--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Dec 06 13:44:55 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/388/Sh3beta-PD/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1376.43 -1386.23
2 -1376.33 -1385.10
--------------------------------------
TOTAL -1376.38 -1385.82
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.245947 0.003421 0.143919 0.356169 0.237742 919.75 972.01 1.000
r(A<->C){all} 0.121452 0.001667 0.045269 0.200004 0.118120 677.66 761.03 1.004
r(A<->G){all} 0.200509 0.002966 0.096745 0.305449 0.195137 538.05 560.51 1.000
r(A<->T){all} 0.064904 0.002136 0.000031 0.155143 0.056065 473.08 511.44 1.002
r(C<->G){all} 0.055005 0.000722 0.007483 0.105874 0.051649 821.65 838.37 1.001
r(C<->T){all} 0.461794 0.007688 0.300553 0.637470 0.458618 509.84 542.51 1.000
r(G<->T){all} 0.096337 0.002009 0.024136 0.195141 0.091447 690.87 724.05 1.001
pi(A){all} 0.292734 0.000275 0.263970 0.328779 0.292694 975.36 1183.48 1.000
pi(C){all} 0.252308 0.000256 0.224027 0.287139 0.252021 660.18 907.27 1.002
pi(G){all} 0.324905 0.000292 0.290451 0.356492 0.324760 1215.40 1244.71 1.000
pi(T){all} 0.130053 0.000154 0.106488 0.154858 0.129895 1094.80 1138.73 1.000
alpha{1,2} 0.131087 0.013099 0.000107 0.321803 0.110951 1147.56 1232.66 1.000
alpha{3} 1.168827 0.423586 0.189351 2.509427 1.025760 1351.59 1394.81 1.000
pinvar{all} 0.471747 0.019497 0.186225 0.711103 0.485187 871.46 940.02 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1196.659866
Model 2: PositiveSelection -1196.578461
Model 0: one-ratio -1204.191742
Model 3: discrete -1196.575152
Model 7: beta -1196.76739
Model 8: beta&w>1 -1196.57667
Model 0 vs 1 15.063752000000022
Model 2 vs 1 0.1628099999998085
Model 8 vs 7 0.38144000000011147
>C1
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAETEAEDKKTEAGDGDVDVKE
EAAEKAENEDGKDKENSKGEDEDADEENAEQKKLPATTTTTAASAKKTSD
SQSDLLLDSERAAAAQoooooo
>C2
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAEDKKPESGDGDVDVKE
EAAEKAENEDADDKDKENSKGEDEDADEENAEQKKLPATTTTTTAPARKT
SDSQSDLLLDSERAAAAQoooo
>C3
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAEDKKPESGDGDVDVKE
EAAEKAENEDADGKDKENSKGEDEDADEEKAEQKKLPATTTTTTAVPAKK
TSDSQSDLLLDSERAAAAQooo
>C4
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSNGGTVSDPEPRHPLPPQLFNDEEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAATDAEEKKPEAGDGGV
KEEEEAAEKAENEDADGEDKENSKGEAEDAEDSAEQKKLPATTTAAAPAA
AKKTSDSQSDLLLDSERAAAAQ
>C5
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSSGGTVSDPEPRHPLPPQLFNDEEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAVTDADAEAKKPEAGDG
GAKEEEEVAAEKAENEDDAGADKENSKGEDEDAEDSTEQKKSSTTTTAAA
AKKTSDSQSDLLLHSERAAAAQ
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=232
C1 MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
C2 MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
C3 MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
C4 MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
C5 MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
**************************************************
C1 MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF
C2 MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF
C3 MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF
C4 MQNKSTSNGGTVSDPEPRHPLPPQLFNDEEYCGDYDAFDMANEIDTLEVF
C5 MQNKSTSSGGTVSDPEPRHPLPPQLFNDEEYCGDYDAFDMANEIDTLEVF
*******.********************:*********************
C1 LKLAPADTTAVSTAQIELKQENGDAKKEEAETEAED------KKTEAGDG
C2 LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAED------KKPESGDG
C3 LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAED------KKPESGDG
C4 LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAAT--DAEEKKPEAGDG
C5 LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAVTDADAEAKKPEAGDG
*******************************:** **.*:***
C1 DVDVKEE-AAEKAENEDG--KDKENSKGEDEDADEENAEQKKLPATTTTT
C2 DVDVKEE-AAEKAENEDADDKDKENSKGEDEDADEENAEQKKLPATTTTT
C3 DVDVKEE-AAEKAENEDADGKDKENSKGEDEDADEEKAEQKKLPATTTTT
C4 GVKEEEE-AAEKAENEDADGEDKENSKGEAEDA-EDSAEQKKLPATTTAA
C5 GAKEEEEVAAEKAENEDDAGADKENSKGEDEDA-EDSTEQKKSSTTTTAA
... :** ********* ******** *** *:.:**** .:***::
C1 AAS-AKKTSDSQSDLLLDSERAAAAQoooooo
C2 TAP-ARKTSDSQSDLLLDSERAAAAQoooo--
C3 TAVPAKKTSDSQSDLLLDSERAAAAQooo---
C4 APAAAKKTSDSQSDLLLDSERAAAAQ------
C5 A---AKKTSDSQSDLLLHSERAAAAQ------
: *:***********.********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5380]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [5380]--->[5140]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.278 Mb, Max= 30.551 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAETEAED------KKTEAGDG
DVDVKEE-AAEKAENEDG--KDKENSKGEDEDADEENAEQKKLPATTTTT
AAS-AKKTSDSQSDLLLDSERAAAAQoooooo
>C2
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAED------KKPESGDG
DVDVKEE-AAEKAENEDADDKDKENSKGEDEDADEENAEQKKLPATTTTT
TAP-ARKTSDSQSDLLLDSERAAAAQoooo--
>C3
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAED------KKPESGDG
DVDVKEE-AAEKAENEDADGKDKENSKGEDEDADEEKAEQKKLPATTTTT
TAVPAKKTSDSQSDLLLDSERAAAAQooo---
>C4
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSNGGTVSDPEPRHPLPPQLFNDEEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAAT--DAEEKKPEAGDG
GVKEEEE-AAEKAENEDADGEDKENSKGEAEDA-EDSAEQKKLPATTTAA
APAAAKKTSDSQSDLLLDSERAAAAQ------
>C5
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSSGGTVSDPEPRHPLPPQLFNDEEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAVTDADAEAKKPEAGDG
GAKEEEEVAAEKAENEDDAGADKENSKGEDEDA-EDSTEQKKSSTTTTAA
A---AKKTSDSQSDLLLHSERAAAAQ------
FORMAT of file /tmp/tmp3614882657618376062aln Not Supported[FATAL:T-COFFEE]
>C1
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAETEAED------KKTEAGDG
DVDVKEE-AAEKAENEDG--KDKENSKGEDEDADEENAEQKKLPATTTTT
AAS-AKKTSDSQSDLLLDSERAAAAQoooooo
>C2
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAED------KKPESGDG
DVDVKEE-AAEKAENEDADDKDKENSKGEDEDADEENAEQKKLPATTTTT
TAP-ARKTSDSQSDLLLDSERAAAAQoooo--
>C3
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAED------KKPESGDG
DVDVKEE-AAEKAENEDADGKDKENSKGEDEDADEEKAEQKKLPATTTTT
TAVPAKKTSDSQSDLLLDSERAAAAQooo---
>C4
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSNGGTVSDPEPRHPLPPQLFNDEEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAAT--DAEEKKPEAGDG
GVKEEEE-AAEKAENEDADGEDKENSKGEAEDA-EDSAEQKKLPATTTAA
APAAAKKTSDSQSDLLLDSERAAAAQ------
>C5
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSSGGTVSDPEPRHPLPPQLFNDEEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAVTDADAEAKKPEAGDG
