--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Tue Dec 06 14:08:52 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/388/Shab-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/388/Shab-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/388/Shab-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/388/Shab-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -7662.75         -7676.81
2      -7662.47         -7674.08
--------------------------------------
TOTAL    -7662.60         -7676.18
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/388/Shab-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/388/Shab-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/388/Shab-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.382173    0.000952    0.319733    0.441063    0.380479   1125.74   1128.46    1.000
r(A<->C){all}   0.148274    0.000328    0.113597    0.183676    0.147625   1171.76   1209.11    1.000
r(A<->G){all}   0.238447    0.000498    0.198102    0.285563    0.237902   1048.03   1090.21    1.000
r(A<->T){all}   0.132429    0.000478    0.089766    0.174949    0.131449   1033.69   1219.61    1.000
r(C<->G){all}   0.130101    0.000231    0.102467    0.161154    0.129872   1174.27   1186.88    1.000
r(C<->T){all}   0.279731    0.000676    0.230168    0.331405    0.279346    963.90    976.19    1.000
r(G<->T){all}   0.071017    0.000206    0.042909    0.098496    0.069844   1066.94   1135.46    1.000
pi(A){all}      0.238739    0.000057    0.223955    0.253336    0.238657   1082.92   1149.87    1.000
pi(C){all}      0.285546    0.000062    0.269770    0.299976    0.285692   1177.26   1200.19    1.000
pi(G){all}      0.296244    0.000064    0.280427    0.311946    0.296215   1051.01   1066.21    1.000
pi(T){all}      0.179470    0.000045    0.166966    0.193650    0.179467    987.43   1179.92    1.000
alpha{1,2}      0.282310    0.003113    0.186096    0.397527    0.276641    867.07    991.21    1.000
alpha{3}        1.895751    0.473930    0.759707    3.304258    1.789710    956.79   1067.61    1.000
pinvar{all}     0.665764    0.001300    0.599108    0.735645    0.670332    686.50    762.87    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-6617.465061
Model 2: PositiveSelection	-6604.744526
Model 0: one-ratio	-6782.098907
Model 3: discrete	-6604.227619
Model 7: beta	-6623.950015
Model 8: beta&w>1	-6604.773812


Model 0 vs 1	329.26769199999944

Model 2 vs 1	25.441069999998945

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Shab-PA)

            Pr(w>1)     post mean +- SE for w

    51 T      0.670         2.409
    56 H      0.778         2.635
    58 K      0.619         2.300
    59 Q      0.513         2.077
    66 Q      0.573         2.203
    68 Q      0.528         2.109
   120 A      0.633         2.331
   154 S      0.553         2.162
   173 P      0.510         2.071
   174 A      0.714         2.500
   176 V      0.695         2.461
   177 G      0.501         2.054
   178 S      0.973*        3.044
   179 G      0.512         2.075
   180 A      0.872         2.833
   181 G      0.767         2.611
   182 A      0.584         2.227
   183 S      0.768         2.614
   184 V      0.834         2.752
   185 T      0.712         2.496
   187 T      0.748         2.572
   190 G      0.507         2.066
   191 S      0.972*        3.042
   194 S      0.972*        3.041
   195 G      0.878         2.846
   246 H      0.748         2.571
   832 G      0.870         2.828
   855 A      0.542         2.139
   863 A      0.659         2.385
   865 G      0.514         2.080

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Shab-PA)

            Pr(w>1)     post mean +- SE for w

    51 T      0.827         2.770 +- 0.951
    53 Q      0.541         2.084 +- 1.194
    56 H      0.894         2.918 +- 0.814
    57 S      0.559         2.128 +- 1.195
    58 K      0.791         2.685 +- 0.997
    59 Q      0.719         2.530 +- 1.055
    60 Q      0.691         2.454 +- 1.111
    66 Q      0.767         2.640 +- 1.013
    68 Q      0.720         2.520 +- 1.079
    73 K      0.520         2.029 +- 1.210
   120 A      0.807         2.726 +- 0.960
   139 G      0.634         2.312 +- 1.161
   149 P      0.672         2.422 +- 1.085
   154 S      0.737         2.560 +- 1.081
   157 L      0.535         2.070 +- 1.197
   160 G      0.643         2.334 +- 1.157
   173 P      0.700         2.471 +- 1.116
   174 A      0.859         2.845 +- 0.884
   176 V      0.847         2.815 +- 0.902
   177 G      0.692         2.453 +- 1.124
   178 S      0.987*        3.114 +- 0.558
   179 G      0.702         2.476 +- 1.116
   180 A      0.942         3.022 +- 0.701
   181 G      0.889         2.910 +- 0.828
   182 A      0.762         2.618 +- 1.054
   183 S      0.889         2.912 +- 0.827
   184 V      0.923         2.982 +- 0.749
   185 T      0.858         2.842 +- 0.886
   187 T      0.878         2.887 +- 0.848
   190 G      0.698         2.467 +- 1.121
   191 S      0.986*        3.113 +- 0.560
   194 S      0.986*        3.113 +- 0.560
   195 G      0.944         3.029 +- 0.696
   222 I      0.537         2.102 +- 1.132
   243 V      0.576         2.170 +- 1.190
   246 H      0.878         2.886 +- 0.847
   822 I      0.505         1.996 +- 1.191
   829 A      0.678         2.419 +- 1.134
   830 T      0.692         2.469 +- 1.073
   832 G      0.941         3.020 +- 0.704
   855 A      0.742         2.583 +- 1.035
   860 P      0.600         2.236 +- 1.156
   863 A      0.824         2.762 +- 0.936
   865 G      0.708         2.492 +- 1.100
   866 G      0.519         2.034 +- 1.183
   873 G      0.527         2.063 +- 1.166


