--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Tue Dec 06 17:09:27 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/388/Shab-PN/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/388/Shab-PN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/388/Shab-PN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/388/Shab-PN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1     -13184.82        -13197.90
2     -13184.66        -13197.60
--------------------------------------
TOTAL   -13184.74        -13197.76
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/388/Shab-PN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/388/Shab-PN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/388/Shab-PN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.566792    0.000998    0.504575    0.628836    0.565940   1298.89   1316.91    1.001
r(A<->C){all}   0.107627    0.000154    0.083239    0.130739    0.107383    901.52    968.71    1.001
r(A<->G){all}   0.203852    0.000279    0.171349    0.236341    0.203249    814.18    870.49    1.000
r(A<->T){all}   0.142618    0.000322    0.107223    0.178063    0.141964   1067.92   1090.27    1.000
r(C<->G){all}   0.097053    0.000096    0.078282    0.116222    0.096785   1122.60   1152.53    1.000
r(C<->T){all}   0.397043    0.000538    0.355228    0.445636    0.396633    866.07    905.67    1.000
r(G<->T){all}   0.051807    0.000098    0.033374    0.070639    0.051615   1172.29   1188.06    1.000
pi(A){all}      0.228036    0.000032    0.217050    0.238971    0.227878   1183.36   1214.56    1.002
pi(C){all}      0.309550    0.000039    0.296727    0.320780    0.309613    954.24    995.92    1.000
pi(G){all}      0.294854    0.000039    0.283867    0.308019    0.294793   1012.88   1040.69    1.001
pi(T){all}      0.167560    0.000025    0.157738    0.177345    0.167513   1107.40   1110.68    1.000
alpha{1,2}      0.190763    0.000323    0.157972    0.227551    0.189525   1104.57   1128.50    1.000
alpha{3}        3.572837    0.825348    2.062492    5.427608    3.439777   1317.90   1409.45    1.001
pinvar{all}     0.610941    0.000334    0.574726    0.647344    0.611435   1151.62   1208.89    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-11767.464061
Model 2: PositiveSelection	-11760.414626
Model 0: one-ratio	-12007.964324
Model 3: discrete	-11759.923871
Model 7: beta	-11768.199493
Model 8: beta&w>1	-11759.992385


Model 0 vs 1	481.0005259999998

Model 2 vs 1	14.098870000001625

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Shab-PN)

            Pr(w>1)     post mean +- SE for w

   185 A      0.578         2.351
   186 G      0.902         3.109
   187 T      0.524         2.225
   195 S      0.912         3.132
   862 G      0.582         2.361
  1255 L      0.663         2.549
  1280 R      0.797         2.864
  1496 H      0.569         2.330
  1505 A      0.806         2.884
  1513 A      0.911         3.131
  1538 A      0.681         2.592

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Shab-PN)

            Pr(w>1)     post mean +- SE for w

    37 G      0.568         1.794 +- 0.848
    50 H      0.733         2.100 +- 0.677
    59 Q      0.756         2.135 +- 0.658
    60 Q      0.760         2.143 +- 0.648
    67 K      0.608         1.881 +- 0.797
    68 Q      0.685         2.028 +- 0.709
    69 H      0.611         1.912 +- 0.749
   139 G      0.542         1.748 +- 0.858
   154 S      0.648         1.933 +- 0.801
   160 G      0.544         1.750 +- 0.859
   176 A      0.804         2.209 +- 0.608
   179 S      0.793         2.192 +- 0.620
   180 G      0.568         1.792 +- 0.848
   183 A      0.692         2.036 +- 0.707
   185 A      0.870         2.309 +- 0.515
   186 G      0.963*        2.449 +- 0.299
   187 T      0.841         2.265 +- 0.561
   189 T      0.564         1.785 +- 0.851
   190 G      0.647         1.932 +- 0.802
   191 T      0.797         2.198 +- 0.616
   195 S      0.966*        2.454 +- 0.288
   198 S      0.817         2.229 +- 0.593
   199 G      0.635         1.907 +- 0.816
   851 I      0.649         1.971 +- 0.731
   859 A      0.587         1.826 +- 0.838
   862 G      0.872         2.313 +- 0.511
   885 A      0.721         2.084 +- 0.680
   894 E      0.566         1.842 +- 0.762
   895 G      0.539         1.736 +- 0.867
  1178 N      0.738         2.107 +- 0.673
  1206 L      0.823         2.233 +- 0.598
  1255 L      0.894         2.345 +- 0.473
  1278 G      0.790         2.187 +- 0.624
  1280 R      0.937         2.410 +- 0.378
  1281 A      0.825         2.241 +- 0.579
  1282 G      0.715         2.072 +- 0.692
  1291 S      0.606         1.904 +- 0.750
  1292 S      0.576         1.860 +- 0.753
  1464 T      0.747         2.122 +- 0.666
  1472 G      0.561         1.777 +- 0.856
  1496 H      0.871         2.310 +- 0.513
  1502 P      0.793         2.192 +- 0.620
  1505 A      0.933         2.404 +- 0.389
  1506 P      0.812         2.222 +- 0.595
  1511 A      0.819         2.232 +- 0.590
  1513 A      0.966*        2.454 +- 0.288
  1514 T      0.588         1.829 +- 0.838
  1538 A      0.906         2.364 +- 0.449


Model 8 vs 7	16.414216000001034

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Shab-PN)

            Pr(w>1)     post mean +- SE for w

    50 H      0.710         1.916
    59 Q      0.737         1.966
    60 Q      0.785         2.055
    67 K      0.531         1.582
    68 Q      0.661         1.826
    69 H      0.544         1.610
   154 S      0.571         1.655
   176 A      0.801         2.085
   179 S      0.787         2.058
   183 A      0.656         1.816
   185 A      0.904         2.274
   186 G      0.985*        2.424
   187 T      0.850         2.174
   190 G      0.569         1.651
   191 T      0.794         2.070
   195 S      0.987*        2.427
   198 S      0.818         2.115
   199 G      0.550         1.615
   851 I      0.602         1.716
   862 G      0.907         2.279
   885 A      0.744         1.979
   894 E      0.532         1.587
  1178 N      0.717         1.929
  1206 L      0.827         2.131
  1255 L      0.926         2.314
  1278 G      0.781         2.048
  1280 R      0.969*        2.394
  1281 A      0.858         2.190
  1282 G      0.680         1.861
  1291 S      0.545         1.611
  1292 S      0.531         1.586
  1464 T      0.726         1.947
  1496 H      0.906         2.279
  1502 P      0.797         2.077
  1505 A      0.959*        2.376
  1506 P      0.843         2.161
  1511 A      0.821         2.121
  1513 A      0.987*        2.427
  1538 A      0.949         2.357

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Shab-PN)