GAKEEEEVAAEKAENEDDAGADKENSKGEDEDA-EDSTEQKKSSTTTTAA
A---AKKTSDSQSDLLLHSERAAAAQ------
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:232 S:94 BS:232
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 96.82 C1 C2 96.82
TOP 1 0 96.82 C2 C1 96.82
BOT 0 2 96.80 C1 C3 96.80
TOP 2 0 96.80 C3 C1 96.80
BOT 0 3 91.63 C1 C4 91.63
TOP 3 0 91.63 C4 C1 91.63
BOT 0 4 89.67 C1 C5 89.67
TOP 4 0 89.67 C5 C1 89.67
BOT 1 2 98.19 C2 C3 98.19
TOP 2 1 98.19 C3 C2 98.19
BOT 1 3 91.24 C2 C4 91.24
TOP 3 1 91.24 C4 C2 91.24
BOT 1 4 88.37 C2 C5 88.37
TOP 4 1 88.37 C5 C2 88.37
BOT 2 3 91.74 C3 C4 91.74
TOP 3 2 91.74 C4 C3 91.74
BOT 2 4 89.30 C3 C5 89.30
TOP 4 2 89.30 C5 C3 89.30
BOT 3 4 94.06 C4 C5 94.06
TOP 4 3 94.06 C5 C4 94.06
AVG 0 C1 * 93.73
AVG 1 C2 * 93.66
AVG 2 C3 * 94.01
AVG 3 C4 * 92.17
AVG 4 C5 * 90.35
TOT TOT * 92.78
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGTCTTGAAAGTCTACGTCAGCGGCATGTCCGGCAATAAGGAGGTGAA
C2 ATGGTCTTGAAAGTCTACGTCAGCGGCATGTCCGGCAATAAGGAGGTGAA
C3 ATGGTCTTGAAAGTCTACGTCAGCGGCATGTCCGGCAATAAGGAGGTGAA
C4 ATGGTCTTGAAAGTCTACGTCAGCGGCATGTCCGGCAATAAGGAGGTGAA
C5 ATGGTCTTGAAAGTCTACGTCAGCGGCATGTCCGGCAATAAGGAGGTGAA
**************************************************
C1 GAAGCGCCAGCAGCGCGTTCTGATGATCCTGGACAGCAAGAACATCAAGT
C2 GAAGCGCCAGCAGCGCGTTCTCATGATCCTGGACAGCAAGAACATCAAGT
C3 GAAGCGCCAGCAGCGCGTTCTCATGATCCTGGACAGCAAGAACATCAAGT
C4 GAAGCGCCAGCAGCGCGTTCTGATGATCCTGGACAGCAAGAACATCAAGT
C5 GAAGCGCCAGCAGCGCGTTCTGATGATCCTGGACAGCAAGAACATCAAGT
********************* ****************************
C1 ACGACACGGTGGACATCACGGAGCCCGGCAAGGAATCCGAGAAGGAGCTG
C2 ACGACACCGTGGACATCACGGAGCCCGGCAAGGAATCCGAGAAGGAGCTA
C3 ACGACACCGTGGACATCACGGAGCCCGGCAAGGAATCCGAGAAGGAGCTA
C4 ACGACACGGTGGACATCACGGAGCCCGGCAAGGAATCCGAGAAGGAGCTG
C5 ACGACACGGTAGACATCACGGAGCCCGGCAAGGAATCCGAAAAGGAGCTG
******* **.*****************************.********.
C1 ATGCAAAACAAATCGACAAGCAACGGTGGAACGGTCAGCGATCCAGAGCC
C2 ATGCAGAACAAATCGACGAGCAACGGCGGAACGGTCAGCGATCCAGAGCC
C3 ATGCAGAACAAATCGACGAGCAACGGCGGAACGGTCAGCGATCCAGAGCC
C4 ATGCAGAACAAATCGACGAGCAACGGCGGCACGGTCAGCGATCCAGAGCC
C5 ATGCAGAACAAATCGACGAGCAGCGGCGGCACGGTCAGCGATCCAGAGCC
*****.***********.****.*** **.********************
C1 CCGTCATCCGCTTCCTCCGCAGCTGTTCAACGACGACGAGTACTGCGGTG
C2 CCGTCATCCGCTTCCTCCGCAGCTGTTCAACGATGACGAGTACTGCGGTG
C3 CCGTCATCCGCTTCCTCCGCAGCTGTTCAACGATGACGAGTACTGCGGTG
C4 CCGTCATCCGCTTCCTCCGCAGCTCTTCAACGACGAAGAGTACTGCGGCG
C5 CCGCCATCCGCTTCCTCCGCAGCTCTTCAACGACGAAGAGTACTGCGGCG
*** ******************** ******** **.*********** *
C1 ATTACGACGCCTTTGACATGGCCAACGAGATCGATACCCTGGAGGTGTTC
C2 ACTACGACGCCTTCGACATGGCCAACGAGATCGATACCCTGGAGGTGTTC
C3 ACTACGACGCCTTCGACATGGCCAACGAGATCGATACCCTGGAGGTGTTC
C4 ACTACGACGCCTTCGACATGGCCAACGAGATCGACACCCTGGAGGTGTTC
C5 ACTACGACGCCTTCGACATGGCCAACGAGATCGACACCCTGGAGGTGTTC
* *********** ******************** ***************
C1 CTCAAGCTGGCTCCAGCCGACACCACGGCAGTTAGTACCGCCCAAATCGA
C2 CTCAAGCTGGCCCCAGCCGACACCACGGCGGTTAGTACCGCCCAAATCGA
C3 CTCAAGCTGGCCCCAGCCGACACCACGGCGGTTAGTACCGCCCAAATCGA
C4 CTCAAACTGGCACCCGCCGACACCACGGCGGTTAGCACCGCCCAAATCGA
C5 CTCAAACTGGCCCCAGCCGACACCACGGCGGTTAGTACCGCCCAAATCGA
*****.***** **.**************.***** **************
C1 ACTGAAGCAGGAGAACGGCGATGCCAAGAAGGAGGAGGCGGAAACGGAGG
C2 ACTGAAACAGGAGAACGGCGATGCCAAGAAGGAGGAGGCGGAAGCGGAGG
C3 ACTGAAACAGGAGAACGGCGATGCCAAGAAGGAGGAGGCGGAAGCGGAGG
C4 ACTGAAGCAGGAGAACGGCGATGCCAAGAAGGAGGAGGCAGAAGCGGAGG
C5 ACTGAAGCAGGAGAACGGCGATGCCAAGAAGGAGGAGGCTGAAGCGGAGG
******.******************************** ***.******
C1 CGGAGGAT------------------AAGAAAACGGAGGCCGGCGATGGC
C2 CGGAGGAT------------------AAGAAACCGGAGTCCGGCGATGGC
C3 CGGAGGAT------------------AAGAAACCGGAGTCCGGCGATGGC
C4 CGGCTACA------GATGCGGAGGAGAAGAAACCGGAGGCCGGCGATGGC
C5 CGGTAACGGATGCGGATGCGGAGGCAAAGAAACCGGAGGCCGGTGATGGC
*** .. ******.***** **** ******
C1 GATGTGGATGTCAAGGAGGAG---GCTGCTGAGAAGGCCGAGAACGAAGA
C2 GATGTGGATGTCAAGGAGGAG---GCTGCGGAGAAGGCCGAGAACGAAGA
C3 GATGTGGATGTCAAGGAGGAG---GCTGCGGAGAAGGCCGAGAACGAAGA
C4 GGTGTCAAGGAGGAGGAGGAG---GCTGCGGAGAAGGCCGAGAACGAAGA
C5 GGTGCCAAGGAGGAGGAGGAGGTGGCTGCGGAGAAGGCCGAGAATGAAGA
*.** .* *: .******** ***** ************** *****
C1 CGGC------AAGGACAAGGAGAATTCAAAGGGCGAGGATGAAGACGCAG
C2 CGCTGACGACAAGGACAAGGAGAATTCAAAGGGCGAGGATGAAGACGCAG
C3 CGCTGACGGCAAGGACAAGGAGAATTCAAAGGGCGAGGATGAAGACGCAG
C4 CGCTGACGGCGAGGACAAGGAGAATTCAAAGGGCGAGGCTGAAGACGCC-
C5 CGATGCCGGCGCGGACAAGGAGAATTCGAAGGGCGAGGATGAGGACGCT-
** ..***************.**********.***.*****
C1 ATGAAGAGAATGCCGAGCAAAAGAAGTTACCAGCGACCACAACAACAACA
C2 ATGAAGAAAATGCCGAGCAAAAGAAGTTACCAGCGACCACAACAACAACA
C3 ATGAAGAAAAGGCCGAGCAAAAGAAGTTACCAGCGACCACAACAACAACA
C4 --GAAGATAGTGCCGAGCAAAAGAAGTTACCAGCGACAACAACAGCAGCA
C5 --GAAGATAGTACCGAGCAAAAGAAGTCATCAACGACAACAACAGCAGCA
***** *. .*************** * **.****.******.**.**
C1 GCAGCATCA---GCTAAGAAGACTTCAGATTCCCAATCGGATCTCTTATT
C2 ACAGCGCCA---GCTAGGAAGACTTCAGATTCCCAATCGGATCTCTTATT
C3 ACAGCAGTACCCGCTAAGAAGACTTCAGATTCCCAATCGGATCTCTTATT
C4 GCACCAGCAGCAGCTAAGAAGACTTCAGATTCCCAATCGGATCTCTTATT
C5 GCA---------GCTAAGAAGACTTCAGATTCCCAATCGGATCTTTTATT
.** ****.*************************** *****
C1 GGACAGCGAGCGGGCAGCGGCTGCGCAG------------------
C2 GGACAGCGAGCGGGCAGCGGCTGCGCAG------------------
C3 GGACAGCGAGCGGGCAGCGGCTGCGCAG------------------
C4 GGACAGCGAGCGAGCAGCGGCTGCGCAG------------------
C5 GCACAGCGAGCGGGCAGCGGCTGCGCAG------------------
* **********.***************
>C1
ATGGTCTTGAAAGTCTACGTCAGCGGCATGTCCGGCAATAAGGAGGTGAA
GAAGCGCCAGCAGCGCGTTCTGATGATCCTGGACAGCAAGAACATCAAGT
ACGACACGGTGGACATCACGGAGCCCGGCAAGGAATCCGAGAAGGAGCTG
ATGCAAAACAAATCGACAAGCAACGGTGGAACGGTCAGCGATCCAGAGCC
CCGTCATCCGCTTCCTCCGCAGCTGTTCAACGACGACGAGTACTGCGGTG
ATTACGACGCCTTTGACATGGCCAACGAGATCGATACCCTGGAGGTGTTC
CTCAAGCTGGCTCCAGCCGACACCACGGCAGTTAGTACCGCCCAAATCGA
ACTGAAGCAGGAGAACGGCGATGCCAAGAAGGAGGAGGCGGAAACGGAGG
CGGAGGAT------------------AAGAAAACGGAGGCCGGCGATGGC
GATGTGGATGTCAAGGAGGAG---GCTGCTGAGAAGGCCGAGAACGAAGA
CGGC------AAGGACAAGGAGAATTCAAAGGGCGAGGATGAAGACGCAG
ATGAAGAGAATGCCGAGCAAAAGAAGTTACCAGCGACCACAACAACAACA
GCAGCATCA---GCTAAGAAGACTTCAGATTCCCAATCGGATCTCTTATT
GGACAGCGAGCGGGCAGCGGCTGCGCAG------------------
>C2
ATGGTCTTGAAAGTCTACGTCAGCGGCATGTCCGGCAATAAGGAGGTGAA
GAAGCGCCAGCAGCGCGTTCTCATGATCCTGGACAGCAAGAACATCAAGT
ACGACACCGTGGACATCACGGAGCCCGGCAAGGAATCCGAGAAGGAGCTA
ATGCAGAACAAATCGACGAGCAACGGCGGAACGGTCAGCGATCCAGAGCC
CCGTCATCCGCTTCCTCCGCAGCTGTTCAACGATGACGAGTACTGCGGTG
ACTACGACGCCTTCGACATGGCCAACGAGATCGATACCCTGGAGGTGTTC
CTCAAGCTGGCCCCAGCCGACACCACGGCGGTTAGTACCGCCCAAATCGA
ACTGAAACAGGAGAACGGCGATGCCAAGAAGGAGGAGGCGGAAGCGGAGG
CGGAGGAT------------------AAGAAACCGGAGTCCGGCGATGGC
GATGTGGATGTCAAGGAGGAG---GCTGCGGAGAAGGCCGAGAACGAAGA
CGCTGACGACAAGGACAAGGAGAATTCAAAGGGCGAGGATGAAGACGCAG
ATGAAGAAAATGCCGAGCAAAAGAAGTTACCAGCGACCACAACAACAACA
ACAGCGCCA---GCTAGGAAGACTTCAGATTCCCAATCGGATCTCTTATT
GGACAGCGAGCGGGCAGCGGCTGCGCAG------------------
>C3
ATGGTCTTGAAAGTCTACGTCAGCGGCATGTCCGGCAATAAGGAGGTGAA
GAAGCGCCAGCAGCGCGTTCTCATGATCCTGGACAGCAAGAACATCAAGT
ACGACACCGTGGACATCACGGAGCCCGGCAAGGAATCCGAGAAGGAGCTA
ATGCAGAACAAATCGACGAGCAACGGCGGAACGGTCAGCGATCCAGAGCC
CCGTCATCCGCTTCCTCCGCAGCTGTTCAACGATGACGAGTACTGCGGTG
ACTACGACGCCTTCGACATGGCCAACGAGATCGATACCCTGGAGGTGTTC
CTCAAGCTGGCCCCAGCCGACACCACGGCGGTTAGTACCGCCCAAATCGA
ACTGAAACAGGAGAACGGCGATGCCAAGAAGGAGGAGGCGGAAGCGGAGG
CGGAGGAT------------------AAGAAACCGGAGTCCGGCGATGGC
GATGTGGATGTCAAGGAGGAG---GCTGCGGAGAAGGCCGAGAACGAAGA
CGCTGACGGCAAGGACAAGGAGAATTCAAAGGGCGAGGATGAAGACGCAG
ATGAAGAAAAGGCCGAGCAAAAGAAGTTACCAGCGACCACAACAACAACA
ACAGCAGTACCCGCTAAGAAGACTTCAGATTCCCAATCGGATCTCTTATT
GGACAGCGAGCGGGCAGCGGCTGCGCAG------------------
>C4
ATGGTCTTGAAAGTCTACGTCAGCGGCATGTCCGGCAATAAGGAGGTGAA
GAAGCGCCAGCAGCGCGTTCTGATGATCCTGGACAGCAAGAACATCAAGT
ACGACACGGTGGACATCACGGAGCCCGGCAAGGAATCCGAGAAGGAGCTG
ATGCAGAACAAATCGACGAGCAACGGCGGCACGGTCAGCGATCCAGAGCC
CCGTCATCCGCTTCCTCCGCAGCTCTTCAACGACGAAGAGTACTGCGGCG
ACTACGACGCCTTCGACATGGCCAACGAGATCGACACCCTGGAGGTGTTC
CTCAAACTGGCACCCGCCGACACCACGGCGGTTAGCACCGCCCAAATCGA
ACTGAAGCAGGAGAACGGCGATGCCAAGAAGGAGGAGGCAGAAGCGGAGG
CGGCTACA------GATGCGGAGGAGAAGAAACCGGAGGCCGGCGATGGC
GGTGTCAAGGAGGAGGAGGAG---GCTGCGGAGAAGGCCGAGAACGAAGA
CGCTGACGGCGAGGACAAGGAGAATTCAAAGGGCGAGGCTGAAGACGCC-
--GAAGATAGTGCCGAGCAAAAGAAGTTACCAGCGACAACAACAGCAGCA
GCACCAGCAGCAGCTAAGAAGACTTCAGATTCCCAATCGGATCTCTTATT
GGACAGCGAGCGAGCAGCGGCTGCGCAG------------------
>C5
ATGGTCTTGAAAGTCTACGTCAGCGGCATGTCCGGCAATAAGGAGGTGAA
GAAGCGCCAGCAGCGCGTTCTGATGATCCTGGACAGCAAGAACATCAAGT
ACGACACGGTAGACATCACGGAGCCCGGCAAGGAATCCGAAAAGGAGCTG
ATGCAGAACAAATCGACGAGCAGCGGCGGCACGGTCAGCGATCCAGAGCC
CCGCCATCCGCTTCCTCCGCAGCTCTTCAACGACGAAGAGTACTGCGGCG
ACTACGACGCCTTCGACATGGCCAACGAGATCGACACCCTGGAGGTGTTC
CTCAAACTGGCCCCAGCCGACACCACGGCGGTTAGTACCGCCCAAATCGA
ACTGAAGCAGGAGAACGGCGATGCCAAGAAGGAGGAGGCTGAAGCGGAGG
CGGTAACGGATGCGGATGCGGAGGCAAAGAAACCGGAGGCCGGTGATGGC
GGTGCCAAGGAGGAGGAGGAGGTGGCTGCGGAGAAGGCCGAGAATGAAGA
CGATGCCGGCGCGGACAAGGAGAATTCGAAGGGCGAGGATGAGGACGCT-
--GAAGATAGTACCGAGCAAAAGAAGTCATCAACGACAACAACAGCAGCA
GCA---------GCTAAGAAGACTTCAGATTCCCAATCGGATCTTTTATT
GCACAGCGAGCGGGCAGCGGCTGCGCAG------------------
>C1
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAETEAEDooooooKKTEAGDG
DVDVKEEoAAEKAENEDGooKDKENSKGEDEDADEENAEQKKLPATTTTT
AASoAKKTSDSQSDLLLDSERAAAAQ
>C2
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAEDooooooKKPESGDG
DVDVKEEoAAEKAENEDADDKDKENSKGEDEDADEENAEQKKLPATTTTT
TAPoARKTSDSQSDLLLDSERAAAAQ
>C3
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAEDooooooKKPESGDG
DVDVKEEoAAEKAENEDADGKDKENSKGEDEDADEEKAEQKKLPATTTTT
TAVPAKKTSDSQSDLLLDSERAAAAQ
>C4
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSNGGTVSDPEPRHPLPPQLFNDEEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAATooDAEEKKPEAGDG
GVKEEEEoAAEKAENEDADGEDKENSKGEAEDAoEDSAEQKKLPATTTAA
APAAAKKTSDSQSDLLLDSERAAAAQ
>C5
MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
MQNKSTSSGGTVSDPEPRHPLPPQLFNDEEYCGDYDAFDMANEIDTLEVF
LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAVTDADAEAKKPEAGDG
GAKEEEEVAAEKAENEDDAGADKENSKGEDEDAoEDSTEQKKSSTTTTAA
AoooAKKTSDSQSDLLLHSERAAAAQ
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 696 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1481031604
Setting output file names to "/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 2092263090
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1335194559
Seed = 1241665900
Swapseed = 1481031604
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 21 unique site patterns
Division 2 has 27 unique site patterns
Division 3 has 43 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1753.238931 -- -25.624409
Chain 2 -- -1738.388330 -- -25.624409
Chain 3 -- -1714.108342 -- -25.624409
Chain 4 -- -1753.238931 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1740.177802 -- -25.624409
Chain 2 -- -1739.398709 -- -25.624409
Chain 3 -- -1753.238931 -- -25.624409
Chain 4 -- -1674.941861 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1753.239] (-1738.388) (-1714.108) (-1753.239) * [-1740.178] (-1739.399) (-1753.239) (-1674.942)
500 -- (-1392.746) [-1401.985] (-1412.779) (-1419.943) * (-1401.156) [-1393.340] (-1401.551) (-1402.607) -- 0:00:00
1000 -- [-1391.894] (-1396.763) (-1392.409) (-1398.487) * (-1388.018) [-1392.116] (-1392.119) (-1393.024) -- 0:00:00
1500 -- (-1391.553) [-1395.906] (-1393.260) (-1391.032) * [-1382.919] (-1387.839) (-1381.386) (-1401.316) -- 0:00:00
2000 -- (-1390.221) (-1388.026) [-1387.136] (-1391.842) * [-1380.249] (-1388.556) (-1380.202) (-1389.830) -- 0:00:00
2500 -- [-1385.748] (-1391.601) (-1386.525) (-1396.662) * (-1385.276) [-1383.109] (-1377.804) (-1388.179) -- 0:00:00
3000 -- [-1381.730] (-1393.123) (-1382.420) (-1388.708) * [-1381.906] (-1387.987) (-1378.619) (-1399.172) -- 0:00:00
3500 -- (-1385.838) (-1388.296) [-1387.526] (-1387.831) * [-1382.840] (-1388.438) (-1382.752) (-1388.683) -- 0:04:44
4000 -- (-1389.757) (-1393.086) (-1378.149) [-1380.821] * [-1377.421] (-1392.007) (-1379.894) (-1383.689) -- 0:04:09
4500 -- (-1393.304) (-1387.225) [-1375.700] (-1381.264) * (-1377.764) (-1393.788) (-1378.703) [-1384.774] -- 0:03:41
5000 -- (-1389.593) (-1382.386) [-1377.069] (-1384.203) * (-1374.462) (-1386.162) (-1379.115) [-1384.449] -- 0:03:19
Average standard deviation of split frequencies: 0.000000
5500 -- (-1390.765) (-1384.960) (-1376.137) [-1375.956] * (-1378.164) (-1384.876) (-1379.184) [-1378.996] -- 0:03:00
6000 -- (-1382.340) [-1381.905] (-1383.567) (-1380.124) * (-1379.558) (-1385.412) [-1379.642] (-1378.630) -- 0:02:45
6500 -- (-1381.092) [-1385.523] (-1379.281) (-1383.860) * (-1379.566) [-1377.860] (-1380.261) (-1383.521) -- 0:02:32
7000 -- (-1385.556) (-1386.729) [-1381.818] (-1377.551) * [-1377.606] (-1379.592) (-1378.617) (-1380.873) -- 0:02:21
7500 -- (-1390.214) (-1381.614) (-1382.252) [-1374.895] * (-1380.465) (-1377.775) [-1381.455] (-1380.884) -- 0:02:12
8000 -- (-1384.833) (-1386.015) [-1381.798] (-1379.556) * [-1374.607] (-1376.571) (-1375.268) (-1383.889) -- 0:02:04
8500 -- [-1379.169] (-1381.418) (-1377.156) (-1378.521) * (-1378.415) [-1376.309] (-1383.568) (-1378.853) -- 0:01:56
9000 -- (-1377.850) [-1379.424] (-1382.654) (-1376.305) * (-1378.791) [-1376.201] (-1379.038) (-1380.287) -- 0:03:40
9500 -- (-1377.206) [-1378.131] (-1383.330) (-1376.903) * (-1377.975) (-1379.170) [-1376.580] (-1383.952) -- 0:03:28
10000 -- (-1378.015) (-1376.245) (-1382.282) [-1378.831] * [-1377.159] (-1376.852) (-1379.031) (-1382.206) -- 0:03:18
Average standard deviation of split frequencies: 0.000000
10500 -- [-1381.467] (-1377.157) (-1383.771) (-1382.078) * [-1374.698] (-1379.455) (-1381.961) (-1378.206) -- 0:03:08
11000 -- [-1378.417] (-1384.438) (-1386.520) (-1380.450) * [-1381.388] (-1382.700) (-1378.896) (-1381.416) -- 0:02:59
11500 -- (-1381.000) (-1385.155) [-1382.938] (-1375.862) * (-1374.322) (-1382.242) [-1378.337] (-1376.060) -- 0:02:51
12000 -- (-1379.329) (-1379.204) [-1378.009] (-1379.056) * (-1374.663) (-1380.916) [-1378.163] (-1377.659) -- 0:02:44
12500 -- (-1378.969) [-1380.549] (-1386.491) (-1381.254) * [-1374.502] (-1383.785) (-1381.528) (-1381.906) -- 0:02:38
13000 -- [-1376.539] (-1382.016) (-1381.472) (-1374.284) * (-1375.190) (-1381.774) [-1382.933] (-1381.118) -- 0:02:31
13500 -- (-1376.575) (-1381.731) [-1381.191] (-1374.516) * (-1381.497) [-1381.097] (-1379.131) (-1380.389) -- 0:02:26
14000 -- (-1376.946) (-1383.788) [-1378.175] (-1382.208) * (-1381.897) (-1380.176) (-1386.655) [-1374.413] -- 0:03:31
14500 -- (-1379.038) (-1378.783) (-1382.894) [-1380.075] * (-1378.757) (-1382.658) (-1380.169) [-1376.128] -- 0:03:23
15000 -- (-1387.190) [-1377.773] (-1381.483) (-1382.573) * [-1382.290] (-1380.660) (-1385.573) (-1384.464) -- 0:03:17
Average standard deviation of split frequencies: 0.014731
15500 -- (-1382.233) (-1376.115) (-1379.505) [-1376.364] * (-1375.155) (-1379.936) (-1376.660) [-1379.861] -- 0:03:10
16000 -- (-1381.971) (-1377.947) (-1377.977) [-1378.845] * (-1384.604) (-1378.445) (-1377.226) [-1384.479] -- 0:03:04
16500 -- (-1387.167) (-1382.961) [-1377.566] (-1376.491) * (-1382.194) [-1387.607] (-1378.240) (-1381.618) -- 0:02:58
17000 -- (-1388.403) (-1378.742) [-1374.601] (-1380.746) * (-1377.964) (-1379.858) (-1376.603) [-1377.627] -- 0:02:53
17500 -- (-1383.796) (-1374.871) [-1377.253] (-1380.039) * (-1377.120) (-1381.894) [-1380.902] (-1378.988) -- 0:02:48
18000 -- [-1381.780] (-1379.651) (-1375.980) (-1378.874) * [-1376.631] (-1380.809) (-1378.310) (-1380.802) -- 0:02:43
18500 -- [-1380.585] (-1379.688) (-1384.513) (-1380.290) * (-1381.028) (-1382.635) [-1381.475] (-1380.551) -- 0:02:39
19000 -- (-1382.931) (-1377.335) (-1374.842) [-1377.094] * (-1386.991) (-1384.769) [-1380.290] (-1378.292) -- 0:02:34
19500 -- (-1378.559) (-1377.247) (-1375.481) [-1376.470] * (-1384.203) [-1376.127] (-1383.527) (-1386.094) -- 0:03:21
20000 -- (-1380.728) (-1382.467) (-1376.100) [-1377.890] * (-1377.543) (-1377.780) (-1388.976) [-1385.397] -- 0:03:16
Average standard deviation of split frequencies: 0.022810
20500 -- (-1383.411) (-1387.651) (-1382.203) [-1382.744] * [-1376.535] (-1375.081) (-1387.176) (-1385.457) -- 0:03:11
21000 -- (-1380.756) (-1379.986) (-1376.761) [-1385.478] * [-1380.675] (-1380.652) (-1383.695) (-1385.010) -- 0:03:06
21500 -- (-1379.948) (-1382.834) [-1373.397] (-1377.801) * (-1381.494) (-1383.168) [-1382.967] (-1379.371) -- 0:03:02
22000 -- (-1382.445) (-1392.079) [-1373.951] (-1376.032) * (-1381.164) (-1378.076) (-1380.439) [-1379.139] -- 0:02:57
22500 -- [-1383.283] (-1380.571) (-1381.033) (-1382.675) * [-1380.141] (-1377.336) (-1376.937) (-1379.113) -- 0:02:53
23000 -- (-1377.832) (-1382.038) (-1379.931) [-1377.092] * (-1378.751) (-1379.700) (-1381.791) [-1382.211] -- 0:02:49
23500 -- (-1379.856) (-1386.080) (-1381.329) [-1380.779] * (-1382.992) (-1379.530) [-1375.837] (-1378.357) -- 0:02:46
24000 -- [-1381.664] (-1379.670) (-1375.094) (-1381.621) * (-1382.298) (-1381.104) (-1377.950) [-1379.740] -- 0:02:42
24500 -- (-1378.008) (-1376.750) (-1381.925) [-1382.940] * [-1376.153] (-1381.577) (-1381.808) (-1381.462) -- 0:03:19
25000 -- [-1377.356] (-1378.852) (-1384.226) (-1384.399) * (-1379.498) (-1378.437) (-1376.522) [-1381.717] -- 0:03:15
Average standard deviation of split frequencies: 0.009065
25500 -- [-1379.473] (-1374.279) (-1380.576) (-1381.760) * [-1379.288] (-1380.691) (-1374.654) (-1386.512) -- 0:03:11
26000 -- (-1378.470) (-1374.263) [-1379.481] (-1373.876) * [-1376.261] (-1388.485) (-1374.929) (-1387.346) -- 0:03:07
26500 -- (-1384.944) [-1380.350] (-1384.427) (-1382.263) * (-1383.895) [-1376.385] (-1380.528) (-1386.328) -- 0:03:03
27000 -- (-1385.085) [-1376.730] (-1374.368) (-1380.440) * (-1380.109) [-1375.186] (-1379.292) (-1382.259) -- 0:03:00
27500 -- (-1382.810) [-1374.203] (-1385.390) (-1381.352) * [-1376.570] (-1375.847) (-1378.065) (-1382.656) -- 0:02:56
28000 -- (-1382.334) [-1379.748] (-1383.614) (-1375.854) * [-1379.148] (-1384.559) (-1382.916) (-1386.228) -- 0:02:53
28500 -- (-1378.600) (-1383.038) (-1380.294) [-1378.094] * [-1380.082] (-1377.462) (-1383.088) (-1388.272) -- 0:02:50
29000 -- [-1383.858] (-1383.451) (-1381.171) (-1381.977) * (-1375.999) [-1380.265] (-1378.516) (-1378.313) -- 0:02:47
29500 -- (-1377.096) [-1377.191] (-1386.899) (-1383.198) * (-1381.188) (-1391.231) [-1375.323] (-1376.196) -- 0:02:44
30000 -- (-1383.720) [-1380.699] (-1382.534) (-1376.122) * (-1379.803) (-1384.111) (-1379.881) [-1382.651] -- 0:03:14