Model 8 vs 7	38.352405999999974

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Shab-PA)

            Pr(w>1)     post mean +- SE for w

    51 T      0.697         2.371
    56 H      0.799         2.573
    58 K      0.654         2.286
    59 Q      0.555         2.092
    60 Q      0.535         2.052
    66 Q      0.608         2.197
    68 Q      0.569         2.120
   120 A      0.668         2.315
   149 P      0.505         1.994
   154 S      0.587         2.154
   173 P      0.547         2.076
   174 A      0.737         2.451
   176 V      0.724         2.424
   177 G      0.538         2.059
   178 S      0.973*        2.914
   179 G      0.548         2.079
   180 A      0.881         2.733
   181 G      0.784         2.543
   182 A      0.615         2.209
   183 S      0.786         2.546
   184 V      0.847         2.667
   185 T      0.736         2.448
   187 T      0.768         2.511
   190 G      0.544         2.070
   191 S      0.972*        2.912
   194 S      0.972*        2.912
   195 G      0.885         2.740
   246 H      0.769         2.514
   829 A      0.524         2.032
   830 T      0.528         2.038
   832 G      0.879         2.730
   855 A      0.582         2.145
   863 A      0.693         2.364
   865 G      0.552         2.086

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Shab-PA)

            Pr(w>1)     post mean +- SE for w

    51 T      0.921         2.805 +- 0.827
    53 Q      0.660         2.114 +- 1.278
    54 Q      0.613         1.984 +- 1.292
    56 H      0.975*        2.939 +- 0.616
    57 S      0.674         2.151 +- 1.271
    58 K      0.911         2.776 +- 0.855
    59 Q      0.882         2.706 +- 0.915
    60 Q      0.821         2.543 +- 1.071
    66 Q      0.904         2.765 +- 0.860
    68 Q      0.858         2.638 +- 0.992
    73 K      0.621         2.010 +- 1.311
   120 A      0.938         2.846 +- 0.757
   139 G      0.756         2.370 +- 1.181
   149 P      0.854         2.636 +- 0.973
   154 S      0.842         2.601 +- 1.037
   157 L      0.651         2.090 +- 1.286
   160 G      0.763         2.390 +- 1.171
   173 P      0.813         2.523 +- 1.092
   174 A      0.953*        2.885 +- 0.708
   176 V      0.954*        2.887 +- 0.701
   177 G      0.804         2.500 +- 1.109
   178 S      0.998**       2.992 +- 0.511
   179 G      0.813         2.524 +- 1.093
   180 A      0.988*        2.969 +- 0.560
   181 G      0.965*        2.915 +- 0.662
   182 A      0.861         2.649 +- 0.997
   183 S      0.965*        2.916 +- 0.661
   184 V      0.984*        2.959 +- 0.580
   185 T      0.953*        2.884 +- 0.709
   187 T      0.961*        2.906 +- 0.677
   190 G      0.808         2.510 +- 1.104
   191 S      0.998**       2.992 +- 0.512
   194 S      0.998**       2.992 +- 0.512
   195 G      0.986*        2.963 +- 0.574
   222 I      0.731         2.308 +- 1.172
   243 V      0.693         2.202 +- 1.254
   246 H      0.966*        2.916 +- 0.657
   822 I      0.627         2.023 +- 1.295
   829 A      0.795         2.474 +- 1.124
   830 T      0.868         2.670 +- 0.945
   832 G      0.988*        2.969 +- 0.560
   855 A      0.895         2.740 +- 0.883
   860 P      0.749         2.352 +- 1.176
   863 A      0.950*        2.877 +- 0.713
   864 E      0.674         2.154 +- 1.233
   865 G      0.831         2.571 +- 1.052
   866 G      0.651         2.088 +- 1.277
   873 G      0.680         2.167 +- 1.245

