047610, ((6: 0.295938, 7: 0.119473): 0.112810, 8: 0.299529): 0.147365): 0.055878, (2: 0.006888, 3: 0.005390): 0.000004);
(D_melanogaster_sisA-PA: 0.084093, ((D_yakuba_sisA-PA: 0.110931, D_erecta_sisA-PA: 0.087738): 0.047610, ((D_biarmipes_sisA-PA: 0.295938, D_suzukii_sisA-PA: 0.119473): 0.112810, D_eugracilis_sisA-PA: 0.299529): 0.147365): 0.055878, (D_sechellia_sisA-PA: 0.006888, D_simulans_sisA-PA: 0.005390): 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.76326
Parameters in M7 (beta):
p = 0.07868 q = 0.84498
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00005 0.00066 0.00549 0.03371 0.16224 0.61153
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.084 428.4 105.6 0.0814 0.0087 0.1066 3.7 11.3
9..10 0.056 428.4 105.6 0.0814 0.0058 0.0708 2.5 7.5
10..11 0.048 428.4 105.6 0.0814 0.0049 0.0603 2.1 6.4
11..4 0.111 428.4 105.6 0.0814 0.0114 0.1406 4.9 14.8
11..5 0.088 428.4 105.6 0.0814 0.0090 0.1112 3.9 11.7
10..12 0.147 428.4 105.6 0.0814 0.0152 0.1867 6.5 19.7
12..13 0.113 428.4 105.6 0.0814 0.0116 0.1430 5.0 15.1
13..6 0.296 428.4 105.6 0.0814 0.0305 0.3750 13.1 39.6
13..7 0.119 428.4 105.6 0.0814 0.0123 0.1514 5.3 16.0
12..8 0.300 428.4 105.6 0.0814 0.0309 0.3796 13.2 40.1
9..14 0.000 428.4 105.6 0.0814 0.0000 0.0000 0.0 0.0
14..2 0.007 428.4 105.6 0.0814 0.0007 0.0087 0.3 0.9
14..3 0.005 428.4 105.6 0.0814 0.0006 0.0068 0.2 0.7
Time used: 2:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, ((4, 5), ((6, 7), 8)), (2, 3)); MP score: 168
lnL(ntime: 13 np: 18): -1526.623800 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..13 13..6 13..7 12..8 9..14 14..2 14..3
0.086307 0.058703 0.047864 0.113436 0.091062 0.157340 0.113497 0.299892 0.120416 0.303998 0.000004 0.007059 0.005573 1.761464 0.985243 0.103764 1.520916 2.308291
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.40515
(1: 0.086307, ((4: 0.113436, 5: 0.091062): 0.047864, ((6: 0.299892, 7: 0.120416): 0.113497, 8: 0.303998): 0.157340): 0.058703, (2: 0.007059, 3: 0.005573): 0.000004);
(D_melanogaster_sisA-PA: 0.086307, ((D_yakuba_sisA-PA: 0.113436, D_erecta_sisA-PA: 0.091062): 0.047864, ((D_biarmipes_sisA-PA: 0.299892, D_suzukii_sisA-PA: 0.120416): 0.113497, D_eugracilis_sisA-PA: 0.303998): 0.157340): 0.058703, (D_sechellia_sisA-PA: 0.007059, D_simulans_sisA-PA: 0.005573): 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.76146
Parameters in M8 (beta&w>1):
p0 = 0.98524 p = 0.10376 q = 1.52092
(p1 = 0.01476) w = 2.30829
dN/dS (w) for site classes (K=11)
p: 0.09852 0.09852 0.09852 0.09852 0.09852 0.09852 0.09852 0.09852 0.09852 0.09852 0.01476
w: 0.00000 0.00000 0.00000 0.00002 0.00025 0.00173 0.00869 0.03495 0.12176 0.41354 2.30829
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.086 428.4 105.6 0.0913 0.0097 0.1062 4.2 11.2
9..10 0.059 428.4 105.6 0.0913 0.0066 0.0722 2.8 7.6
10..11 0.048 428.4 105.6 0.0913 0.0054 0.0589 2.3 6.2
11..4 0.113 428.4 105.6 0.0913 0.0127 0.1395 5.5 14.7
11..5 0.091 428.4 105.6 0.0913 0.0102 0.1120 4.4 11.8
10..12 0.157 428.4 105.6 0.0913 0.0177 0.1935 7.6 20.4
12..13 0.113 428.4 105.6 0.0913 0.0127 0.1396 5.5 14.7
13..6 0.300 428.4 105.6 0.0913 0.0337 0.3689 14.4 39.0
13..7 0.120 428.4 105.6 0.0913 0.0135 0.1481 5.8 15.6
12..8 0.304 428.4 105.6 0.0913 0.0341 0.3739 14.6 39.5
9..14 0.000 428.4 105.6 0.0913 0.0000 0.0000 0.0 0.0
14..2 0.007 428.4 105.6 0.0913 0.0008 0.0087 0.3 0.9
14..3 0.006 428.4 105.6 0.0913 0.0006 0.0069 0.3 0.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_sisA-PA)
Pr(w>1) post mean +- SE for w
33 T 0.661 1.663
86 L 0.934 2.182
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_sisA-PA)
Pr(w>1) post mean +- SE for w
29 T 0.639 1.627 +- 1.254
33 T 0.813 2.011 +- 1.244
86 L 0.947 2.325 +- 1.301
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.001 0.012 0.049 0.135 0.288 0.515
ws: 0.504 0.278 0.121 0.052 0.023 0.011 0.006 0.003 0.002 0.001
Time used: 3:17
Model 1: NearlyNeutral -1529.141433 Model 2: PositiveSelection -1529.141433 Model 0: one-ratio -1549.059066 Model 3: discrete -1526.342164 Model 7: beta -1527.734591 Model 8: beta&w>1 -1526.6238 Model 0 vs 1 39.83526600000005 Model 2 vs 1 0.0 Model 8 vs 7 2.221581999999671
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