Average standard deviation of split frequencies: 0.000000
30500 -- [-1383.225] (-1376.536) (-1377.359) (-1374.288) * (-1378.605) [-1377.484] (-1385.193) (-1379.336) -- 0:03:10
31000 -- [-1379.923] (-1378.347) (-1381.084) (-1380.278) * [-1378.798] (-1383.672) (-1378.394) (-1380.351) -- 0:03:07
31500 -- [-1384.087] (-1381.679) (-1384.973) (-1376.782) * (-1378.464) (-1380.563) (-1379.598) [-1381.723] -- 0:03:04
32000 -- [-1375.232] (-1385.563) (-1380.949) (-1376.779) * (-1378.962) (-1381.671) [-1379.772] (-1377.477) -- 0:03:01
32500 -- [-1376.560] (-1380.048) (-1382.623) (-1376.746) * (-1378.114) (-1382.952) (-1382.368) [-1377.277] -- 0:02:58
33000 -- (-1374.776) [-1378.599] (-1380.644) (-1379.229) * [-1379.829] (-1383.364) (-1377.729) (-1377.825) -- 0:02:55
33500 -- (-1385.603) (-1382.028) (-1380.551) [-1376.939] * (-1380.293) (-1386.061) (-1379.347) [-1381.267] -- 0:02:53
34000 -- [-1382.830] (-1387.251) (-1382.616) (-1377.059) * [-1381.455] (-1375.352) (-1382.274) (-1380.208) -- 0:02:50
34500 -- (-1378.189) (-1378.730) [-1380.595] (-1375.648) * (-1375.060) (-1379.974) (-1386.620) [-1380.422] -- 0:02:47
35000 -- [-1379.265] (-1376.510) (-1377.925) (-1377.452) * [-1375.760] (-1381.260) (-1380.476) (-1381.447) -- 0:03:13
Average standard deviation of split frequencies: 0.006547
35500 -- (-1381.207) [-1373.523] (-1383.171) (-1376.933) * (-1375.946) [-1378.562] (-1383.728) (-1379.608) -- 0:03:10
36000 -- (-1382.998) [-1375.986] (-1381.997) (-1380.465) * (-1375.979) (-1378.807) [-1380.037] (-1375.179) -- 0:03:07
36500 -- (-1385.429) (-1376.560) (-1380.834) [-1375.723] * [-1376.189] (-1381.832) (-1381.124) (-1380.261) -- 0:03:04
37000 -- (-1377.973) (-1378.624) (-1379.516) [-1376.360] * (-1381.809) (-1378.024) [-1380.424] (-1378.937) -- 0:03:02
37500 -- (-1378.732) [-1375.579] (-1379.663) (-1375.259) * (-1387.215) (-1378.319) (-1380.793) [-1378.417] -- 0:02:59
38000 -- [-1379.564] (-1382.544) (-1376.031) (-1379.115) * [-1380.623] (-1381.420) (-1381.756) (-1380.827) -- 0:02:57
38500 -- (-1382.426) (-1382.013) [-1381.562] (-1378.670) * (-1377.625) (-1375.655) [-1387.874] (-1379.010) -- 0:02:54
39000 -- [-1378.097] (-1377.514) (-1382.881) (-1382.549) * (-1385.654) [-1377.779] (-1382.529) (-1377.868) -- 0:02:52
39500 -- (-1380.552) [-1378.208] (-1377.152) (-1378.278) * [-1377.787] (-1375.145) (-1386.756) (-1376.488) -- 0:02:50
40000 -- [-1379.147] (-1378.573) (-1382.709) (-1384.883) * (-1381.750) [-1373.296] (-1386.431) (-1376.822) -- 0:02:48
Average standard deviation of split frequencies: 0.005796
40500 -- (-1382.357) [-1375.230] (-1387.441) (-1375.661) * [-1374.372] (-1375.969) (-1383.445) (-1377.307) -- 0:03:09
41000 -- (-1381.427) (-1381.961) [-1378.891] (-1381.975) * (-1384.227) [-1375.820] (-1382.626) (-1375.550) -- 0:03:07
41500 -- (-1389.823) [-1380.718] (-1383.681) (-1375.777) * (-1377.756) [-1376.980] (-1384.788) (-1376.332) -- 0:03:04
42000 -- (-1378.434) (-1384.807) [-1379.259] (-1377.340) * (-1376.682) (-1381.514) (-1385.521) [-1379.599] -- 0:03:02
42500 -- (-1381.032) (-1384.110) (-1379.486) [-1374.515] * (-1381.852) [-1382.493] (-1381.963) (-1383.073) -- 0:03:00
43000 -- (-1379.639) [-1378.287] (-1374.721) (-1376.518) * [-1382.077] (-1378.757) (-1384.362) (-1377.183) -- 0:02:58
43500 -- [-1383.331] (-1374.621) (-1382.804) (-1379.394) * (-1382.127) (-1383.636) (-1385.796) [-1379.265] -- 0:02:55
44000 -- [-1385.376] (-1382.610) (-1381.267) (-1382.488) * (-1381.640) (-1382.269) (-1392.261) [-1377.688] -- 0:02:53
44500 -- (-1382.181) [-1377.653] (-1375.822) (-1380.925) * (-1381.922) (-1381.646) (-1391.070) [-1384.478] -- 0:02:51
45000 -- [-1387.443] (-1381.942) (-1377.493) (-1379.849) * (-1379.578) (-1383.770) (-1386.175) [-1380.066] -- 0:02:49
Average standard deviation of split frequencies: 0.000000
45500 -- (-1383.083) [-1383.167] (-1374.328) (-1376.293) * (-1383.364) [-1380.872] (-1381.876) (-1384.448) -- 0:03:08
46000 -- [-1378.853] (-1379.733) (-1375.105) (-1379.692) * (-1380.611) [-1376.787] (-1379.973) (-1381.496) -- 0:03:06
46500 -- [-1376.279] (-1379.861) (-1375.791) (-1375.535) * (-1385.771) [-1382.167] (-1386.601) (-1376.938) -- 0:03:04
47000 -- [-1377.808] (-1374.509) (-1376.301) (-1382.129) * (-1383.703) (-1380.461) (-1382.958) [-1379.602] -- 0:03:02
47500 -- [-1380.454] (-1376.763) (-1380.740) (-1379.442) * [-1378.964] (-1383.251) (-1377.367) (-1380.597) -- 0:03:00
48000 -- (-1377.918) (-1380.710) [-1379.954] (-1386.902) * (-1377.579) (-1379.383) (-1383.893) [-1375.331] -- 0:02:58
48500 -- [-1376.167] (-1379.703) (-1380.411) (-1382.052) * [-1374.627] (-1378.226) (-1385.779) (-1380.504) -- 0:02:56
49000 -- [-1376.282] (-1376.143) (-1376.321) (-1384.592) * [-1378.033] (-1380.417) (-1381.611) (-1381.246) -- 0:02:54
49500 -- [-1377.448] (-1379.330) (-1383.875) (-1385.785) * [-1379.415] (-1379.091) (-1382.187) (-1377.205) -- 0:02:52
50000 -- (-1377.513) (-1384.018) (-1373.633) [-1384.095] * (-1379.276) [-1380.183] (-1380.344) (-1376.328) -- 0:02:51
Average standard deviation of split frequencies: 0.004652
50500 -- (-1376.974) [-1376.357] (-1383.580) (-1386.799) * [-1382.903] (-1378.793) (-1380.453) (-1379.607) -- 0:02:49
51000 -- (-1380.285) [-1376.243] (-1379.822) (-1378.524) * (-1380.644) [-1378.929] (-1387.282) (-1380.621) -- 0:03:06
51500 -- (-1374.799) [-1379.499] (-1381.483) (-1382.915) * [-1376.999] (-1380.693) (-1380.572) (-1383.357) -- 0:03:04
52000 -- [-1375.128] (-1385.076) (-1384.870) (-1377.612) * [-1376.923] (-1380.935) (-1385.228) (-1378.946) -- 0:03:02
52500 -- (-1376.165) (-1380.739) [-1376.724] (-1383.510) * (-1385.749) (-1393.472) [-1381.803] (-1381.407) -- 0:03:00
53000 -- [-1380.679] (-1381.586) (-1385.076) (-1376.792) * (-1390.104) (-1380.234) (-1383.367) [-1391.873] -- 0:02:58
53500 -- [-1375.602] (-1385.251) (-1381.100) (-1382.724) * (-1379.350) (-1387.814) (-1382.376) [-1384.854] -- 0:02:56
54000 -- (-1377.078) (-1385.076) (-1379.604) [-1381.511] * (-1382.793) (-1383.006) (-1380.453) [-1377.481] -- 0:02:55
54500 -- (-1376.838) (-1390.430) (-1384.288) [-1379.471] * (-1384.833) [-1378.789] (-1378.951) (-1381.386) -- 0:02:53
55000 -- (-1376.618) (-1382.779) (-1380.217) [-1387.913] * (-1378.106) (-1383.616) (-1376.192) [-1378.676] -- 0:02:51
Average standard deviation of split frequencies: 0.000000
55500 -- [-1375.243] (-1383.452) (-1378.708) (-1379.299) * (-1384.428) (-1377.343) [-1377.212] (-1377.738) -- 0:02:50
56000 -- [-1377.781] (-1380.661) (-1377.279) (-1380.753) * (-1380.413) (-1381.238) (-1380.281) [-1376.314] -- 0:03:05
56500 -- (-1382.920) [-1383.852] (-1388.994) (-1381.964) * [-1377.981] (-1377.901) (-1382.877) (-1383.732) -- 0:03:03
57000 -- [-1382.155] (-1382.647) (-1378.655) (-1380.020) * [-1377.545] (-1375.594) (-1379.977) (-1383.732) -- 0:03:01
57500 -- (-1380.675) [-1379.691] (-1383.697) (-1376.208) * [-1381.538] (-1378.093) (-1384.552) (-1379.319) -- 0:03:00
58000 -- (-1382.846) [-1383.849] (-1379.195) (-1377.337) * (-1382.414) (-1384.234) (-1380.694) [-1375.792] -- 0:02:58
58500 -- [-1377.150] (-1384.588) (-1380.946) (-1383.209) * (-1374.346) [-1383.617] (-1380.793) (-1382.688) -- 0:02:57
59000 -- (-1382.541) (-1387.958) (-1380.675) [-1376.914] * (-1377.751) (-1391.126) (-1374.846) [-1378.441] -- 0:02:55
59500 -- (-1384.531) (-1385.743) [-1383.694] (-1380.814) * (-1378.029) (-1380.576) [-1379.606] (-1377.902) -- 0:02:53
60000 -- [-1383.902] (-1385.410) (-1379.240) (-1379.010) * (-1376.122) (-1382.310) [-1376.488] (-1381.999) -- 0:02:52
Average standard deviation of split frequencies: 0.003885
60500 -- [-1379.997] (-1385.193) (-1387.694) (-1383.178) * (-1380.021) (-1378.554) (-1381.573) [-1375.589] -- 0:02:50
61000 -- (-1386.763) (-1382.285) (-1384.723) [-1381.268] * (-1381.113) (-1379.600) [-1376.948] (-1377.629) -- 0:02:49
61500 -- (-1383.842) (-1382.291) [-1381.139] (-1380.652) * [-1377.014] (-1379.701) (-1382.316) (-1378.407) -- 0:03:03
62000 -- (-1383.064) [-1382.119] (-1384.075) (-1383.511) * [-1379.090] (-1378.238) (-1378.255) (-1375.761) -- 0:03:01
62500 -- [-1379.270] (-1383.706) (-1383.049) (-1380.127) * (-1377.007) (-1378.550) (-1374.336) [-1376.616] -- 0:03:00
63000 -- (-1378.165) (-1379.051) [-1373.593] (-1380.059) * (-1379.110) (-1378.784) [-1376.558] (-1376.805) -- 0:02:58
63500 -- (-1385.966) (-1380.672) (-1386.625) [-1381.448] * [-1379.454] (-1383.293) (-1373.925) (-1392.354) -- 0:02:56
64000 -- (-1379.921) (-1380.686) (-1378.871) [-1376.985] * (-1383.235) (-1392.659) [-1376.545] (-1375.978) -- 0:02:55
64500 -- [-1374.020] (-1381.981) (-1377.749) (-1383.386) * (-1382.841) (-1387.791) [-1377.713] (-1383.271) -- 0:02:54
65000 -- (-1381.003) [-1382.705] (-1379.557) (-1378.604) * (-1376.101) [-1375.740] (-1378.968) (-1383.648) -- 0:02:52
Average standard deviation of split frequencies: 0.003571
65500 -- (-1382.245) [-1383.359] (-1380.142) (-1381.612) * (-1382.034) [-1377.453] (-1376.025) (-1378.239) -- 0:02:51
66000 -- (-1378.310) (-1380.242) (-1384.204) [-1379.268] * (-1387.028) (-1379.933) [-1379.792] (-1381.998) -- 0:02:49
66500 -- (-1383.410) (-1384.431) (-1381.316) [-1379.022] * (-1385.311) (-1376.595) [-1376.805] (-1377.459) -- 0:03:02