            Pr(w>1)     post mean +- SE for w

    37 G      0.701         1.875 +- 0.962
    50 H      0.898         2.300 +- 0.591
    59 Q      0.911         2.324 +- 0.558
    60 Q      0.935         2.374 +- 0.469
    67 K      0.767         2.022 +- 0.869
    68 Q      0.877         2.258 +- 0.641
    69 H      0.805         2.115 +- 0.783
   139 G      0.672         1.815 +- 0.988
   154 S      0.782         2.048 +- 0.860
   160 G      0.673         1.816 +- 0.988
   176 A      0.937         2.375 +- 0.474
   179 S      0.931         2.364 +- 0.494
   180 G      0.700         1.873 +- 0.963
   183 A      0.872         2.248 +- 0.656
   185 A      0.974*        2.448 +- 0.305
   186 G      0.996**       2.489 +- 0.133
   187 T      0.955*        2.410 +- 0.404
   189 T      0.694         1.861 +- 0.968
   190 G      0.780         2.044 +- 0.864
   191 T      0.934         2.370 +- 0.484
   195 S      0.996**       2.490 +- 0.128
   198 S      0.943         2.387 +- 0.451
   199 G      0.764         2.007 +- 0.889
   851 I      0.842         2.188 +- 0.718
   859 A      0.720         1.917 +- 0.941
   862 G      0.975*        2.449 +- 0.300
   885 A      0.919         2.344 +- 0.519
   893 A      0.521         1.511 +- 1.042
   894 E      0.801         2.109 +- 0.784
   895 G      0.660         1.787 +- 1.000
   993 G      0.611         1.685 +- 1.030
  1059 V      0.680         1.867 +- 0.928
  1178 N      0.902         2.306 +- 0.582
  1206 L      0.941         2.380 +- 0.471
  1255 L      0.980*        2.460 +- 0.267
  1278 G      0.929         2.360 +- 0.501
  1280 R      0.992**       2.481 +- 0.178
  1281 A      0.960*        2.422 +- 0.373
  1282 G      0.884         2.271 +- 0.630
  1291 S      0.806         2.118 +- 0.780
  1292 S      0.802         2.114 +- 0.778
  1463 G      0.517         1.480 +- 1.068
  1464 T      0.906         2.314 +- 0.572
  1465 P      0.554         1.560 +- 1.057
  1472 G      0.688         1.847 +- 0.976
  1496 H      0.974*        2.449 +- 0.301
  1502 P      0.936         2.373 +- 0.477
  1505 A      0.989*        2.476 +- 0.202
  1506 P      0.955*        2.412 +- 0.395
  1511 A      0.945         2.390 +- 0.446
  1513 A      0.996**       2.490 +- 0.127
  1514 T      0.722         1.920 +- 0.939
  1538 A      0.986*        2.472 +- 0.221