>C1
MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQA
TQQQQHSKQQQQQQQQQQQQLQLKQHQQQQQDILYQQHNEAIAIARGLQA
ATPADIGDNQPYYDTSGNVDWERAMGAGGAGAYGGIGIGSLPAAGGAAYH
LGPANPAGLVSRHLDYGDGGHLAGPSAGLPAGAVGSGAGAGAGAGASVTG
SGSGAGTGTGTGAGSGSGSGAAGKEVRYAPFPVASPTHSIPTTSQQIVGS
VGGVGVGGASSQSISGGVPTHSQSNTTGALQRTHSRSMSSIPPPEPFMIA
QSKAVNSRVSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCD
DYSLADNEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGV
DELYLESCCQHKYHQRKENVHEEMRKEAESLRQRDEEEFGEGKCAEYQKY
LWELLEKPNTSFAARVIAVISILFIVLSTIALTLNTLPQLQHIDNGTPQD
NPQLAMVEAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAILPYFV
SLFLLETNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTL
RNSYKELGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFWWAGIT
MTTVGYGDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQM
RREKALKRREALDRAKREGSIVSFHHINLKDAFAKSMDLIDVIVDTGHNL
SQTDGNSTEGESTSGRNPATTGTGCYKNYDHVANLRNSNLHNRRGSSSEQ
DAVPPYSFDNPNARQTSMMAMESYRREQQALLQQQQQQQQQMLQMQQIQQ
KAPNGNGGATGGGVANNLAMVAASSAATAVATATNASNASNTAPGSEGAE
GGGDGDGGGVDDDNLSQAKGLPIQMMITPGEVAELRRQVALENLQNQRMD
NLEQDVPVEFECCFCTTKGLPGCHGECIPLRANSVooooooooooooooo
o
>C2
MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQCGQAAGQQQQQQQA
TQQQQLSKQQQQQQQHQQQQLQLKQQQQQQQQQQQQDILYQQHNEAIAIA
RGLQAATPADIGDNQPYYDTSGNVDWERAMGTGGAGAYGGIGIGSLPAAG
GAAYHLGPANTAGLVSRHLDYADGGHLAGPSAGLPAGAVGSGAGAGTGAS
AGASVTGSGAGAGSGATGTGTGTGTGAGSGSGGGAAGKEVRYAPFPVASP
THSIPTTSQQIVGSVGGGGVGGASSQSISGGVPTHSQSNTTGALQRTHSR
SMSSIPPPEPFMIAQSKAVNSRVSINVGGVRHEVLWRTLERLPHTRLGRL
RECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSILNFYRTGKLHIVDEM
CVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHEEMRKEAESLRQRDE
EEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISILFIVLSTIALTLNT
LPQLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILRFSASPDKWKFFKGG
LNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVVQVFRIMRILRILKL
ARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAEKDEKDTK
FVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTVCCICGVLVIALPIP
IIVNNFAEFYKNQMRREKALKRREALDRAKREGSIVSFHHINLKDAFAKS
MDLIDVIVDTGHNLSQTDGNSTEGESTSGRNPATTGTGCYKNYDHVANLR
NSNLHNRRGSSSEQDAVPPYSFDNPNARQTSMMAMESYRREQQALLLQQQ
QQQQQQMLQMQQIQQKAPNGNGGATGGGGVANNLAMVAASSAATAVATAT
NASNASNTAPGTEGAEGGGDGDGGVVDDDNLSQAKGLPIQMMITPGEVAE
LRRQVALENLQNQRMDNLEQDVPVEFECCFCTTKGLPGCHGECIPLRANS
V
>C3
MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQCGQAAGQQQQQQQA
TQQQQHSKQQQQQQQQQQQQQLQLKQQQQQDILYQQHNEAVAIARGLQAA
TPADIGDNQPYYDTSGNVDWERAMGTGGAGAYGGIGIGSIPAAGGAAYHL
GPANPAGLVSRHLDYTDGGHLAGPSAGLPAGAVGSGAGAGAGTGAGAGAS
VTGSGSGSGAGPGTGTGAGSGSGSGAAGKEVRYAPFPVASPTHSIPTTSQ
QIVGSVGGGGVGGASSQSISGGVPTHSQSNTTGALQRTHSRSMSSIPPPE
PFMIAQSKAVNSRVSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAI
VELCDDYSLADNEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDL
EYWGVDELYLESCCQHKYHQRKENVHEEMRKEAESLRQRDEEEFGEGKCA
EYQKYLWELLEKPNTSFAARVIAVISILFIVLSTIALTLNTLPQLQHIDN
GTPQDNPQLAMVEAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAI
LPYFVSLFLLETNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQS
LGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFW
WAGITMTTVGYGDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAEF
YKNQMRREKALKRREALDRAKREGSIVSFHHINLKDAFAKSMDLIDVIVD
TGHNLSQTDGNSTEGESTSGRNPATTGTGCYKNYDHVANLRNSNLHNRRG
SSSEQDAVPPYSFDNPNARQTSMMAMESYRREQQALLLQQQQQQQQQQQM
LQMQQTQQKAPNGNGGATGGGVANNLAMVAASSAATAVATATNATNASNT
APGSEGAEGGGDGDGGGVDDDNLSQAKGLPIQMMITPGEVAELRRQVALE
NLQNQRMDNLEQDVPVEFECCFCTTKGLPGCHGECIPLRANSVooooooo
o
>C4
MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQA
TQQQQLSKQHQQQQQLQLKQQQQQQQQQQQQQQQQDILYQQHNEAIAIAR
GLQAATPADLGDNQPYYDTSGNVDWERAMGAGGAGAYGGIGIGSLPAAGG
AAYHLGPANPAGLVSRHLDYADGGHLAGPSAGLPLAAVPGSGAVSAAVSG
AGSGGAGSGGAGAGAGAVTGSGPAAAGKEVRYAPFPVASPTHSIPTTSQQ
IVGSVGGGGVGGGGGGSQSISGGGPTHSQSNTTGALQRTHSRSMSSIPPP
EPFMIAQSKAVNSRVSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEA
IVELCDDYSLADNEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDD
LEYWGVDELYLESCCQHKYHQRKENVHEEMRKEAESLRQRDEEEFGEGKC
AEYQKYLWELLEKPNTSFAARVIAVISILFIVLSTIALTLNTLPQLQHID
NGTPQDNPQLAMVEAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLA
ILPYFVSLFLLETNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQ
SLGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETF
WWAGITMTTVGYGDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAE
FYKNQMRREKALKRREALDRAKREGSIVSFHHINLKDAFAKSMDLIDVIV
DTGHNLSQTDGNSTEGESTSGRNPATTGTGCYKNYDHVANLRNSNLHNRR
GSSSEQDAVPPYSFDNPNARQTSMMAMESYRREQQALQLQQQQQQQQQQQ
MLQMQQIQQKAPNGGGSGSGVANNLAMVAASSAATAVATATNTTNTSNTA
QGSEGAEGGGGEDGGGVDDDNLSQAKGLPIQMMITPGEVAELRRQVALEN
LQNQRMDNLEQDVPVEFECCFCTTKGLPGCHGECIPLRANSVoooooooo
o
>C5
MVGERDRDREAVRWATGELTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQA
TQQQQLSKQQQQQQQLQLKQQQQQQQQQQQDILYQQHNEAIAIARGLQAA
TPADIGDNQPYYDTSGNVDWERAMGTGGAGAYGGIGIGSLPAAGGAPYHL
GPANPAGLVSRHMDYADGGHLAGPSAGLPAGAVGAGTGSGLVSGGSAVAG
PGAGSGAGTGSAGGAAGKEVRYAPFPVASPTHSIPTTSQQIVGSVGGGGV
GGASSQSISGGVPTHSQSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAVN
SRVSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCDDYSLAD
NEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLE
SCCQHKYHQRKENVHEEMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLE
KPNTSFAARVIAVISILFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAM
VEAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLE
TNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNSYKE
LGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGY
GDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQMRREKAL
KRREALDRAKREGSIVSFHHINLKDAFAKSMDLIDVIVDTGHNLSQTDGN
STEGESTSGRNPATTGTGCYKNYDHVANLRNSNLHNRRGSSSEQDAVPPY
SFDNPNARQTSMMAMESYRREQQALLLQQQQQQQQQTQQQMLQMQQIQQK
APNGGGSGSGVANNLAMVAASSAATAVATATNASNNSNIAPGSAEGAEGG
DGAGVDDDNLSQAKGLPIQMMITPGEVAELRRQVALENLQNQRMDNLEQD
VPVEFECCFCTTKGLPGCHGECIPLRANSVoooooooooooooooooooo
o
>C6
MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQQ
QQATQQQQQQHAKQQQQQQQLKQQQHQQELLYQQHNEAIAIARGLQAATP
ADVGDNQPYYDTSGNVDWERAMGAGGAGAYGGVGIGSLPAGGGAAYHLGP
ANAAGLVPRHLDYADGGHLAGPSAGLSAGALAAGAGTAAVGGAAGAPGGA
GQGGTAAGSKEVRYAPFPVASPTHSIPTTSNQQLGGSVVGGGGVGGASSQ
SISGGVPTAHSQSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAVNSRVSI
NVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFF
DRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQH
KYHQRKENVHEEMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTS
FAARVIAVISILFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAMVEAVC
ITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNA
TDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLM
LFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYP
TTALGKVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREA
LDRAKREGSIVSFHHINLKDAFAKSMDLIDVIVDTGHNLSQTDGNSTEGE
STSGRNPATTGTGCYKNYDHVANLRNSNLHNRRGSSSEQDAVPPYSFDNP
NARQTSMMAMESYRREQQALLLQQQQQQQQMLQMQQIQKAPNGGGAAQGV
TNNLAIMAASSAATAVATASTSNTSNTAQGSEGQGAEGGGEGADEDNLSQ
AKGLPIQMMITPGEVAELRRQVALENLQNQRMDNLEQDVPVEFECCFCTT
KGLPGCHGECIPLRANSVoooooooooooooooooooooooooooooooo
o
>C7
MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQA
TQQQQQQLSRQQQQQQQQQQQQQQQQQLQHKQQQDILYQQHNEAIAIARG
LQAATPADIGDNQPYYDTSGNVDWERAMGTGGAGAYGGIGIGSLPAAGGA
AYHLGPANPAGLVPRHMDYADGGHLAGPSAGLPAGGVGGPAVTGSGSTGA
GAGAGTGPGAGAAGKEVRYAPFPVASPTHSIPTTSQQIVGSVGGGGVGGA
TSSQSISGGGGGGVPTNHSQSNTTGALQRTHSRSMSSIPPPEPFMIAQSK
AVNSRVSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCDDYS
LADNEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGVDEL
YLESCCQHKYHQRKENVHEEMRKEAESLRQRDEEEFGEGKCAEYQKYLWE
LLEKPNTSFAARVIAVISILFIVLSTIALTLNTLPQLQHIDNGTPQDNPQ
LAMVEAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAILPYFVSLF
LLETNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNS
YKELGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFWWAGITMTT
VGYGDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQMRRE
KALKRREALDRAKREGSIVSFHHINLKDAFAKSMDLIDVIVDTGHNLSQT
DGNSTEGESTSGRNPATTGTGCYKNYDHVANLRNSNLHNRRGSSSEQDAV
PPYSFDNPNARQTSMMAMESYRREQQALLLQQQQQQQQQQQQQMLQMQQM
QQKAPNGGGTGSGVANNLAMVAASSAATAVATASSSNTAQGSEGAAEGGG
GEGGGADEDNLSQAKGLPIQMMITPGEVAELRRQVALENLQNQRMDNLEQ
DVPVEFECCFCTTKoooooooooooooooooooooooooooooooooooo
o
>C8
MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQA
TQQQQQQLTRQQQQLQQQQHKQQQQDILYQQQNEAIAIARGLQAATPADI
GDNQPYYDTSGNVDWERAMGAGGAGAYGGLGIGSLPAAGHVAYHLGPANA
PGLAARHLDYADGGHLAGPSAGVSVGSGAVSITGSGSGGAIGAGGAAGAA
GAAGATAAGKEVRYAPFPVASPTHSIPTTSQQIVGSVGGGGVGGATSSQS
ISGGGGGGGGAPTNPSQSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAAN
SRVSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCDDYSLAD
NEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLE
SCCQHKYHQRKENVHEEMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLE
KPNTSFAARVIAVISILFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAM
VEAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLE
TNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNSYKE
LGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGY
GDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQMRREKAL
KRREALDRAKREGSIVSFHHINLKDAFAKSMDLIDVIVDTGHNLSQTDGN
STEGESTSGRNPATTGTGCYKNYDHVANLRNSNLHHRRGSSSEQDAVPPY
NFDNPNARQTSMMAMESYRREQQALLLQQQQQQQKQQQQQQQMLQMQQMQ
QKAAPNGGATGSGVANNLAIVAASSAATAVATASSSNTAPGSEVAEGGGG
DGGGGEEGVADDDNLSQAKGLPIQMMITPGEVAELRRQVALENLQNQRMD
NLEQDVPVEFECCFCTTKGLPGCHGECIPLRANSVooooooooooooooo
o
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=8, Len=1059 