67000 -- (-1377.895) (-1380.145) [-1381.641] (-1384.445) * (-1380.213) (-1374.511) [-1379.762] (-1378.752) -- 0:03:01
67500 -- (-1381.660) (-1386.037) (-1380.663) [-1379.363] * (-1384.528) (-1375.192) [-1375.760] (-1381.078) -- 0:02:59
68000 -- (-1380.166) (-1381.666) [-1376.342] (-1382.111) * (-1375.063) [-1376.321] (-1382.967) (-1378.972) -- 0:02:58
68500 -- (-1375.328) [-1381.163] (-1380.983) (-1379.773) * [-1375.669] (-1374.086) (-1378.709) (-1380.097) -- 0:02:56
69000 -- (-1376.374) [-1377.578] (-1375.653) (-1379.040) * (-1382.254) [-1376.597] (-1381.081) (-1381.014) -- 0:02:55
69500 -- (-1380.395) (-1378.997) [-1383.448] (-1381.476) * (-1377.335) [-1378.167] (-1384.175) (-1379.908) -- 0:02:54
70000 -- (-1377.985) [-1382.329] (-1379.464) (-1381.649) * [-1379.273] (-1379.761) (-1386.158) (-1383.442) -- 0:02:52
Average standard deviation of split frequencies: 0.000000
70500 -- [-1381.638] (-1375.992) (-1383.232) (-1381.252) * (-1380.753) [-1377.333] (-1377.122) (-1378.317) -- 0:02:51
71000 -- (-1384.428) [-1375.992] (-1386.754) (-1381.966) * (-1380.405) (-1376.690) [-1379.101] (-1380.866) -- 0:02:50
71500 -- [-1379.116] (-1377.100) (-1379.239) (-1380.379) * [-1380.509] (-1377.239) (-1376.784) (-1381.151) -- 0:02:48
72000 -- (-1383.053) (-1379.610) [-1378.224] (-1388.574) * [-1381.072] (-1379.031) (-1383.825) (-1379.701) -- 0:03:00
72500 -- (-1385.951) (-1377.589) [-1375.418] (-1397.655) * (-1404.624) (-1379.625) (-1382.862) [-1374.938] -- 0:02:59
73000 -- [-1380.139] (-1379.614) (-1377.748) (-1387.548) * (-1374.770) [-1377.356] (-1377.812) (-1382.141) -- 0:02:57
73500 -- (-1378.580) (-1377.982) [-1381.104] (-1382.387) * [-1376.507] (-1379.306) (-1378.962) (-1385.980) -- 0:02:56
74000 -- (-1377.543) [-1379.420] (-1382.568) (-1382.356) * (-1378.220) (-1374.322) (-1379.628) [-1381.151] -- 0:02:55
74500 -- (-1381.103) [-1376.202] (-1383.057) (-1386.248) * [-1376.741] (-1389.873) (-1385.371) (-1381.001) -- 0:02:53
75000 -- (-1382.039) (-1381.924) (-1384.055) [-1384.458] * [-1376.421] (-1379.676) (-1380.695) (-1386.679) -- 0:02:52
Average standard deviation of split frequencies: 0.000000
75500 -- (-1382.240) (-1379.578) (-1379.508) [-1378.934] * [-1377.142] (-1379.521) (-1382.756) (-1382.333) -- 0:02:51
76000 -- (-1382.459) [-1381.989] (-1379.447) (-1383.401) * (-1384.349) [-1382.675] (-1376.255) (-1380.458) -- 0:02:50
76500 -- (-1380.573) (-1379.840) (-1384.160) [-1381.162] * (-1382.804) (-1385.879) [-1380.970] (-1379.308) -- 0:02:49
77000 -- (-1381.069) (-1380.221) (-1385.364) [-1375.989] * [-1376.511] (-1388.897) (-1379.071) (-1381.642) -- 0:02:59
77500 -- [-1377.580] (-1378.143) (-1373.135) (-1383.991) * [-1378.349] (-1383.537) (-1381.072) (-1384.129) -- 0:02:58
78000 -- (-1376.966) (-1376.045) (-1378.005) [-1381.793] * (-1376.173) (-1383.505) [-1376.188] (-1376.984) -- 0:02:57
78500 -- [-1373.923] (-1380.793) (-1380.370) (-1381.786) * (-1383.188) (-1378.859) [-1376.565] (-1380.181) -- 0:02:56
79000 -- [-1379.258] (-1382.663) (-1379.407) (-1384.876) * [-1376.092] (-1380.811) (-1379.586) (-1378.267) -- 0:02:54
79500 -- [-1377.821] (-1384.466) (-1380.322) (-1385.346) * (-1379.227) (-1374.977) [-1374.851] (-1374.540) -- 0:02:53
80000 -- (-1380.589) (-1378.906) [-1378.547] (-1383.321) * (-1375.439) (-1383.087) (-1376.387) [-1377.269] -- 0:02:52
Average standard deviation of split frequencies: 0.000000
80500 -- (-1380.537) (-1379.036) [-1376.946] (-1380.535) * (-1373.869) [-1377.461] (-1376.105) (-1375.034) -- 0:02:51
81000 -- (-1376.524) (-1383.208) (-1378.063) [-1375.697] * (-1380.355) (-1381.850) [-1378.948] (-1387.539) -- 0:02:50
81500 -- (-1376.014) [-1379.903] (-1375.730) (-1377.813) * (-1382.235) (-1383.001) (-1380.532) [-1376.113] -- 0:02:49
82000 -- (-1375.199) (-1380.873) (-1378.079) [-1376.895] * (-1380.829) [-1380.882] (-1387.010) (-1387.411) -- 0:02:47
82500 -- (-1379.883) [-1379.137] (-1378.007) (-1379.333) * (-1378.802) [-1376.811] (-1375.839) (-1378.639) -- 0:02:57
83000 -- [-1379.260] (-1377.292) (-1378.544) (-1375.366) * (-1376.162) (-1379.388) [-1375.921] (-1384.720) -- 0:02:56
83500 -- (-1379.265) (-1381.063) [-1380.335] (-1381.321) * [-1375.187] (-1379.977) (-1377.190) (-1380.711) -- 0:02:55
84000 -- (-1374.782) (-1379.710) [-1379.115] (-1378.368) * (-1377.027) (-1386.252) [-1377.475] (-1380.827) -- 0:02:54
84500 -- [-1375.072] (-1380.168) (-1382.630) (-1374.572) * [-1379.386] (-1382.354) (-1374.396) (-1384.877) -- 0:02:53
85000 -- [-1378.899] (-1383.260) (-1379.383) (-1381.577) * (-1383.790) (-1384.917) (-1382.532) [-1382.333] -- 0:02:52
Average standard deviation of split frequencies: 0.000000
85500 -- (-1386.870) [-1374.731] (-1381.131) (-1375.986) * (-1382.831) (-1395.189) [-1374.760] (-1377.363) -- 0:02:51
86000 -- (-1380.817) (-1381.773) [-1375.962] (-1380.786) * (-1384.565) (-1391.533) [-1377.678] (-1381.537) -- 0:02:50
86500 -- [-1385.092] (-1374.985) (-1378.792) (-1380.624) * [-1377.367] (-1388.368) (-1380.863) (-1384.219) -- 0:02:48
87000 -- (-1379.471) (-1378.042) (-1380.118) [-1380.937] * [-1382.278] (-1380.962) (-1376.058) (-1378.237) -- 0:02:47
87500 -- [-1378.260] (-1377.581) (-1379.599) (-1376.602) * (-1379.911) (-1380.726) (-1378.618) [-1378.907] -- 0:02:46
88000 -- (-1383.491) (-1376.433) (-1378.491) [-1382.691] * (-1386.786) (-1379.805) (-1381.863) [-1378.409] -- 0:02:56
88500 -- [-1378.063] (-1374.614) (-1376.554) (-1381.377) * (-1381.587) [-1381.167] (-1377.703) (-1378.486) -- 0:02:55
89000 -- (-1380.246) (-1375.068) [-1377.354] (-1377.314) * (-1382.403) (-1374.435) [-1380.199] (-1380.705) -- 0:02:54
89500 -- (-1378.337) (-1377.732) (-1382.184) [-1375.405] * (-1380.463) (-1380.014) (-1385.208) [-1383.518] -- 0:02:52
90000 -- (-1378.931) (-1381.736) [-1379.804] (-1377.188) * [-1373.838] (-1379.809) (-1383.196) (-1376.954) -- 0:02:51
Average standard deviation of split frequencies: 0.000000
90500 -- (-1378.285) (-1377.854) (-1375.150) [-1385.349] * [-1374.395] (-1383.553) (-1384.018) (-1380.606) -- 0:02:50
91000 -- [-1377.823] (-1375.704) (-1372.879) (-1384.465) * (-1374.559) (-1381.428) (-1385.499) [-1383.507] -- 0:02:49
91500 -- [-1377.050] (-1376.401) (-1382.863) (-1386.410) * (-1382.390) (-1380.101) [-1380.700] (-1381.590) -- 0:02:48
92000 -- (-1374.130) [-1375.304] (-1381.669) (-1390.841) * (-1384.934) (-1382.497) (-1385.001) [-1379.281] -- 0:02:47
92500 -- (-1379.752) [-1381.807] (-1379.508) (-1386.149) * [-1387.843] (-1385.554) (-1385.689) (-1378.619) -- 0:02:46
93000 -- (-1378.849) (-1381.199) [-1375.946] (-1386.476) * (-1386.939) [-1376.828] (-1377.116) (-1376.765) -- 0:02:55
93500 -- (-1382.300) [-1380.665] (-1379.706) (-1385.464) * [-1379.553] (-1377.413) (-1381.968) (-1377.013) -- 0:02:54
94000 -- (-1377.491) (-1386.152) [-1376.167] (-1377.977) * (-1381.062) (-1376.466) (-1384.581) [-1379.280] -- 0:02:53
94500 -- [-1378.359] (-1381.814) (-1383.876) (-1378.074) * (-1382.996) (-1380.198) (-1388.712) [-1376.097] -- 0:02:52
95000 -- [-1384.113] (-1381.345) (-1378.891) (-1379.673) * (-1378.896) (-1378.897) (-1379.679) [-1377.450] -- 0:02:51
Average standard deviation of split frequencies: 0.002455
95500 -- (-1380.636) (-1380.357) (-1379.211) [-1377.154] * [-1382.678] (-1377.413) (-1388.043) (-1381.872) -- 0:02:50
96000 -- (-1385.632) (-1383.074) [-1377.654] (-1383.236) * [-1380.768] (-1382.491) (-1380.457) (-1381.457) -- 0:02:49
96500 -- (-1380.155) (-1378.440) [-1376.959] (-1378.119) * (-1379.198) (-1386.899) [-1381.869] (-1381.800) -- 0:02:48
97000 -- (-1384.981) (-1384.710) (-1377.596) [-1378.778] * (-1380.912) [-1385.313] (-1379.303) (-1383.078) -- 0:02:47
97500 -- (-1380.709) (-1382.481) [-1379.250] (-1380.485) * (-1380.752) [-1381.878] (-1379.457) (-1380.475) -- 0:02:46
98000 -- (-1386.860) (-1378.106) [-1381.654] (-1381.004) * (-1381.816) [-1377.867] (-1380.092) (-1381.966) -- 0:02:45
98500 -- [-1381.678] (-1376.409) (-1385.786) (-1379.291) * (-1388.954) (-1379.108) (-1380.347) [-1380.078] -- 0:02:53
99000 -- (-1382.298) (-1379.074) [-1378.375] (-1381.057) * (-1382.829) [-1378.867] (-1377.531) (-1385.504) -- 0:02:52
99500 -- (-1380.274) (-1382.306) (-1383.935) [-1375.567] * (-1381.759) [-1375.077] (-1381.583) (-1383.399) -- 0:02:51
100000 -- (-1379.194) (-1373.403) [-1383.372] (-1378.577) * (-1381.232) (-1381.052) [-1376.489] (-1379.114) -- 0:02:51
Average standard deviation of split frequencies: 0.004683
100500 -- [-1379.040] (-1375.457) (-1380.144) (-1378.985) * (-1381.201) (-1379.502) (-1380.076) [-1380.580] -- 0:02:50
101000 -- [-1380.716] (-1372.960) (-1378.570) (-1376.937) * (-1380.251) [-1374.034] (-1379.456) (-1382.194) -- 0:02:49
101500 -- (-1379.967) (-1377.005) [-1377.822] (-1380.310) * (-1380.926) (-1379.072) (-1384.636) [-1381.885] -- 0:02:48
102000 -- (-1383.585) (-1380.563) (-1382.300) [-1380.414] * (-1380.122) (-1378.364) [-1380.171] (-1383.273) -- 0:02:47
102500 -- (-1381.650) (-1379.585) (-1380.949) [-1374.737] * (-1382.780) [-1377.943] (-1380.029) (-1378.369) -- 0:02:46
103000 -- (-1382.543) [-1378.866] (-1379.815) (-1378.191) * (-1377.350) (-1381.059) (-1385.562) [-1384.638] -- 0:02:54