>C1
MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQA
TQQQQHSKQQQQQQQQQQQQLQLKQHQQQQQDILYQQHNEAIAIARGLQA
ATPADIGDNQPYYDTSGNVDWERAMGAGGAGAYGGIGIGSLPAAGGAAYH
LGPANPAGLVSRHLDYGDGGHLAGPSAGLPAGAVGSGAGAGAGAGASVTG
SGSGAGTGTGTGAGSGSGSGAAGKEVRYAPFPVASPTHSIPTTSQQIVGS
VGGVGVGGASSQSISGGVPTHSQSNTTGALQRTHSRSMSSIPPPEPFMIA
QSKAVNSRVSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCD
DYSLADNEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGV
DELYLESCCQHKYHQRKENVHEEMRKEAESLRQRDEEEFGEGKCAEYQKY
LWELLEKPNTSFAARVIAVISILFIVLSTIALTLNTLPQLQHIDNGTPQD
NPQLAMVEAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAILPYFV
SLFLLETNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTL
RNSYKELGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFWWAGIT
MTTVGYGDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQM
RREKALKRREALDRAKREGSIVSFHHINLKDAFAKSMDLIDVIVDTEKRE
SHTRSLKNWHRLTHALRRSPTGHNLSQTDGNSTEGESTSGRNPATTGTGC
YKNYDHVANLRNSNLHNRRGSSSEQDAVPPYSFDNPNARQTSMMAMESYR
REQQALLQQQQQQQQQMLQMQQIQQKAPNGNGGATGGGVANNLAMVAASS
AATAVATATNASNASNTAPGSEGAEGGGDGDGGGVDDDNLSQAKGLPIQM
MITPGEVAELRRQVALENLQNQRMDNLEQDVPVEFECCFCTTKDFKEFTD
AEGVISLPTSDFHKPICLEMRLAAAGRQAGAYGLLSPLPAPLPPLHGPLL
ALPPPPPLPPTSCAAVLLPAISQSSSTSSSYGTTTSTTIALPLDVSLRYG
ATICSSSNFNHNYNNNFNTTTVGGGGNGTLLFGGNYNGSNNNNADLASVD
SSDTYASCQTHPFLSQGDLTADFNDEACALDIDMDNLYINPLEREQHQGI
SSSTGFIVGLPSTNSSGGPRAQVKKSASGDTALRNLAAGGVGAGGLSPLN
DVYQSFDVQERGSRVSLNENSVPKHRKTRFQQSFTAMRPSGATGVLGSSV
LGGMRPRARFEDTKLDDETGGRREGELAGGSGSPAASGSGGLSGQGPKKK
RSVFMPGKSLATATKLINQHLFGIQNVGAKAKFESKHSSSIDSIDASPNL
EHHRRSKSILKNKSDISRVLSDPESERLLADNMSGSGVSDNGTVMGESGS
DYSPNKLPHSVLAKSISPPPLRHRTLMHQRSGPATLQSKPTKFQTPRYPE
EQALRQVKPLLSRGTPSTSASAGSADGQQTRDSSLDSETTFTSPVSHRAG
EDPPTAPPSQAAVATGQEDREEEGEAEANDEQRALLQGADTEEAKRAGNE
GToooooooooooooooooooooo
>C2
MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQCGQAAGQQQQQQQA
TQQQQLSKQQQQQQQHQQQQLQLKQQQQQQQQQQQQDILYQQHNEAIAIA
RGLQAATPADIGDNQPYYDTSGNVDWERAMGTGGAGAYGGIGIGSLPAAG
GAAYHLGPANTAGLVSRHLDYADGGHLAGPSAGLPAGAVGSGAGAGTGAS
AGASVTGSGAGAGSGATGTGTGTGTGAGSGSGGGAAGKEVRYAPFPVASP
THSIPTTSQQIVGSVGGGGVGGASSQSISGGVPTHSQSNTTGALQRTHSR
SMSSIPPPEPFMIAQSKAVNSRVSINVGGVRHEVLWRTLERLPHTRLGRL
RECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSILNFYRTGKLHIVDEM
CVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHEEMRKEAESLRQRDE
EEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISILFIVLSTIALTLNT
LPQLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILRFSASPDKWKFFKGG
LNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVVQVFRIMRILRILKL
ARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAEKDEKDTK
FVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTVCCICGVLVIALPIP
IIVNNFAEFYKNQMRREKALKRREALDRAKREGSIVSFHHINLKDAFAKS
MDLIDVIVDTEKRESHTRSLKNWHRLTHALRRSPTGHNLSQTDGNSTEGE
STSGRNPATTGTGCYKNYDHVANLRNSNLHNRRGSSSEQDAVPPYSFDNP
NARQTSMMAMESYRREQQALLLQQQQQQQQQMLQMQQIQQKAPNGNGGAT
GGGGVANNLAMVAASSAATAVATATNASNASNTAPGTEGAEGGGDGDGGV
VDDDNLSQAKGLPIQMMITPGEVAELRRQVALENLQNQRMDNLEQDVPVE
FECCFCTTKDFKEFTDAEGVISLPTSDFHKPICLEMRLAAAGRQAGAYGL
LSPLPAPLPPLHGPLLALPPPPPLPPTSCAAVLLPAISQSSSTSSSYGTT
TSTTIALPLDMSLRYGATICSSSNFNHNYNNNFNTTTVGGGANGTLLFGG
NYNGSNNNNADLASVDSSDTYASCQTHPFLSQGDLTADFNDEACALDIDM
DNLYINPLEREQHQGISSSTGFIVGLPSTNSSGGLRAQVKKSASGDTALR
NLAAGGGGAGGLSPLDDVYQSFDVQERGSRVSLNENSVPKHRKTRFQQSF
TAMRPSGAAGVLGSSVLGGMRPRARFEDTKLDDETGGRREGELAGGSGSP
AASGSGGFGGQGPKKKRSVFMPGKSLATATKLINQHLFGIQNVGAKAKFE
SKHSSSIDSIDASPNLEHHRRSKSILKNKSDISRVLSDPESERLLADNMS
GSGVSDNGTVMGESGSDYSPNKLPHSVLAKSISPPPLRHRTLMHQRSGPA
TLQSKPTKFQTPRYPEEQALRQVKPLLSRGTPSTSASAGSADGQQTRDSS
LDSETTFTSPVSQRAGEDPPTAAPSQAAVPPAQEDREEEGEAEANDEQRA
LLQGGDAEEAKRAGNEGToooooo
>C3
MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQCGQAAGQQQQQQQA
TQQQQHSKQQQQQQQQQQQQQLQLKQQQQQDILYQQHNEAVAIARGLQAA
TPADIGDNQPYYDTSGNVDWERAMGTGGAGAYGGIGIGSIPAAGGAAYHL
GPANPAGLVSRHLDYTDGGHLAGPSAGLPAGAVGSGAGAGAGTGAGAGAS
VTGSGSGSGAGPGTGTGAGSGSGSGAAGKEVRYAPFPVASPTHSIPTTSQ
QIVGSVGGGGVGGASSQSISGGVPTHSQSNTTGALQRTHSRSMSSIPPPE
PFMIAQSKAVNSRVSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAI
VELCDDYSLADNEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDL
EYWGVDELYLESCCQHKYHQRKENVHEEMRKEAESLRQRDEEEFGEGKCA
EYQKYLWELLEKPNTSFAARVIAVISILFIVLSTIALTLNTLPQLQHIDN
GTPQDNPQLAMVEAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAI
LPYFVSLFLLETNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQS
LGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFW
WAGITMTTVGYGDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAEF
YKNQMRREKALKRREALDRAKREGSIVSFHHINLKDAFAKSMDLIDVIVD
TEKRESHTRSLKNWHRLTHALRRSPTGHNLSQTDGNSTEGESTSGRNPAT
TGTGCYKNYDHVANLRNSNLHNRRGSSSEQDAVPPYSFDNPNARQTSMMA
MESYRREQQALLLQQQQQQQQQQQMLQMQQTQQKAPNGNGGATGGGVANN
LAMVAASSAATAVATATNATNASNTAPGSEGAEGGGDGDGGGVDDDNLSQ
AKGLPIQMMITPGEVAELRRQVALENLQNQRMDNLEQDVPVEFECCFCTT
KDFKEFTDAEGVISLPTSDFHKPICLEMRLAAAGRQTGAYGLLSPLPAPL
PPLHGPLLALPPPPPLPPSSCAAVLLPAISQSSSTSSSYGTTTSTTIALP
LDMSLRYGATICSSSNFNHNYNNNFNTTTVGGGANGTLLFGGNYNGSNNN
NADLASVDSSDTYASCQTHPFLSQGDLTADFNDEACALDIDMDNLYINPL
EREQHQGISSSTGFIVGLPSTNSSGGLRAQVKKSASGDTALRNLAAGGGG
AGGLSPLDDVYQSFDVQERGSRVSLNENSVPKHRKTRFQQSFTAMRPSGA
AGVLGSSVLGGMRLRARFEDTKLDDETGARREGELAGCSGSPAASGSSGS
GGFGGQGPKKKRSVFMPGKSLATATKLINQHLFGIQNVGAKAKFESKHSS
SIDSIDASPNLEHHRRSKSILKNKSDISRVLSDPESERLLADNMSGSGVS
DNGTVMGESGSDYSPNKLPHSVLAKSISPPPLRHRTLMHQRSGPATLQSK
PTKFQTPRYPEEQALRQVKPLLSRGPPSTSASAGSADGQQTRDSSLDSET
TFTSPVSHRAGEDAPTAPPSQAAVPPGQEDREEEGEAEANDEQRALLQGG
DAEEAKRAGNEGTooooooooooo
>C4
MVGERDRDREAVRWATGELTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQA
TQQQQLSKQQQQQQQLQLKQQQQQQQQQQQDILYQQHNEAIAIARGLQAA
TPADIGDNQPYYDTSGNVDWERAMGTGGAGAYGGIGIGSLPAAGGAPYHL
GPANPAGLVSRHMDYADGGHLAGPSAGLPAGAVGAGTGSGLVSGGSAVAG
PGAGSGAGTGSAGGAAGKEVRYAPFPVASPTHSIPTTSQQIVGSVGGGGV
GGASSQSISGGVPTHSQSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAVN
SRVSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCDDYSLAD
NEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLE
SCCQHKYHQRKENVHEEMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLE
KPNTSFAARVIAVISILFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAM
VEAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLE
TNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNSYKE
LGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGY
GDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQMRREKAL
KRREALDRAKREGSIVSFHHINLKDAFAKSMDLIDVIVDTEKRESHTRSL