C1              MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQA
C2              MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQCGQAAGQQQQQQQA
C3              MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQCGQAAGQQQQQQQA
C4              MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQA
C5              MVGERDRDREAVRWATGELTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQA
C6              MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQQ
C7              MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQA
C8              MVGERDRDREAVRWATGESTPLQTNNGVLQMVGQLQGGQAAGQQQQQQQA
                ****************** ***************** ************ 

C1              TQQQQHSKQQQQQQQQQQQQLQLKQHQQQQQ-----DILYQQHNEAIAIA
C2              TQQQQLSKQQQQQQQHQQQQLQLKQQQQQQQQQQQQDILYQQHNEAIAIA
C3              TQQQQHSKQQQQQQQQQQQQ-QLQLKQQQQQ-----DILYQQHNEAVAIA
C4              TQQQQLSKQHQQQQQLQLKQQQQQQQQQQQQQQQQ-DILYQQHNEAIAIA
C5              TQQQQLSKQQQQQQQLQLKQ-QQQQQQQQQQ-----DILYQQHNEAIAIA
C6              QQATQQQQQQHAKQQQQQQQLKQQQHQQ--------ELLYQQHNEAIAIA
C7              TQQQQQQLSRQQQQQQQQQQQQQQQQQLQHKQQQ--DILYQQHNEAIAIA
C8              TQQQQQQLTRQQQQLQQQQHKQQQQ-----------DILYQQQNEAIAIA
                 *  * .  :: :*  * :: : :            ::****:***:***