103500 -- [-1377.942] (-1382.656) (-1378.756) (-1377.677) * (-1384.320) (-1380.644) (-1379.333) [-1378.310] -- 0:02:53
104000 -- (-1381.400) (-1377.923) (-1382.725) [-1377.098] * (-1380.439) (-1375.857) [-1380.534] (-1381.376) -- 0:02:52
104500 -- (-1378.417) (-1379.978) [-1376.296] (-1377.493) * (-1379.741) (-1377.698) (-1381.963) [-1376.625] -- 0:02:51
105000 -- (-1374.339) (-1379.898) [-1378.206] (-1386.218) * (-1383.588) (-1374.833) (-1380.878) [-1376.549] -- 0:02:50
Average standard deviation of split frequencies: 0.004447
105500 -- (-1384.948) (-1379.822) [-1377.861] (-1389.541) * [-1377.546] (-1378.209) (-1377.248) (-1382.681) -- 0:02:49
106000 -- (-1380.381) (-1382.877) [-1375.817] (-1379.095) * (-1377.978) (-1386.746) (-1376.885) [-1379.916] -- 0:02:48
106500 -- (-1378.840) (-1386.164) (-1381.670) [-1380.466] * [-1375.586] (-1376.994) (-1377.279) (-1380.803) -- 0:02:47
107000 -- (-1380.622) (-1384.670) [-1381.570] (-1380.105) * (-1376.372) [-1378.960] (-1382.665) (-1379.813) -- 0:02:46
107500 -- (-1381.902) [-1376.784] (-1384.765) (-1377.184) * (-1378.029) (-1378.031) [-1375.777] (-1378.157) -- 0:02:46
108000 -- (-1384.990) [-1377.921] (-1379.039) (-1382.123) * (-1380.730) (-1377.276) [-1378.337] (-1378.574) -- 0:02:53
108500 -- (-1379.264) (-1387.480) (-1381.924) [-1379.488] * (-1379.594) (-1391.840) [-1379.859] (-1378.392) -- 0:02:52
109000 -- (-1381.156) [-1376.923] (-1379.656) (-1385.609) * (-1383.354) (-1378.842) (-1378.595) [-1383.834] -- 0:02:51
109500 -- (-1378.675) [-1379.068] (-1385.391) (-1388.212) * [-1375.251] (-1383.844) (-1377.948) (-1386.666) -- 0:02:50
110000 -- (-1378.445) (-1376.580) [-1385.319] (-1388.791) * [-1378.285] (-1375.570) (-1374.460) (-1380.267) -- 0:02:49
Average standard deviation of split frequencies: 0.004260
110500 -- (-1376.924) [-1378.231] (-1387.221) (-1380.711) * (-1381.135) (-1374.879) [-1380.724] (-1387.592) -- 0:02:49
111000 -- (-1375.776) (-1382.744) [-1380.604] (-1377.207) * (-1382.705) [-1375.247] (-1383.953) (-1380.359) -- 0:02:48
111500 -- (-1381.571) [-1377.741] (-1377.939) (-1380.390) * [-1381.703] (-1375.478) (-1383.873) (-1381.947) -- 0:02:47
112000 -- (-1390.219) [-1376.457] (-1374.106) (-1381.689) * (-1381.430) (-1374.888) [-1381.479] (-1380.476) -- 0:02:46
112500 -- (-1377.852) [-1381.959] (-1383.584) (-1385.281) * (-1376.727) (-1384.530) (-1378.418) [-1378.695] -- 0:02:45
113000 -- (-1381.951) (-1382.702) (-1380.944) [-1379.667] * [-1387.260] (-1380.537) (-1376.554) (-1373.837) -- 0:02:44
113500 -- [-1385.757] (-1376.153) (-1384.524) (-1381.293) * [-1389.559] (-1379.407) (-1379.915) (-1377.244) -- 0:02:51
114000 -- (-1382.974) (-1379.778) (-1382.023) [-1380.791] * (-1387.997) (-1380.501) [-1383.322] (-1373.928) -- 0:02:50
114500 -- (-1380.938) (-1379.774) [-1381.028] (-1381.404) * [-1381.578] (-1378.919) (-1389.873) (-1375.533) -- 0:02:50
115000 -- (-1378.936) (-1380.092) (-1377.525) [-1379.100] * (-1383.962) [-1376.539] (-1386.630) (-1383.514) -- 0:02:49
Average standard deviation of split frequencies: 0.006096
115500 -- (-1382.795) (-1381.192) [-1374.732] (-1377.373) * (-1377.555) (-1378.571) [-1383.066] (-1378.092) -- 0:02:48
116000 -- (-1383.370) [-1380.282] (-1378.914) (-1385.572) * (-1378.463) (-1383.067) (-1382.358) [-1374.218] -- 0:02:47
116500 -- (-1375.396) (-1381.754) (-1388.746) [-1378.024] * (-1381.894) (-1384.642) [-1379.469] (-1376.888) -- 0:02:46
117000 -- (-1377.430) [-1380.929] (-1386.074) (-1386.899) * [-1377.516] (-1383.826) (-1381.646) (-1384.160) -- 0:02:46
117500 -- [-1378.553] (-1380.050) (-1385.779) (-1380.719) * (-1378.914) (-1382.582) [-1378.972] (-1380.922) -- 0:02:45
118000 -- (-1379.165) [-1382.972] (-1384.479) (-1379.952) * (-1379.961) [-1383.920] (-1382.376) (-1378.476) -- 0:02:44
118500 -- [-1377.438] (-1378.777) (-1378.325) (-1374.015) * (-1374.904) (-1378.938) [-1379.324] (-1383.803) -- 0:02:51
119000 -- (-1378.639) (-1388.198) [-1376.309] (-1381.170) * (-1380.943) (-1378.896) [-1379.464] (-1383.659) -- 0:02:50
119500 -- [-1376.433] (-1380.009) (-1377.448) (-1383.784) * (-1378.479) [-1378.749] (-1375.931) (-1384.795) -- 0:02:49
120000 -- [-1381.850] (-1386.951) (-1377.743) (-1381.907) * (-1378.502) (-1384.870) (-1378.140) [-1385.787] -- 0:02:48
Average standard deviation of split frequencies: 0.007813
120500 -- (-1376.739) (-1378.774) [-1380.921] (-1386.574) * [-1378.284] (-1384.257) (-1381.394) (-1376.591) -- 0:02:47
121000 -- (-1375.680) (-1377.885) [-1376.734] (-1385.278) * (-1378.381) (-1377.500) [-1376.044] (-1378.764) -- 0:02:47
121500 -- (-1379.360) [-1388.019] (-1374.587) (-1384.370) * (-1382.794) (-1379.096) [-1378.751] (-1378.844) -- 0:02:46
122000 -- [-1377.187] (-1379.938) (-1377.185) (-1384.776) * (-1379.553) [-1381.997] (-1378.974) (-1381.778) -- 0:02:45
122500 -- [-1378.144] (-1376.752) (-1382.200) (-1384.503) * (-1380.405) (-1383.343) [-1380.634] (-1380.723) -- 0:02:44
123000 -- [-1378.531] (-1387.789) (-1380.224) (-1385.986) * (-1374.892) [-1384.692] (-1376.133) (-1376.944) -- 0:02:43
123500 -- [-1380.527] (-1380.330) (-1374.652) (-1380.149) * [-1379.916] (-1381.108) (-1377.203) (-1376.689) -- 0:02:43
124000 -- (-1376.666) [-1377.849] (-1376.470) (-1383.108) * (-1379.794) (-1381.152) [-1381.669] (-1381.824) -- 0:02:49
124500 -- (-1376.505) (-1381.248) (-1376.562) [-1378.574] * (-1386.242) [-1380.580] (-1376.931) (-1378.737) -- 0:02:48
125000 -- (-1379.138) (-1383.013) [-1374.185] (-1381.978) * (-1378.850) (-1386.275) (-1375.931) [-1379.022] -- 0:02:48
Average standard deviation of split frequencies: 0.009353
125500 -- [-1381.170] (-1379.039) (-1377.103) (-1388.291) * [-1376.403] (-1378.416) (-1374.092) (-1382.871) -- 0:02:47
126000 -- [-1377.862] (-1384.949) (-1378.555) (-1381.737) * (-1377.071) [-1375.899] (-1377.944) (-1376.110) -- 0:02:46
126500 -- [-1381.820] (-1380.217) (-1378.026) (-1383.408) * (-1380.635) (-1376.932) [-1373.399] (-1384.679) -- 0:02:45
127000 -- (-1383.194) (-1384.823) (-1384.603) [-1383.591] * [-1375.106] (-1377.815) (-1391.968) (-1382.314) -- 0:02:44
127500 -- (-1377.241) [-1386.546] (-1377.786) (-1384.534) * (-1378.196) (-1387.172) [-1384.200] (-1380.241) -- 0:02:44
128000 -- [-1375.278] (-1391.568) (-1382.006) (-1380.129) * (-1381.539) [-1381.457] (-1381.524) (-1377.064) -- 0:02:43
128500 -- (-1377.848) (-1391.004) (-1382.806) [-1382.155] * (-1380.960) (-1388.944) [-1381.661] (-1375.560) -- 0:02:42
129000 -- (-1384.851) (-1384.745) [-1382.876] (-1381.727) * (-1377.732) (-1376.754) [-1379.226] (-1380.535) -- 0:02:48
129500 -- [-1378.494] (-1382.271) (-1385.293) (-1381.228) * [-1374.796] (-1379.566) (-1382.387) (-1377.243) -- 0:02:48
130000 -- (-1379.733) [-1378.615] (-1384.813) (-1375.577) * [-1377.182] (-1376.554) (-1379.299) (-1380.601) -- 0:02:47
Average standard deviation of split frequencies: 0.010823
130500 -- (-1379.545) (-1386.292) (-1380.543) [-1377.247] * (-1382.017) (-1387.569) [-1377.419] (-1387.568) -- 0:02:46
131000 -- [-1377.604] (-1382.306) (-1378.029) (-1379.648) * [-1378.950] (-1382.723) (-1383.469) (-1383.741) -- 0:02:45
131500 -- (-1375.627) (-1382.333) [-1380.659] (-1380.622) * (-1381.919) (-1379.265) [-1383.856] (-1384.247) -- 0:02:45
132000 -- (-1381.245) (-1379.998) [-1377.739] (-1382.968) * (-1380.998) [-1376.294] (-1380.644) (-1385.644) -- 0:02:44
132500 -- (-1381.571) (-1378.551) [-1374.214] (-1379.346) * [-1379.259] (-1379.413) (-1383.632) (-1387.454) -- 0:02:43
133000 -- [-1378.581] (-1387.783) (-1378.577) (-1378.793) * [-1378.412] (-1386.888) (-1380.294) (-1384.850) -- 0:02:42
133500 -- [-1379.586] (-1381.508) (-1382.198) (-1386.451) * (-1380.202) (-1386.002) [-1378.077] (-1380.121) -- 0:02:42
134000 -- [-1381.137] (-1382.563) (-1378.116) (-1386.043) * (-1378.320) (-1384.847) (-1378.929) [-1377.618] -- 0:02:41
134500 -- (-1386.924) [-1385.579] (-1378.740) (-1382.767) * (-1374.649) (-1388.180) (-1381.729) [-1375.305] -- 0:02:47
135000 -- (-1381.693) [-1383.478] (-1381.531) (-1382.197) * (-1378.627) (-1381.562) (-1378.358) [-1374.345] -- 0:02:46
Average standard deviation of split frequencies: 0.010399
135500 -- (-1386.093) (-1384.634) (-1381.864) [-1375.210] * (-1376.526) [-1377.624] (-1381.584) (-1384.540) -- 0:02:45
136000 -- [-1385.457] (-1380.300) (-1380.693) (-1384.479) * (-1380.251) (-1382.030) [-1380.770] (-1384.748) -- 0:02:45
136500 -- [-1381.137] (-1384.526) (-1379.431) (-1378.726) * (-1375.870) [-1375.492] (-1383.887) (-1377.971) -- 0:02:44
137000 -- (-1377.385) (-1382.971) [-1375.688] (-1382.847) * [-1376.689] (-1382.147) (-1381.853) (-1378.028) -- 0:02:43
137500 -- (-1377.986) [-1376.805] (-1376.503) (-1377.747) * (-1376.831) [-1381.262] (-1384.743) (-1380.593) -- 0:02:43
138000 -- (-1376.441) (-1380.002) (-1381.164) [-1377.889] * (-1380.297) (-1378.328) (-1382.212) [-1379.350] -- 0:02:42
138500 -- (-1379.269) (-1379.559) (-1382.296) [-1376.602] * (-1382.733) [-1377.150] (-1380.208) (-1384.634) -- 0:02:41
139000 -- (-1376.385) [-1378.984] (-1380.746) (-1385.379) * (-1381.369) (-1376.190) [-1384.310] (-1383.604) -- 0:02:41