KNWHRLTHALRRSPTGHNLSQTDGNSTEGESTSGRNPATTGTGCYKNYDH
VANLRNSNLHNRRGSSSEQDAVPPYSFDNPNARQTSMMAMESYRREQQAL
LLQQQQQQQQQTQQQMLQMQQIQQKAPNGGGSGSGVANNLAMVAASSAAT
AVATATNASNNSNIAPGSAEGAEGGDGAGVDDDNLSQAKGLPIQMMITPG
EVAELRRQVALENLQNQRMDNLEQDVPVEFECCFCTTKDFKEYTDAEGVI
SLPTSDFHKPICLEMRLAAANRQAGAFGLLSPLQPPPPALQGPLLALPPP
PPLPPTSCSAVLLPAISQSSSTSSSYGTTTSTTIALPLDVSMRYGPTICS
SSNFNHNYNNNFNTTTVGGGANGTLLFGGNYNGSNNNNADLASVDSSDTY
ASCQTHPFLSQGDLTADFNDEACALDIDMDNLYINPLEREQHQGISSSTG
FIVGLPSTNSSGALRAQVKKSASGDTALRNLAAGGGGAGGISPLDDVYQS
FDVQERGSRVSLNENSVPKHRKTRFQQSFTAMRPSGAAGVLGGSVLGGIR
PRARFEDTKLDDETGGRPESGLSGSGSPGASGSSGFGGQGPKKKRSVFMP
GKSLATATKLINQHLFGIQNVGAKAKFESKHSSSIDSIDASPNLEHHRRS
KSILKNKSDISRVLSDPESERLLADNMSGSGVSDNGTVMGESGSDYSPNK
LPHSVLAKSISPPPLRHRTLMHQRSGPATLQSKPTKFQTPRYPEEQALRQ
VKPLLSRGAPSTSVSASAGSADGQQTRDSSLDSETTFTSPVSTRAGEDPP
TAAPSQVPVGSGQDDREEEGEAEANDEQRALLQGPDAEEAKRTGNEGToo
oooooooooooooooooooooooo
>C5
MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQQ
QQATQQQQQQHAKQQQQQQQLKQQQHQQELLYQQHNEAIAIARGLQAATP
ADVGDNQPYYDTSGNVDWERAMGAGGAGAYGGVGIGSLPAGGGAAYHLGP
ANAAGLVPRHLDYADGGHLAGPSAGLSAGALAAGAGTAAVGGAAGAPGGA
GQGGTAAGSKEVRYAPFPVASPTHSIPTTSNQQLGGSVVGGGGVGGASSQ
SISGGVPTAHSQSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAVNSRVSI
NVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFF
DRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQH
KYHQRKENVHEEMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTS
FAARVIAVISILFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAMVEAVC
ITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNA
TDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLM
LFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYP
TTALGKVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREA
LDRAKREGSIVSFHHINLKDAFAKSMDLIDVIVDTEKRESHTRSLKNWHR
LTHALRRSPTGHNLSQTDGNSTEGESTSGRNPATTGTGCYKNYDHVANLR
NSNLHNRRGSSSEQDAVPPYSFDNPNARQTSMMAMESYRREQQALLLQQQ
QQQQQMLQMQQIQKAPNGGGAAQGVTNNLAIMAASSAATAVATASTSNTS
NTAQGSEGQGAEGGGEGADEDNLSQAKGLPIQMMITPGEVAELRRQVALE
NLQNQRMDNLEQDVPVEFECCFCTTKDFKEYTDAEGVISLPTSDFHKPIC
LEMRLAAASRQAGAFGFLSPLPLPPPPPPPLQGPLLALPPPPPLPPSSGG
AVLLPAISQSSSTSSSYGTTTSTTIALPLDVSLRYGATICSSSNFNFNHN
LNNNFNTTTVGGSGANGSLLFGGNYNYNGSNNNNADLASVDSSDTYASCQ
THPFLSQGDLTADFNDEACALDIDMDNLYINPLEREQHQGISGSTGFIVG
LPSTSSAGGLRAQVKKSASGDTALRNLASGGGGAGGLSPLDDVYQSFDVQ
ERGSRVSLNENSVPKHRKTRFQQSFTAMRPTGAPAAGGVLGGIRPRARFE
DTKLDDEMGGGRAEASGGSGSPAASGSGAFGAQGPKKKRSVFMPGKSLAT
ATKLINQHLFGIQNVGAKAKFESKHSSSIDSIDASPNLEHHRRSKSILKN
KSDISRVLSDPESERLLADNMSGSGVSDNGTVMGESGSDYSPNKLPHSVL
AKSISPPPLRHRTLMHQRSGPATLQSKPTKFQTPRYPEEQALRQVKPLLS
RGPASTSASASAGSADGQQTRDSSLDSETTFTSPVSSRAGEDPPAGSTPS
QVAGPPGQEEREEEGEAEANDEQRALLQGRDAEEAKRAGNEGTooooooo
oooooooooooooooooooooooo
>C6
MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQA
TQQQQQQLSRQQQQQQQQQQQQQQQQQLQHKQQQDILYQQHNEAIAIARG
LQAATPADIGDNQPYYDTSGNVDWERAMGTGGAGAYGGIGIGSLPAAGGA
AYHLGPANPAGLVPRHMDYADGGHLAGPSAGLPAGGVGGPAVTGSGSTGA
GAGAGTGPGAGAAGKEVRYAPFPVASPTHSIPTTSQQIVGSVGGGGVGGA
TSSQSISGGGGGGVPTNHSQSNTTGALQRTHSRSMSSIPPPEPFMIAQSK
AVNSRVSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCDDYS
LADNEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGVDEL
YLESCCQHKYHQRKENVHEEMRKEAESLRQRDEEEFGEGKCAEYQKYLWE
LLEKPNTSFAARVIAVISILFIVLSTIALTLNTLPQLQHIDNGTPQDNPQ
LAMVEAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAILPYFVSLF
LLETNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNS
YKELGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFWWAGITMTT
VGYGDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQMRRE
KALKRREALDRAKREGSIVSFHHINLKDAFAKSMDLIDVIVDTEKRESHT
RSLKNWHRLTHALRRSPTGHNLSQTDGNSTEGESTSGRNPATTGTGCYKN
YDHVANLRNSNLHNRRGSSSEQDAVPPYSFDNPNARQTSMMAMESYRREQ
QALLLQQQQQQQQQQQQQMLQMQQMQQKAPNGGGTGSGVANNLAMVAASS
AATAVATASSSNTAQGSEGAAEGGGGEGGGADEDNLSQAKGLPIQMMITP
GEVAELRRQVALENLQNQRMDNLEQDVPVEFECCFCTTKDFKEFTDAEGV
ISLPTSDFHKPICLEMRLAAASRQAGAFGLLSPLPLPPPPLPHHGPLLAL
PPPPPLPPSSCAAVLLPAISQSSSTSSSYGTTTSTTIALPLDVSLRYGAT
ICSSSNFNHNYNNNFNTTTVGGGANGSLLFGGNYNGSNNNNADLASVDSS
DTYASCQTHPFLSQGDLTADFNDEACALDIDMDNLYINPLEREQHQGISS
STGFIVGLPSTQSSGGGLRAQVKKSASGDTALRNLASGGGASGGLSPLDD
VYQSFDVQELGSRVSLNENSVPKHRKTRFQQSFTAIRPSGGGVTGGGVLA
GIRPRARFEDTKLDDETGARAPDGSGSPAASGFGGQGPKKKRSVFMPGKS
LATATKLINQHLFGIQNVGAKAKFESKHSSSIDSIDASPNLEHHRRSKSI
LKNKSDISRVLSDPESERLLADNMSGSGVSDNGTVMGESGSDYSPNKLPH
SVLAKSISPPPLRHRTLMHQRSGPATLQSKPTKFQTPRYPEEQALRQVKP
LLSRAPPSTSASASAASADGQQTRDSSLDSETTFTSPVSSRAGEDQPTAG
QVPSQVPVAPGQEDRDEEGEAESNDEQRALLQGVDAEEAKRAGNEGTooo
oooooooooooooooooooooooo
>C7
MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQA
TQQQQQQLTRQQQQLQQQQHKQQQQDILYQQQNEAIAIARGLQAATPADI
GDNQPYYDTSGNVDWERAMGAGGAGAYGGLGIGSLPAAGHVAYHLGPANA
PGLAARHLDYADGGHLAGPSAGVSVGSGAVSITGSGSGGAIGAGGAAGAA
GAAGATAAGKEVRYAPFPVASPTHSIPTTSQQIVGSVGGGGVGGATSSQS
ISGGGGGGGGAPTNPSQSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAAN
SRVSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCDDYSLAD
NEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLE
SCCQHKYHQRKENVHEEMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLE
KPNTSFAARVIAVISILFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAM
VEAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLE
TNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNSYKE
LGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGY
GDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQMRREKAL
KRREALDRAKREGSIVSFHHINLKDAFAKSMDLIDVIVDTEKRESHTRSL
KNWHRLTHALRRSPTGHNLSQTDGNSTEGESTSGRNPATTGTGCYKNYDH
VANLRNSNLHHRRGSSSEQDAVPPYNFDNPNARQTSMMAMESYRREQQAL
LLQQQQQQQKQQQQQQQMLQMQQMQQKAAPNGGATGSGVANNLAIVAASS
AATAVATASSSNTAPGSEVAEGGGGDGGGGEEGVADDDNLSQAKGLPIQM
MITPGEVAELRRQVALENLQNQRMDNLEQDVPVEFECCFCTTKDFKEYTD
AEGVISLPTSDFHKPICLEMRLAEASRQAGAFGLLSPLQLPPPPLPLPLQ
GPLLALPPPPPLPPSSVLLPAISQSSSTSSSYGTTTSTTIALPLDAMSLR
YGATICSSSNFNHNYNNNFNTTTVGGNGANGSLLFGGNNYNGSNNNNADL
ASVDSSDTYASCQTHPFLSQGDLTADFNDEACALDIDMDNLYINPLEREQ
HHQGISSSTGFIVGLPSTSGLRAQVKKSASGDTALRNLASGGGGVGGGGA
GGISPLDDVYQSFDVQERGSRVSLNENSVPKHRKTRFQQSFTAMRPSGAG
AGAGVLGSLRPRARFEDTKLDDETGARAAEASASGSGAGAGAGSPASSGF
GSTQGQGPQKKKRSVFMPGKSLATATKLINQHLFGIQNVGAKAKFESKHS
SSIDSIDASPNLEHHRRSKSILKNKSDISRVLSDPESERLLADNMSGSGV
SDNGTVMGESGSDYSPNKLPHSVLAKSISPPPLRHRTLMHQRSGPATLQS
KPTKFQTPRYPEEQALRQVKPLPSRAPSSTSASASASAAAASADGQQTRD
SSLDSETTFTSPVSSRAGEDQPAAGSVVPSQVSGSVPGQEDREEEGEAEA
NDEQRALLQGRDAEEAKRSGNEGT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=99, Nseq=7, Len=1707 