C1              RGLQAATPADIGDNQPYYDTSGNVDWERAMGAGGAGAYGGIGIGSLPAAG
C2              RGLQAATPADIGDNQPYYDTSGNVDWERAMGTGGAGAYGGIGIGSLPAAG
C3              RGLQAATPADIGDNQPYYDTSGNVDWERAMGTGGAGAYGGIGIGSIPAAG
C4              RGLQAATPADLGDNQPYYDTSGNVDWERAMGAGGAGAYGGIGIGSLPAAG
C5              RGLQAATPADIGDNQPYYDTSGNVDWERAMGTGGAGAYGGIGIGSLPAAG
C6              RGLQAATPADVGDNQPYYDTSGNVDWERAMGAGGAGAYGGVGIGSLPAGG
C7              RGLQAATPADIGDNQPYYDTSGNVDWERAMGTGGAGAYGGIGIGSLPAAG
C8              RGLQAATPADIGDNQPYYDTSGNVDWERAMGAGGAGAYGGLGIGSLPAAG
                **********:********************:********:****:**.*

C1              GAAYHLGPANPAGLVSRHLDYGDGGHLAGPSAGLPAGAV-GSGAGAGAG-
C2              GAAYHLGPANTAGLVSRHLDYADGGHLAGPSAGLPAGAV-GSGAGAGTG-
C3              GAAYHLGPANPAGLVSRHLDYTDGGHLAGPSAGLPAGAV-GSGAGAGAGT
C4              GAAYHLGPANPAGLVSRHLDYADGGHLAGPSAGLPLAAVPGSGAVSAAVS
C5              GAPYHLGPANPAGLVSRHMDYADGGHLAGPSAGLPAGAV-GAGTGSGLVS
C6              GAAYHLGPANAAGLVPRHLDYADGGHLAGPSAGLSAGALAAGAGT-----
C7              GAAYHLGPANPAGLVPRHMDYADGGHLAGPSAGLPAGGVGGPAVT-----
C8              HVAYHLGPANAPGLAARHLDYADGGHLAGPSAGVSVG-SGAVSIT-----
                 ..*******..**..**:** ***********:. .   . .       

C1              ---AGASVTGSGSG-------AGTGTGTGAGSGSGSGAAGKEVRYAPFPV
C2              -ASAGASVTGSGAGAGSGATGTGTGTGTGAGSGSGGGAAGKEVRYAPFPV
C3              GAGAGASVTGSGSGS-----GAGPGTGTGAGSGSGSGAAGKEVRYAPFPV
C4              ----GAGSGGAGSG--------GAGAGAGAVTGSGPAAAGKEVRYAPFPV
C5              ---GGSAVAG-------------PGAGSGAGTGSAGGAAGKEVRYAPFPV
C6              -----AAVGG------------AAGAPGGAGQG-GTAAGSKEVRYAPFPV
C7              ----GSGS-------------TGAG--AGAGTGPGAGAAGKEVRYAPFPV
C8              ----GSGSGGA----------IGAGGAAGAAGAAGATAAGKEVRYAPFPV
                     :.                .*   **  . .  *..**********