139500 -- (-1381.201) (-1378.177) (-1377.425) [-1383.617] * [-1380.249] (-1378.656) (-1391.187) (-1380.173) -- 0:02:40
140000 -- (-1386.209) (-1383.999) (-1379.544) [-1380.065] * (-1377.314) (-1389.701) (-1381.251) [-1378.783] -- 0:02:45
Average standard deviation of split frequencies: 0.008378
140500 -- (-1382.607) (-1383.047) [-1379.932] (-1378.385) * (-1378.318) [-1382.813] (-1377.160) (-1384.362) -- 0:02:45
141000 -- [-1388.295] (-1378.311) (-1381.862) (-1377.229) * [-1380.016] (-1383.559) (-1380.412) (-1385.734) -- 0:02:44
141500 -- (-1379.104) (-1384.361) [-1384.998] (-1374.225) * (-1385.127) [-1383.291] (-1376.232) (-1387.320) -- 0:02:43
142000 -- [-1376.568] (-1373.702) (-1380.747) (-1379.033) * (-1380.219) [-1377.724] (-1380.794) (-1377.579) -- 0:02:43
142500 -- [-1378.322] (-1380.804) (-1379.828) (-1377.683) * (-1379.384) (-1374.960) (-1374.522) [-1381.123] -- 0:02:42
143000 -- (-1381.259) (-1377.050) (-1386.633) [-1379.877] * (-1380.306) [-1380.800] (-1377.122) (-1380.900) -- 0:02:41
143500 -- [-1374.237] (-1385.863) (-1382.970) (-1375.909) * (-1378.817) [-1382.086] (-1382.718) (-1376.557) -- 0:02:41
144000 -- [-1375.798] (-1380.776) (-1383.416) (-1381.082) * (-1383.310) (-1380.108) (-1378.993) [-1382.762] -- 0:02:40
144500 -- (-1381.955) [-1380.589] (-1377.582) (-1378.394) * [-1377.123] (-1378.813) (-1377.675) (-1376.431) -- 0:02:39
145000 -- (-1383.994) (-1378.533) (-1374.790) [-1375.160] * (-1382.443) [-1383.708] (-1375.796) (-1376.289) -- 0:02:45
Average standard deviation of split frequencies: 0.009686
145500 -- (-1383.001) (-1378.565) [-1377.040] (-1373.295) * (-1382.614) (-1387.946) [-1381.019] (-1380.088) -- 0:02:44
146000 -- (-1383.937) (-1378.419) [-1379.447] (-1377.164) * [-1386.939] (-1378.480) (-1375.903) (-1386.198) -- 0:02:43
146500 -- (-1387.202) (-1377.207) (-1380.621) [-1376.697] * (-1379.223) [-1383.228] (-1384.737) (-1378.749) -- 0:02:43
147000 -- (-1386.518) (-1383.787) [-1382.415] (-1380.622) * (-1376.095) (-1384.470) [-1379.263] (-1379.666) -- 0:02:42
147500 -- (-1380.673) (-1380.563) (-1384.333) [-1379.946] * (-1377.752) (-1377.645) [-1374.609] (-1382.360) -- 0:02:41
148000 -- [-1378.407] (-1383.206) (-1380.677) (-1381.670) * (-1377.758) [-1379.664] (-1382.416) (-1381.570) -- 0:02:41
148500 -- (-1384.003) [-1380.679] (-1382.243) (-1384.020) * (-1382.664) (-1384.741) [-1380.567] (-1384.352) -- 0:02:40
149000 -- (-1388.178) [-1378.179] (-1379.775) (-1378.347) * (-1381.016) (-1381.732) [-1377.703] (-1384.473) -- 0:02:39
149500 -- [-1385.825] (-1391.257) (-1386.537) (-1379.862) * [-1379.743] (-1382.340) (-1382.012) (-1379.653) -- 0:02:39
150000 -- [-1377.292] (-1382.573) (-1378.511) (-1381.784) * (-1391.535) (-1383.906) [-1381.792] (-1374.204) -- 0:02:44
Average standard deviation of split frequencies: 0.010951
150500 -- (-1378.564) (-1378.637) [-1376.755] (-1380.472) * (-1381.970) (-1386.562) (-1382.773) [-1374.423] -- 0:02:43
151000 -- (-1375.143) (-1385.930) [-1374.754] (-1379.570) * (-1381.628) (-1385.040) (-1384.467) [-1376.375] -- 0:02:43
151500 -- (-1379.598) [-1381.138] (-1376.518) (-1388.821) * [-1376.105] (-1381.980) (-1381.511) (-1383.739) -- 0:02:42
152000 -- (-1380.977) (-1379.350) (-1379.126) [-1380.765] * (-1380.707) [-1379.922] (-1379.118) (-1388.270) -- 0:02:41
152500 -- [-1378.557] (-1377.995) (-1383.178) (-1386.450) * (-1377.878) (-1377.931) [-1381.759] (-1384.896) -- 0:02:41
153000 -- [-1376.356] (-1377.662) (-1386.841) (-1375.941) * [-1377.159] (-1379.633) (-1382.579) (-1382.034) -- 0:02:40
153500 -- (-1382.963) (-1378.095) (-1388.408) [-1375.071] * (-1378.565) (-1382.191) (-1384.629) [-1375.895] -- 0:02:39
154000 -- (-1376.963) [-1375.817] (-1378.940) (-1381.967) * (-1379.735) (-1384.260) (-1378.757) [-1377.226] -- 0:02:39
154500 -- [-1380.395] (-1379.446) (-1382.888) (-1374.951) * [-1381.366] (-1380.616) (-1380.460) (-1377.137) -- 0:02:38
155000 -- (-1379.317) (-1380.302) (-1381.048) [-1379.010] * [-1380.057] (-1379.032) (-1378.621) (-1379.623) -- 0:02:38
Average standard deviation of split frequencies: 0.010576
155500 -- (-1375.817) (-1393.039) (-1379.189) [-1379.343] * [-1379.171] (-1381.225) (-1382.482) (-1380.922) -- 0:02:42
156000 -- (-1386.153) [-1376.967] (-1378.844) (-1381.639) * [-1382.488] (-1373.940) (-1389.858) (-1388.857) -- 0:02:42
156500 -- [-1383.899] (-1378.957) (-1376.625) (-1383.208) * (-1378.606) [-1378.497] (-1378.853) (-1381.968) -- 0:02:41
157000 -- (-1382.698) (-1374.856) [-1374.642] (-1378.660) * (-1374.664) (-1380.619) (-1379.741) [-1379.902] -- 0:02:41
157500 -- (-1376.903) (-1386.623) [-1379.658] (-1375.399) * (-1376.876) [-1378.797] (-1381.701) (-1382.497) -- 0:02:40
158000 -- (-1380.848) (-1377.672) (-1383.128) [-1380.916] * (-1384.603) [-1378.409] (-1387.314) (-1378.701) -- 0:02:39
158500 -- (-1378.034) (-1376.291) (-1382.437) [-1380.705] * [-1377.294] (-1376.553) (-1390.807) (-1383.431) -- 0:02:39
159000 -- (-1377.331) (-1378.132) (-1381.891) [-1376.754] * (-1380.089) [-1379.781] (-1383.648) (-1377.873) -- 0:02:38
159500 -- (-1378.554) [-1378.116] (-1384.124) (-1374.514) * (-1375.916) (-1383.376) [-1378.037] (-1381.432) -- 0:02:38
160000 -- (-1374.375) (-1381.864) [-1378.723] (-1383.155) * (-1379.961) (-1379.538) [-1377.094] (-1379.383) -- 0:02:37
Average standard deviation of split frequencies: 0.010269
160500 -- [-1377.961] (-1378.196) (-1377.779) (-1382.889) * (-1383.687) (-1382.499) [-1375.903] (-1384.407) -- 0:02:36
161000 -- (-1381.082) (-1379.159) [-1376.123] (-1382.025) * (-1382.720) (-1383.864) [-1381.749] (-1388.883) -- 0:02:41
161500 -- [-1379.048] (-1378.161) (-1376.672) (-1381.078) * (-1379.869) (-1380.652) (-1383.173) [-1373.827] -- 0:02:40
162000 -- (-1385.052) [-1381.050] (-1375.511) (-1378.405) * (-1379.886) (-1384.544) (-1391.647) [-1376.726] -- 0:02:40
162500 -- (-1379.308) [-1377.106] (-1379.911) (-1377.434) * [-1382.001] (-1379.314) (-1384.189) (-1379.190) -- 0:02:39
163000 -- (-1385.340) (-1385.280) [-1376.938] (-1377.762) * (-1380.985) [-1375.212] (-1391.761) (-1379.378) -- 0:02:39
163500 -- (-1382.643) [-1382.099] (-1376.704) (-1384.064) * [-1382.914] (-1382.837) (-1383.808) (-1380.576) -- 0:02:38
164000 -- (-1390.114) (-1385.186) (-1381.693) [-1376.445] * [-1378.632] (-1386.824) (-1392.601) (-1390.684) -- 0:02:38
164500 -- [-1379.337] (-1383.427) (-1381.906) (-1377.119) * (-1377.924) (-1381.061) (-1389.705) [-1382.652] -- 0:02:37
165000 -- (-1380.265) (-1379.042) (-1379.920) [-1376.170] * (-1378.257) [-1380.728] (-1385.735) (-1383.219) -- 0:02:36
Average standard deviation of split frequencies: 0.009939
165500 -- (-1386.257) (-1380.090) (-1386.446) [-1381.675] * (-1377.664) (-1378.042) (-1387.114) [-1376.869] -- 0:02:36
166000 -- (-1382.966) (-1387.989) (-1385.548) [-1382.505] * (-1381.643) (-1380.448) (-1383.937) [-1380.248] -- 0:02:40
166500 -- (-1383.615) (-1385.259) (-1375.360) [-1377.320] * (-1381.965) (-1378.957) (-1393.041) [-1379.884] -- 0:02:40
167000 -- (-1381.636) (-1382.113) (-1377.992) [-1378.361] * (-1384.416) (-1381.894) (-1385.464) [-1377.202] -- 0:02:39
167500 -- (-1378.632) (-1389.746) [-1380.326] (-1378.787) * (-1380.206) (-1385.940) [-1376.971] (-1377.925) -- 0:02:39
168000 -- (-1378.979) [-1382.017] (-1381.180) (-1378.453) * (-1382.858) (-1373.234) [-1378.513] (-1380.457) -- 0:02:38
168500 -- [-1379.883] (-1382.438) (-1380.888) (-1382.583) * (-1382.651) (-1375.446) [-1381.523] (-1380.586) -- 0:02:37
169000 -- [-1375.250] (-1393.077) (-1381.380) (-1379.518) * (-1387.421) [-1377.333] (-1378.289) (-1383.381) -- 0:02:37
169500 -- (-1378.107) (-1382.266) [-1376.458] (-1382.185) * (-1384.764) (-1381.012) [-1379.484] (-1381.757) -- 0:02:36
170000 -- [-1374.847] (-1383.858) (-1381.909) (-1378.190) * (-1380.351) [-1379.359] (-1380.773) (-1382.750) -- 0:02:36
Average standard deviation of split frequencies: 0.009667
170500 -- (-1379.085) (-1379.282) [-1382.341] (-1388.603) * (-1377.006) (-1381.048) [-1376.108] (-1386.341) -- 0:02:35
171000 -- [-1377.227] (-1384.780) (-1374.984) (-1377.158) * (-1378.586) (-1382.632) [-1378.114] (-1381.128) -- 0:02:35
171500 -- (-1377.962) (-1383.427) [-1384.723] (-1377.960) * [-1380.608] (-1378.605) (-1379.534) (-1383.538) -- 0:02:39
172000 -- (-1377.871) [-1381.584] (-1379.828) (-1378.884) * [-1375.723] (-1375.050) (-1382.530) (-1377.099) -- 0:02:38
172500 -- [-1376.072] (-1384.351) (-1376.805) (-1376.774) * (-1379.326) (-1379.508) (-1379.162) [-1378.169] -- 0:02:38
173000 -- (-1383.467) (-1381.193) [-1379.452] (-1379.714) * (-1381.240) (-1384.080) [-1379.305] (-1385.286) -- 0:02:37
173500 -- (-1384.898) [-1383.080] (-1376.420) (-1377.145) * [-1374.117] (-1380.879) (-1379.452) (-1376.409) -- 0:02:37
174000 -- (-1380.550) (-1380.366) [-1378.104] (-1378.379) * (-1381.828) (-1383.755) [-1377.522] (-1384.391) -- 0:02:36
174500 -- (-1379.339) (-1386.127) (-1376.905) [-1379.361] * (-1381.522) (-1383.643) (-1381.237) [-1376.919] -- 0:02:36
175000 -- (-1380.737) (-1386.481) (-1375.880) [-1376.853] * (-1382.917) [-1378.190] (-1379.083) (-1375.686) -- 0:02:35
Average standard deviation of split frequencies: 0.009375