C1              MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQA
C2              MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQCGQAAGQQQQQQQA
C3              MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQCGQAAGQQQQQQQA
C4              MVGERDRDREAVRWATGELTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQA
C5              MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQGGQAAGQQQQQQ--
C6              MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQA
C7              MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQGGQAAGQQQQQQ--
                ****************** ***************** ***********  

C1              T--QQQQHSKQQQQQQQQQQQQ-----LQLKQHQQQQQDILYQQHNEAIA
C2              T--QQQQLSKQQQQQQQHQQQQLQLKQQQQQQQQQQQQDILYQQHNEAIA
C3              T--QQQQHSKQQQQQQQQQQQ------QQLQLKQQQQQDILYQQHNEAVA
C4              T--QQQQLSKQQQQQQQLQLK------QQQQQQQQQQQDILYQQHNEAIA
C5              ---QQQQATQQQQQQHAKQQQQ-----QQQLKQQQHQQELLYQQHNEAIA
C6              TQQQQQQLSRQQQQQQQQQQQQ----QQQQQLQHKQQQDILYQQHNEAIA
C7              ------QATQQQQQQLTRQQQQ-----LQQQQHKQQQQDILYQQQNEAIA
                      * ::*****   * :       *   ::::**::****:***:*

C1              IARGLQAATPADIGDNQPYYDTSGNVDWERAMGAGGAGAYGGIGIGSLPA
C2              IARGLQAATPADIGDNQPYYDTSGNVDWERAMGTGGAGAYGGIGIGSLPA
C3              IARGLQAATPADIGDNQPYYDTSGNVDWERAMGTGGAGAYGGIGIGSIPA
C4              IARGLQAATPADIGDNQPYYDTSGNVDWERAMGTGGAGAYGGIGIGSLPA
C5              IARGLQAATPADVGDNQPYYDTSGNVDWERAMGAGGAGAYGGVGIGSLPA
C6              IARGLQAATPADIGDNQPYYDTSGNVDWERAMGTGGAGAYGGIGIGSLPA
C7              IARGLQAATPADIGDNQPYYDTSGNVDWERAMGAGGAGAYGGLGIGSLPA
                ************:********************:********:****:**

C1              AGGAAYHLGPANPAGLVSRHLDYGDGGHLAGPSAGLPAGAVGS----GAG
C2              AGGAAYHLGPANTAGLVSRHLDYADGGHLAGPSAGLPAGAVGS--GAGAG
C3              AGGAAYHLGPANPAGLVSRHLDYTDGGHLAGPSAGLPAGAVGSGAGAGAG
C4              AGGAPYHLGPANPAGLVSRHMDYADGGHLAGPSAGLPAGAVGA----GTG
C5              GGGAAYHLGPANAAGLVPRHLDYADGGHLAGPSAGLSAGALAA----GAG
C6              AGGAAYHLGPANPAGLVPRHMDYADGGHLAGPSAGLPAGGVGG----PAV
C7              AGHVAYHLGPANAPGLAARHLDYADGGHLAGPSAGVSVGSGAVS-ITGSG
                .* ..*******..**..**:** ***********:..*. .      : 