C1              ASPTHSIPTTSQQIVG--SVGGVGVGG--ASSQSISGG------VPTH-S
C2              ASPTHSIPTTSQQIVG--SVGGGGVGG--ASSQSISGG------VPTH-S
C3              ASPTHSIPTTSQQIVG--SVGGGGVGG--ASSQSISGG------VPTH-S
C4              ASPTHSIPTTSQQIVG--SVGGGGVGGGGGGSQSISGG------GPTH-S
C5              ASPTHSIPTTSQQIVG--SVGGGGVGG--ASSQSISGG------VPTH-S
C6              ASPTHSIPTTSNQQLGGSVVGGGGVGG--ASSQSISGG------VPTAHS
C7              ASPTHSIPTTSQQIVG--SVGGGGVGG-ATSSQSISGGGGGG--VPTNHS
C8              ASPTHSIPTTSQQIVG--SVGGGGVGG-ATSSQSISGGGGGGGGAPTNPS
                ***********:* :*   *** ****   .*******       **  *

C1              QSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAVNSRVSINVGGVRHEVLW
C2              QSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAVNSRVSINVGGVRHEVLW
C3              QSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAVNSRVSINVGGVRHEVLW
C4              QSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAVNSRVSINVGGVRHEVLW
C5              QSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAVNSRVSINVGGVRHEVLW
C6              QSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAVNSRVSINVGGVRHEVLW
C7              QSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAVNSRVSINVGGVRHEVLW
C8              QSNTTGALQRTHSRSMSSIPPPEPFMIAQSKAANSRVSINVGGVRHEVLW
                ********************************.*****************

C1              RTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSIL
C2              RTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSIL
C3              RTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSIL
C4              RTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSIL
C5              RTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSIL
C6              RTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSIL
C7              RTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSIL
C8              RTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSIL
                **************************************************

C1              NFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHE
C2              NFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHE
C3              NFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHE
C4              NFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHE
C5              NFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHE
C6              NFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHE
C7              NFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHE
C8              NFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHE
                **************************************************

C1              EMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISI
C2              EMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISI
C3              EMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISI
C4              EMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISI
C5              EMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISI
C6              EMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISI
C7              EMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISI
C8              EMRKEAESLRQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISI
                **************************************************

C1              LFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILR
C2              LFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILR
C3              LFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILR
C4              LFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILR
C5              LFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILR
C6              LFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILR
C7              LFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILR
C8              LFIVLSTIALTLNTLPQLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILR
                **************************************************

C1              FSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVV
C2              FSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVV
C3              FSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVV
C4              FSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVV
C5              FSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVV
C6              FSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVV
C7              FSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVV
C8              FSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVV
                **************************************************

C1              QVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFS
C2              QVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFS
C3              QVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFS
C4              QVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFS
C5              QVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFS
C6              QVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFS
C7              QVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFS
C8              QVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFS
                **************************************************

C1              SLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTV
C2              SLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTV
C3              SLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTV
C4              SLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTV
C5              SLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTV
C6              SLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTV
C7              SLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTV
C8              SLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTV
                **************************************************

C1              CCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV
C2              CCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV
C3              CCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV
C4              CCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV
C5              CCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV
C6              CCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV
C7              CCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV
C8              CCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV
                **************************************************

C1              SFHHINLKDAFAKSMDLIDVIVDTGHNLSQTDGNSTEGESTSGRNPATTG
C2              SFHHINLKDAFAKSMDLIDVIVDTGHNLSQTDGNSTEGESTSGRNPATTG
C3              SFHHINLKDAFAKSMDLIDVIVDTGHNLSQTDGNSTEGESTSGRNPATTG
C4              SFHHINLKDAFAKSMDLIDVIVDTGHNLSQTDGNSTEGESTSGRNPATTG
C5              SFHHINLKDAFAKSMDLIDVIVDTGHNLSQTDGNSTEGESTSGRNPATTG
C6              SFHHINLKDAFAKSMDLIDVIVDTGHNLSQTDGNSTEGESTSGRNPATTG
C7              SFHHINLKDAFAKSMDLIDVIVDTGHNLSQTDGNSTEGESTSGRNPATTG
C8              SFHHINLKDAFAKSMDLIDVIVDTGHNLSQTDGNSTEGESTSGRNPATTG
                **************************************************