C1              AGAGAGASVTGSGSGA-------GTGTGTGAGSGSGSGAAGKEVRYAPFP
C2              TGASAGASVTGSGAGAGSGATGTGTGTGTGAGSGSGGGAAGKEVRYAPFP
C3              TGAGAGASVTGSGSGS-----GAGPGTGTGAGSGSGSGAAGKEVRYAPFP
C4              SGLVSGGSAVA------------GPGAGSGAGTGSAGGAAGKEVRYAPFP
C5              TAAVGG-----------------AAGAPGGAGQG-GTAAGSKEVRYAPFP
C6              TGSG-------------------STGAGAGAGTGPGAGAAGKEVRYAPFP
C7              SGGAIG------------------AGGAAGAAGAAGATAAGKEVRYAPFP
                :.                      .*   **. . .  *..*********

C1              VASPTHSIPTTSQQIVG--SVGGVGVGGASS-QSISGG------VPT-HS
C2              VASPTHSIPTTSQQIVG--SVGGGGVGGASS-QSISGG------VPT-HS
C3              VASPTHSIPTTSQQIVG--SVGGGGVGGASS-QSISGG------VPT-HS
C4              VASPTHSIPTTSQQIVG--SVGGGGVGGASS-QSISGG------VPT-HS
C5              VASPTHSIPTTSNQQLGGSVVGGGGVGGASS-QSISGG------VPTAHS
C6              VASPTHSIPTTSQQIVG--SVGGGGVGGATSSQSISGGGGGG--VPTNHS
C7              VASPTHSIPTTSQQIVG--SVGGGGVGGATSSQSISGGGGGGGGAPTNPS
                ************:* :*   *** *****:* ******      .**  *

C1              QSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAVNSRVSINVGGVRHEVLW
C2              QSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAVNSRVSINVGGVRHEVLW
C3              QSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAVNSRVSINVGGVRHEVLW
C4              QSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAVNSRVSINVGGVRHEVLW
C5              QSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAVNSRVSINVGGVRHEVLW
C6              QSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAVNSRVSINVGGVRHEVLW
C7              QSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAANSRVSINVGGVRHEVLW
                ********************************.*****************

C1              RTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSIL
C2              RTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSIL
C3              RTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSIL
C4              RTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSIL
C5              RTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSIL
C6              RTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSIL
C7              RTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSIL
                **************************************************

C1              NFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHE
C2              NFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHE
C3              NFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHE
C4              NFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHE
C5              NFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHE
C6              NFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHE
C7              NFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHE
                **************************************************

C1              EMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISI
C2              EMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISI
C3              EMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISI
C4              EMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISI
C5              EMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISI
C6              EMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISI
C7              EMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISI
                **************************************************

C1              LFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILR
C2              LFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILR
C3              LFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILR
C4              LFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILR
C5              LFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILR
C6              LFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILR
C7              LFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILR
                **************************************************

C1              FSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVV
C2              FSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVV
C3              FSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVV
C4              FSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVV
C5              FSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVV
C6              FSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVV
C7              FSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVV
                **************************************************

C1              QVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFS
C2              QVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFS
C3              QVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFS
C4              QVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFS
C5              QVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFS
C6              QVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFS
C7              QVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFS
                **************************************************

C1              SLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTV
C2              SLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTV
C3              SLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTV
C4              SLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTV
C5              SLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTV
C6              SLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTV
C7              SLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTV
                **************************************************

C1              CCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV
C2              CCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV
C3              CCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV
C4              CCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV
C5              CCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV
C6              CCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV
C7              CCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV
                **************************************************

C1              SFHHINLKDAFAKSMDLIDVIVDTEKRESHTRSLKNWHRLTHALRRSPTG
C2              SFHHINLKDAFAKSMDLIDVIVDTEKRESHTRSLKNWHRLTHALRRSPTG
C3              SFHHINLKDAFAKSMDLIDVIVDTEKRESHTRSLKNWHRLTHALRRSPTG
C4              SFHHINLKDAFAKSMDLIDVIVDTEKRESHTRSLKNWHRLTHALRRSPTG
C5              SFHHINLKDAFAKSMDLIDVIVDTEKRESHTRSLKNWHRLTHALRRSPTG
C6              SFHHINLKDAFAKSMDLIDVIVDTEKRESHTRSLKNWHRLTHALRRSPTG
C7              SFHHINLKDAFAKSMDLIDVIVDTEKRESHTRSLKNWHRLTHALRRSPTG
                **************************************************

C1              HNLSQTDGNSTEGESTSGRNPATTGTGCYKNYDHVANLRNSNLHNRRGSS
C2              HNLSQTDGNSTEGESTSGRNPATTGTGCYKNYDHVANLRNSNLHNRRGSS
C3              HNLSQTDGNSTEGESTSGRNPATTGTGCYKNYDHVANLRNSNLHNRRGSS
C4              HNLSQTDGNSTEGESTSGRNPATTGTGCYKNYDHVANLRNSNLHNRRGSS
C5              HNLSQTDGNSTEGESTSGRNPATTGTGCYKNYDHVANLRNSNLHNRRGSS
C6              HNLSQTDGNSTEGESTSGRNPATTGTGCYKNYDHVANLRNSNLHNRRGSS
C7              HNLSQTDGNSTEGESTSGRNPATTGTGCYKNYDHVANLRNSNLHHRRGSS
                ********************************************:*****

C1              SEQDAVPPYSFDNPNARQTSMMAMESYRREQQALLQQQQQQ-QQQ-----
C2              SEQDAVPPYSFDNPNARQTSMMAMESYRREQQALLLQQQQQQQQQ-----
C3              SEQDAVPPYSFDNPNARQTSMMAMESYRREQQALLLQQQQQQQQQQQ---
C4              SEQDAVPPYSFDNPNARQTSMMAMESYRREQQALLLQQQQQQQQQTQQQ-
C5              SEQDAVPPYSFDNPNARQTSMMAMESYRREQQALLLQQQQQQQQ------
C6              SEQDAVPPYSFDNPNARQTSMMAMESYRREQQALLLQQQQQQQQQQQQQ-
C7              SEQDAVPPYNFDNPNARQTSMMAMESYRREQQALLLQQQQQQQKQQQQQQ
                *********.************************* ***** *:      

C1              -MLQMQQIQQKAPNGNGGATGGG-VANNLAMVAASSAATAVATATNASNA
C2              -MLQMQQIQQKAPNGNGGATGGGGVANNLAMVAASSAATAVATATNASNA
C3              -MLQMQQTQQKAPNGNGGATGGG-VANNLAMVAASSAATAVATATNATNA
C4              -MLQMQQIQQKAPN--GGGSGSG-VANNLAMVAASSAATAVATATNASNN
C5              -MLQMQQIQ-KAPN--GGGAAQG-VTNNLAIMAASSAATAVATAS-TSNT
C6              -MLQMQQMQQKAPN--GGGTGSG-VANNLAMVAASSAATAVATAS----S
C7              QMLQMQQMQQKAAP-NGGATGSG-VANNLAIVAASSAATAVATAS----S
                 ****** * **.   **.:. * *:****::************:     

C1              SNTAPGSEGAEGGGD----GDGGGVDDDNLSQAKGLPIQMMITPGEVAEL
C2              SNTAPGTEGAEGGGD----GDGGVVDDDNLSQAKGLPIQMMITPGEVAEL
C3              SNTAPGSEGAEGGGD----GDGGGVDDDNLSQAKGLPIQMMITPGEVAEL
C4              SNIAPGS--AEGAEG----GDGAGVDDDNLSQAKGLPIQMMITPGEVAEL
C5              SNTAQGSEGQGAEGG----GEG--ADEDNLSQAKGLPIQMMITPGEVAEL
C6              SNTAQGSEGAAEGGG----GEGGGADEDNLSQAKGLPIQMMITPGEVAEL
C7              SNTAPGSEVAEGGGGDGGGGEEGVADDDNLSQAKGLPIQMMITPGEVAEL
                ** * *:       .    *:   .*:***********************

C1              RRQVALENLQNQRMDNLEQDVPVEFECCFCTTKDFKEFTDAEGVISLPTS
C2              RRQVALENLQNQRMDNLEQDVPVEFECCFCTTKDFKEFTDAEGVISLPTS
C3              RRQVALENLQNQRMDNLEQDVPVEFECCFCTTKDFKEFTDAEGVISLPTS
C4              RRQVALENLQNQRMDNLEQDVPVEFECCFCTTKDFKEYTDAEGVISLPTS
C5              RRQVALENLQNQRMDNLEQDVPVEFECCFCTTKDFKEYTDAEGVISLPTS
C6              RRQVALENLQNQRMDNLEQDVPVEFECCFCTTKDFKEFTDAEGVISLPTS
C7              RRQVALENLQNQRMDNLEQDVPVEFECCFCTTKDFKEYTDAEGVISLPTS
                *************************************:************

C1              DFHKPICLEMRLAAAGRQAGAYGLLSPLPAPLP----PLHGPLLALPPPP
C2              DFHKPICLEMRLAAAGRQAGAYGLLSPLPAPLP----PLHGPLLALPPPP
C3              DFHKPICLEMRLAAAGRQTGAYGLLSPLPAPLP----PLHGPLLALPPPP
C4              DFHKPICLEMRLAAANRQAGAFGLLSPLQPPPP----ALQGPLLALPPPP
C5              DFHKPICLEMRLAAASRQAGAFGFLSPLPLPPPPP-PPLQGPLLALPPPP
C6              DFHKPICLEMRLAAASRQAGAFGLLSPLPLPPPP--LPHHGPLLALPPPP
C7              DFHKPICLEMRLAEASRQAGAFGLLSPLQLPPPPLPLPLQGPLLALPPPP
                ************* *.**:**:*:****  * *    . :**********

C1              PLPPTSCAAVLLPAISQSSSTSSSYGTTTSTTIALPLD-VSLRYGATICS
C2              PLPPTSCAAVLLPAISQSSSTSSSYGTTTSTTIALPLD-MSLRYGATICS
C3              PLPPSSCAAVLLPAISQSSSTSSSYGTTTSTTIALPLD-MSLRYGATICS
C4              PLPPTSCSAVLLPAISQSSSTSSSYGTTTSTTIALPLD-VSMRYGPTICS
C5              PLPPSSGGAVLLPAISQSSSTSSSYGTTTSTTIALPLD-VSLRYGATICS
C6              PLPPSSCAAVLLPAISQSSSTSSSYGTTTSTTIALPLD-VSLRYGATICS
C7              PLPPSS---VLLPAISQSSSTSSSYGTTTSTTIALPLDAMSLRYGATICS
                ****:*   ***************************** :*:***.****

C1              SS--NFNHNYNNNFNTTTVGG-GGNGTLLFGG--NYNGSNNNNADLASVD
C2              SS--NFNHNYNNNFNTTTVGG-GANGTLLFGG--NYNGSNNNNADLASVD
C3              SS--NFNHNYNNNFNTTTVGG-GANGTLLFGG--NYNGSNNNNADLASVD
C4              SS--NFNHNYNNNFNTTTVGG-GANGTLLFGG--NYNGSNNNNADLASVD
C5              SSNFNFNHNLNNNFNTTTVGGSGANGSLLFGGNYNYNGSNNNNADLASVD
C6              SS--NFNHNYNNNFNTTTVGG-GANGSLLFGG--NYNGSNNNNADLASVD
C7              SS--NFNHNYNNNFNTTTVGGNGANGSLLFGGN-NYNGSNNNNADLASVD
                **  ***** *********** *.**:*****  ****************

C1              SSDTYASCQTHPFLSQGDLTADFNDEACALDIDMDNLYINPLEREQ-HQG
C2              SSDTYASCQTHPFLSQGDLTADFNDEACALDIDMDNLYINPLEREQ-HQG
C3              SSDTYASCQTHPFLSQGDLTADFNDEACALDIDMDNLYINPLEREQ-HQG
C4              SSDTYASCQTHPFLSQGDLTADFNDEACALDIDMDNLYINPLEREQ-HQG
C5              SSDTYASCQTHPFLSQGDLTADFNDEACALDIDMDNLYINPLEREQ-HQG
C6              SSDTYASCQTHPFLSQGDLTADFNDEACALDIDMDNLYINPLEREQ-HQG
C7              SSDTYASCQTHPFLSQGDLTADFNDEACALDIDMDNLYINPLEREQHHQG
                ********************************************** ***

C1              ISSSTGFIVGLPSTNSSGG-PRAQVKKSASGDTALRNLAAGGV-----GA
C2              ISSSTGFIVGLPSTNSSGG-LRAQVKKSASGDTALRNLAAGGG-----GA
C3              ISSSTGFIVGLPSTNSSGG-LRAQVKKSASGDTALRNLAAGGG-----GA
C4              ISSSTGFIVGLPSTNSSGA-LRAQVKKSASGDTALRNLAAGGG-----GA
C5              ISGSTGFIVGLPSTSSAGG-LRAQVKKSASGDTALRNLASGGG-----GA
C6              ISSSTGFIVGLPSTQSSGGGLRAQVKKSASGDTALRNLASGGG-----AS
C7              ISSSTGFIVGLPSTS----GLRAQVKKSASGDTALRNLASGGGGVGGGGA
                **.***********.      ******************:**      .:

C1              GGLSPLNDVYQSFDVQERGSRVSLNENSVPKHRKTRFQQSFTAMRPSGAT
C2              GGLSPLDDVYQSFDVQERGSRVSLNENSVPKHRKTRFQQSFTAMRPSGAA
C3              GGLSPLDDVYQSFDVQERGSRVSLNENSVPKHRKTRFQQSFTAMRPSGAA
C4              GGISPLDDVYQSFDVQERGSRVSLNENSVPKHRKTRFQQSFTAMRPSGAA
C5              GGLSPLDDVYQSFDVQERGSRVSLNENSVPKHRKTRFQQSFTAMRPTGAP
C6              GGLSPLDDVYQSFDVQELGSRVSLNENSVPKHRKTRFQQSFTAIRPSGG-
C7              GGISPLDDVYQSFDVQERGSRVSLNENSVPKHRKTRFQQSFTAMRPSGAG
                **:***:********** *************************:**:*. 