C1              TGCYKNYDHVANLRNSNLHNRRGSSSEQDAVPPYSFDNPNARQTSMMAME
C2              TGCYKNYDHVANLRNSNLHNRRGSSSEQDAVPPYSFDNPNARQTSMMAME
C3              TGCYKNYDHVANLRNSNLHNRRGSSSEQDAVPPYSFDNPNARQTSMMAME
C4              TGCYKNYDHVANLRNSNLHNRRGSSSEQDAVPPYSFDNPNARQTSMMAME
C5              TGCYKNYDHVANLRNSNLHNRRGSSSEQDAVPPYSFDNPNARQTSMMAME
C6              TGCYKNYDHVANLRNSNLHNRRGSSSEQDAVPPYSFDNPNARQTSMMAME
C7              TGCYKNYDHVANLRNSNLHNRRGSSSEQDAVPPYSFDNPNARQTSMMAME
C8              TGCYKNYDHVANLRNSNLHHRRGSSSEQDAVPPYNFDNPNARQTSMMAME
                *******************:**************.***************

C1              SYRREQQALLQQQQQQQQ--Q-----MLQMQQIQQKAPNGNGGATGGG-V
C2              SYRREQQALLLQQQQQQQ--Q----QMLQMQQIQQKAPNGNGGATGGGGV
C3              SYRREQQALLLQQQQQQQ--QQ--QQMLQMQQTQQKAPNGNGGATGGG-V
C4              SYRREQQALQLQQQQQQQ--QQ--QQMLQMQQIQQKAPN--GGGSGSG-V
C5              SYRREQQALLLQQQQQQQ--QQTQQQMLQMQQIQQKAPN--GGGSGSG-V
C6              SYRREQQALLLQQQQQQQ-------QMLQMQQIQ-KAPN--GGGAAQG-V
C7              SYRREQQALLLQQQQQQQ--QQQQQQMLQMQQMQQKAP--NGGGTGSG-V
C8              SYRREQQALLLQQQQQQQKQQQQQQQMLQMQQMQQKAAP-NGGATGSG-V
                *********  *******        ****** * **.   **.:. * *

C1              ANNLAMVAASSAATAVATATNASNASNTAPGSEGAEGGGDGDGGG-----
C2              ANNLAMVAASSAATAVATATNASNASNTAPGTEGAEGGGDGDGGV-----
C3              ANNLAMVAASSAATAVATATNATNASNTAPGSEGAEGGGDGDGGG-----
C4              ANNLAMVAASSAATAVATATNTTNTSNTAQGSEGAEGGGGEDGGG-----
C5              ANNLAMVAASSAATAVATATNASNNSNIAPGS--AEGAEGGDGAG-----
C6              TNNLAIMAASSAATAVATAS-TSNTSNTAQGSEGQGAEGGGEGAD-----
C7              ANNLAMVAASSAATAVATAS----SSNTAQGSEGAAEGGGGEGGG-----
C8              ANNLAIVAASSAATAVATAS----SSNTAPGSE-VAEGGGGDGGGGEEGV
                :****::************:     ** * *:       . :*.      

C1              VDDDNLSQAKGLPIQMMITPGEVAELRRQVALENLQNQRMDNLEQDVPVE
C2              VDDDNLSQAKGLPIQMMITPGEVAELRRQVALENLQNQRMDNLEQDVPVE
C3              VDDDNLSQAKGLPIQMMITPGEVAELRRQVALENLQNQRMDNLEQDVPVE
C4              VDDDNLSQAKGLPIQMMITPGEVAELRRQVALENLQNQRMDNLEQDVPVE
C5              VDDDNLSQAKGLPIQMMITPGEVAELRRQVALENLQNQRMDNLEQDVPVE
C6              --EDNLSQAKGLPIQMMITPGEVAELRRQVALENLQNQRMDNLEQDVPVE
C7              ADEDNLSQAKGLPIQMMITPGEVAELRRQVALENLQNQRMDNLEQDVPVE
C8              ADDDNLSQAKGLPIQMMITPGEVAELRRQVALENLQNQRMDNLEQDVPVE
                  :***********************************************

C1              FECCFCTTKGLPGCHGECIPLRANSVoooooooooooooooo--------
C2              FECCFCTTKGLPGCHGECIPLRANSV------------------------
C3              FECCFCTTKGLPGCHGECIPLRANSVoooooooo----------------
C4              FECCFCTTKGLPGCHGECIPLRANSVooooooooo---------------
C5              FECCFCTTKGLPGCHGECIPLRANSVooooooooooooooooooooo---
C6              FECCFCTTKGLPGCHGECIPLRANSVoooooooooooooooooooooooo
C7              FECCFCTTKooooooooooooooooooooooooooooooooooooo----
C8              FECCFCTTKGLPGCHGECIPLRANSVoooooooooooooooo--------
                *********                                         

C1              ---------
C2              ---------
C3              ---------
C4              ---------
C5              ---------
C6              ooooooooo
C7              ---------
C8              ---------
                         




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1001 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1001 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/388/Shab-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Tot