C1              GVLGSSVLGGMRPRARFEDTKLDDETGGRREGELAGGSGSPAASGS----
C2              GVLGSSVLGGMRPRARFEDTKLDDETGGRREGELAGGSGSPAASGS----
C3              GVLGSSVLGGMRLRARFEDTKLDDETGARREGELAGCSGSPAASGSSGS-
C4              GVLGGSVLGGIRPRARFEDTKLDDETGGRPESGLSG-SGSPGASGS----
C5              AAGG--VLGGIRPRARFEDTKLDDEMGGGR-AEASGGSGSPAASGS----
C6              GVTGGGVLAGIRPRARFEDTKLDDETGARA----PDGSGSPAASGF----
C7              AGAG--VLGSLRPRARFEDTKLDDETGARAAEASASGSGAGAGAGSPASS
                .  *  **..:* ************ *.      .. **: ..:*     

C1              --GGLSGQGP-KKKRSVFMPGKSLATATKLINQHLFGIQNVGAKAKFESK
C2              --GGFGGQGP-KKKRSVFMPGKSLATATKLINQHLFGIQNVGAKAKFESK
C3              --GGFGGQGP-KKKRSVFMPGKSLATATKLINQHLFGIQNVGAKAKFESK
C4              --SGFGGQGP-KKKRSVFMPGKSLATATKLINQHLFGIQNVGAKAKFESK
C5              --GAFGAQGP-KKKRSVFMPGKSLATATKLINQHLFGIQNVGAKAKFESK
C6              -----GGQGP-KKKRSVFMPGKSLATATKLINQHLFGIQNVGAKAKFESK
C7              GFGSTQGQGPQKKKRSVFMPGKSLATATKLINQHLFGIQNVGAKAKFESK
                      .*** ***************************************

C1              HSSSIDSIDASPNLEHHRRSKSILKNKSDISRVLSDPESERLLADNMSGS
C2              HSSSIDSIDASPNLEHHRRSKSILKNKSDISRVLSDPESERLLADNMSGS
C3              HSSSIDSIDASPNLEHHRRSKSILKNKSDISRVLSDPESERLLADNMSGS
C4              HSSSIDSIDASPNLEHHRRSKSILKNKSDISRVLSDPESERLLADNMSGS
C5              HSSSIDSIDASPNLEHHRRSKSILKNKSDISRVLSDPESERLLADNMSGS
C6              HSSSIDSIDASPNLEHHRRSKSILKNKSDISRVLSDPESERLLADNMSGS
C7              HSSSIDSIDASPNLEHHRRSKSILKNKSDISRVLSDPESERLLADNMSGS
                **************************************************

C1              GVSDNGTVMGESGSDYSPNKLPHSVLAKSISPPPLRHRTLMHQRSGPATL
C2              GVSDNGTVMGESGSDYSPNKLPHSVLAKSISPPPLRHRTLMHQRSGPATL
C3              GVSDNGTVMGESGSDYSPNKLPHSVLAKSISPPPLRHRTLMHQRSGPATL
C4              GVSDNGTVMGESGSDYSPNKLPHSVLAKSISPPPLRHRTLMHQRSGPATL
C5              GVSDNGTVMGESGSDYSPNKLPHSVLAKSISPPPLRHRTLMHQRSGPATL
C6              GVSDNGTVMGESGSDYSPNKLPHSVLAKSISPPPLRHRTLMHQRSGPATL
C7              GVSDNGTVMGESGSDYSPNKLPHSVLAKSISPPPLRHRTLMHQRSGPATL
                **************************************************

C1              QSKPTKFQTPRYPEEQALRQVKPLLSRGTPST------SASAGSADGQQT
C2              QSKPTKFQTPRYPEEQALRQVKPLLSRGTPST------SASAGSADGQQT
C3              QSKPTKFQTPRYPEEQALRQVKPLLSRGPPST------SASAGSADGQQT
C4              QSKPTKFQTPRYPEEQALRQVKPLLSRGAPSTSV----SASAGSADGQQT
C5              QSKPTKFQTPRYPEEQALRQVKPLLSRGPASTSA----SASAGSADGQQT
C6              QSKPTKFQTPRYPEEQALRQVKPLLSRAPPSTSA----SASAASADGQQT
C7              QSKPTKFQTPRYPEEQALRQVKPLPSRAPSSTSASASASAAAASADGQQT
                ************************ **...**      **:*.*******

C1              RDSSLDSETTFTSPVSHRAGEDPPT---APPSQAAV-ATGQEDREEEGEA
C2              RDSSLDSETTFTSPVSQRAGEDPPT---AAPSQAAV-PPAQEDREEEGEA
C3              RDSSLDSETTFTSPVSHRAGEDAPT---APPSQAAV-PPGQEDREEEGEA
C4              RDSSLDSETTFTSPVSTRAGEDPPT---AAPSQVPV-GSGQDDREEEGEA
C5              RDSSLDSETTFTSPVSSRAGEDPPAG--STPSQVAG-PPGQEEREEEGEA
C6              RDSSLDSETTFTSPVSSRAGEDQPTAG-QVPSQVPV-APGQEDRDEEGEA
C7              RDSSLDSETTFTSPVSSRAGEDQPAAGSVVPSQVSGSVPGQEDREEEGEA
                **************** ***** *:     ***..   ..*::*:*****

C1              EANDEQRALLQGADTEEAKRAGNEGToooooooooooooooooooooo--
C2              EANDEQRALLQGGDAEEAKRAGNEGToooooo------------------
C3              EANDEQRALLQGGDAEEAKRAGNEGTooooooooooo-------------
C4              EANDEQRALLQGPDAEEAKRTGNEGToooooooooooooooooooooooo
C5              EANDEQRALLQGRDAEEAKRAGNEGToooooooooooooooooooooooo
C6              ESNDEQRALLQGVDAEEAKRAGNEGToooooooooooooooooooooooo
C7              EANDEQRALLQGRDAEEAKRSGNEGT------------------------
                *:********** *:*****:*****                        

C1              -------
C2              -------
C3              -------
C4              oo-----
C5              ooooooo
C6              ooo----
C7              -------
                       




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1624 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1624 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1624 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1624 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1624 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1624 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1624 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1624 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1624 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1624 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1624 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1624 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PN/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1