175500 -- (-1375.496) (-1384.156) (-1379.534) [-1381.418] * (-1384.120) (-1379.357) [-1379.170] (-1378.365) -- 0:02:35
176000 -- (-1387.594) (-1383.781) [-1377.472] (-1376.549) * (-1383.313) [-1378.906] (-1378.192) (-1385.530) -- 0:02:34
176500 -- [-1377.665] (-1390.236) (-1378.722) (-1376.851) * (-1373.698) [-1375.178] (-1387.443) (-1391.515) -- 0:02:38
177000 -- [-1373.757] (-1383.354) (-1383.833) (-1379.933) * (-1381.154) (-1378.681) [-1383.220] (-1380.259) -- 0:02:38
177500 -- (-1378.257) [-1379.398] (-1381.449) (-1381.385) * (-1379.597) (-1381.952) [-1381.920] (-1380.409) -- 0:02:37
178000 -- (-1378.610) (-1379.439) [-1379.551] (-1378.515) * [-1377.493] (-1380.529) (-1383.357) (-1378.890) -- 0:02:37
178500 -- (-1382.077) (-1376.127) [-1378.095] (-1384.541) * [-1375.323] (-1382.492) (-1379.768) (-1379.182) -- 0:02:36
179000 -- (-1375.515) [-1378.522] (-1378.770) (-1379.554) * (-1379.145) (-1384.462) (-1388.415) [-1380.037] -- 0:02:35
179500 -- [-1379.980] (-1378.321) (-1376.080) (-1381.401) * [-1378.723] (-1376.532) (-1379.687) (-1382.463) -- 0:02:35
180000 -- [-1382.176] (-1377.160) (-1377.867) (-1377.008) * (-1387.205) [-1377.315] (-1382.285) (-1378.772) -- 0:02:34
Average standard deviation of split frequencies: 0.006523
180500 -- (-1379.443) (-1381.965) [-1376.429] (-1380.045) * [-1377.591] (-1375.520) (-1381.554) (-1376.074) -- 0:02:34
181000 -- [-1381.274] (-1383.319) (-1380.201) (-1380.017) * (-1378.171) [-1376.616] (-1382.885) (-1380.323) -- 0:02:33
181500 -- (-1380.021) [-1380.326] (-1379.905) (-1375.853) * (-1383.815) (-1381.366) (-1378.173) [-1379.294] -- 0:02:33
182000 -- [-1380.615] (-1383.699) (-1380.805) (-1377.975) * (-1383.659) [-1374.204] (-1377.040) (-1379.818) -- 0:02:37
182500 -- (-1379.640) (-1380.316) [-1383.750] (-1380.951) * (-1382.736) (-1377.653) (-1379.652) [-1377.731] -- 0:02:36
183000 -- [-1379.915] (-1385.877) (-1377.947) (-1386.672) * (-1379.102) [-1378.141] (-1376.663) (-1377.363) -- 0:02:36
183500 -- [-1375.339] (-1381.429) (-1377.622) (-1380.261) * [-1385.094] (-1381.985) (-1381.723) (-1376.238) -- 0:02:35
184000 -- (-1375.172) (-1383.478) (-1384.409) [-1377.403] * (-1384.654) (-1381.829) (-1377.530) [-1376.367] -- 0:02:35
184500 -- (-1375.858) [-1383.044] (-1383.261) (-1379.625) * (-1384.028) (-1387.672) [-1381.174] (-1374.419) -- 0:02:34
185000 -- [-1378.170] (-1385.600) (-1379.999) (-1381.453) * (-1373.222) (-1377.714) (-1378.091) [-1374.693] -- 0:02:34
Average standard deviation of split frequencies: 0.007603
185500 -- (-1380.556) (-1376.095) [-1380.835] (-1379.826) * (-1379.315) (-1383.297) [-1381.415] (-1378.936) -- 0:02:33
186000 -- [-1379.898] (-1382.733) (-1376.615) (-1380.572) * (-1380.933) (-1379.945) [-1375.032] (-1376.958) -- 0:02:33
186500 -- (-1377.785) (-1380.131) (-1377.059) [-1378.451] * [-1384.140] (-1376.263) (-1378.998) (-1380.076) -- 0:02:32
187000 -- [-1381.471] (-1382.557) (-1387.638) (-1380.731) * (-1382.844) (-1380.077) [-1376.545] (-1378.191) -- 0:02:36
187500 -- [-1376.546] (-1382.108) (-1387.430) (-1380.850) * [-1379.659] (-1379.246) (-1376.531) (-1380.350) -- 0:02:36
188000 -- (-1378.327) (-1380.563) (-1383.893) [-1382.578] * [-1376.918] (-1384.944) (-1378.526) (-1377.604) -- 0:02:35
188500 -- (-1379.915) (-1381.043) [-1376.060] (-1384.479) * [-1375.244] (-1381.037) (-1386.082) (-1375.661) -- 0:02:34
189000 -- (-1382.134) [-1378.141] (-1376.901) (-1382.924) * [-1376.397] (-1376.422) (-1386.111) (-1377.014) -- 0:02:34
189500 -- (-1378.914) (-1377.048) [-1378.462] (-1374.880) * [-1381.157] (-1380.118) (-1377.429) (-1380.702) -- 0:02:33
190000 -- (-1384.932) (-1378.441) [-1380.419] (-1376.750) * (-1378.901) (-1381.197) [-1376.201] (-1379.181) -- 0:02:33
Average standard deviation of split frequencies: 0.007417
190500 -- (-1381.629) [-1377.228] (-1374.744) (-1376.742) * (-1381.846) (-1384.324) (-1389.262) [-1377.540] -- 0:02:32
191000 -- (-1377.340) (-1380.257) [-1381.072] (-1377.268) * (-1377.893) (-1379.385) (-1378.578) [-1375.663] -- 0:02:32
191500 -- (-1378.959) [-1378.041] (-1381.924) (-1381.941) * [-1378.590] (-1380.947) (-1378.111) (-1377.019) -- 0:02:31
192000 -- (-1377.600) [-1380.781] (-1381.034) (-1378.103) * [-1379.569] (-1380.123) (-1378.408) (-1376.046) -- 0:02:31
192500 -- (-1380.779) (-1380.403) [-1382.600] (-1376.626) * (-1374.806) (-1375.447) [-1380.289] (-1380.075) -- 0:02:35
193000 -- (-1380.067) [-1376.632] (-1385.185) (-1385.929) * (-1379.635) (-1381.571) (-1394.296) [-1377.203] -- 0:02:34
193500 -- [-1378.949] (-1378.122) (-1379.610) (-1376.839) * [-1377.489] (-1378.165) (-1383.303) (-1379.140) -- 0:02:34
194000 -- [-1379.456] (-1377.983) (-1387.817) (-1376.112) * (-1374.016) (-1381.736) [-1376.002] (-1381.051) -- 0:02:33
194500 -- (-1385.588) (-1384.325) (-1384.789) [-1378.764] * (-1378.963) (-1379.581) [-1378.317] (-1383.320) -- 0:02:33
195000 -- (-1379.605) (-1380.556) (-1383.170) [-1380.185] * (-1378.594) [-1378.443] (-1375.651) (-1381.042) -- 0:02:32
Average standard deviation of split frequencies: 0.007215
195500 -- (-1380.827) (-1378.752) [-1381.832] (-1380.962) * (-1383.724) (-1389.561) (-1376.598) [-1376.336] -- 0:02:32
196000 -- (-1382.507) (-1383.374) (-1379.151) [-1379.117] * (-1378.720) (-1380.335) [-1375.540] (-1381.721) -- 0:02:31
196500 -- (-1379.646) [-1374.507] (-1375.648) (-1386.329) * (-1380.550) (-1387.424) (-1380.879) [-1380.961] -- 0:02:31
197000 -- (-1376.246) (-1391.299) (-1376.232) [-1379.442] * (-1376.719) (-1375.551) [-1377.557] (-1383.291) -- 0:02:30
197500 -- (-1379.371) (-1379.244) [-1380.520] (-1378.246) * (-1381.229) [-1376.022] (-1377.602) (-1375.830) -- 0:02:30
198000 -- [-1377.557] (-1384.782) (-1378.966) (-1383.629) * (-1380.550) (-1386.308) [-1375.429] (-1379.248) -- 0:02:33
198500 -- [-1376.682] (-1395.930) (-1378.052) (-1380.126) * (-1375.909) [-1382.375] (-1384.566) (-1377.638) -- 0:02:33
199000 -- (-1377.962) (-1383.069) [-1383.045] (-1378.218) * [-1376.454] (-1382.197) (-1379.609) (-1382.912) -- 0:02:32
199500 -- (-1381.553) (-1387.364) [-1376.012] (-1379.536) * (-1379.897) (-1380.326) [-1377.621] (-1375.012) -- 0:02:32
200000 -- (-1378.728) (-1376.991) [-1376.194] (-1378.024) * (-1384.293) [-1377.023] (-1381.188) (-1381.572) -- 0:02:32
Average standard deviation of split frequencies: 0.007048
200500 -- (-1375.109) (-1377.257) [-1381.979] (-1385.640) * (-1378.631) [-1379.572] (-1378.340) (-1376.240) -- 0:02:31
201000 -- [-1383.364] (-1380.900) (-1375.655) (-1387.202) * [-1375.978] (-1383.374) (-1377.661) (-1374.210) -- 0:02:31
201500 -- [-1386.994] (-1381.565) (-1390.084) (-1374.670) * (-1381.063) (-1378.976) [-1375.231] (-1377.035) -- 0:02:30
202000 -- (-1379.813) (-1380.228) (-1387.317) [-1376.908] * (-1376.737) (-1378.685) (-1376.769) [-1376.937] -- 0:02:30
202500 -- (-1374.498) (-1379.846) (-1379.514) [-1377.983] * (-1375.861) (-1378.221) (-1382.839) [-1387.322] -- 0:02:29
203000 -- (-1376.113) (-1380.174) (-1378.156) [-1378.951] * (-1375.359) [-1376.623] (-1381.373) (-1380.743) -- 0:02:33
203500 -- [-1376.828] (-1386.081) (-1388.294) (-1380.750) * [-1381.216] (-1379.824) (-1377.238) (-1378.420) -- 0:02:32
204000 -- (-1381.467) (-1385.644) [-1382.046] (-1376.682) * (-1377.583) [-1379.418] (-1375.922) (-1377.624) -- 0:02:32
204500 -- (-1378.342) (-1386.203) [-1380.997] (-1374.572) * (-1376.931) [-1378.683] (-1378.187) (-1379.196) -- 0:02:31
205000 -- [-1379.717] (-1387.157) (-1379.896) (-1376.481) * [-1378.836] (-1383.621) (-1380.147) (-1378.498) -- 0:02:31
Average standard deviation of split frequencies: 0.005721
205500 -- (-1384.579) (-1394.463) (-1381.541) [-1378.339] * (-1389.258) (-1381.171) [-1379.321] (-1383.659) -- 0:02:30
206000 -- (-1374.836) (-1382.810) [-1377.488] (-1381.320) * [-1385.117] (-1379.052) (-1383.381) (-1384.003) -- 0:02:30
206500 -- (-1375.945) (-1378.670) (-1379.442) [-1382.202] * (-1378.659) (-1374.052) (-1380.401) [-1376.322] -- 0:02:29
207000 -- (-1377.025) [-1379.470] (-1378.757) (-1384.445) * (-1380.950) (-1379.955) (-1378.303) [-1377.433] -- 0:02:29
207500 -- (-1379.287) (-1380.282) (-1381.608) [-1379.873] * (-1377.302) (-1377.884) [-1376.077] (-1376.706) -- 0:02:28
208000 -- (-1378.819) [-1377.694] (-1379.491) (-1381.787) * (-1380.960) (-1374.924) (-1392.927) [-1377.695] -- 0:02:28
208500 -- [-1376.187] (-1380.768) (-1383.496) (-1380.173) * [-1382.916] (-1382.915) (-1386.127) (-1384.692) -- 0:02:31
209000 -- (-1375.385) [-1377.670] (-1382.447) (-1386.082) * [-1385.782] (-1386.733) (-1378.739) (-1383.122) -- 0:02:31
209500 -- (-1376.605) [-1380.498] (-1376.914) (-1377.023) * (-1395.096) (-1384.273) (-1384.260) [-1379.853] -- 0:02:30
210000 -- (-1377.163) (-1380.077) (-1379.839) [-1380.092] * (-1383.290) (-1382.281) [-1377.530] (-1383.984) -- 0:02:30
Average standard deviation of split frequencies: 0.005594
210500 -- (-1382.202) (-1381.906) [-1376.919] (-1382.664) * [-1384.402] (-1381.693) (-1379.646) (-1377.824) -- 0:02:30
211000 -- (-1380.435) (-1378.487) [-1375.119] (-1383.241) * (-1382.998) (-1382.730) (-1382.231) [-1377.400] -- 0:02:29
211500 -- (-1379.595) [-1378.578] (-1374.460) (-1380.267) * (-1386.439) [-1380.860] (-1383.760) (-1377.427) -- 0:02:29
212000 -- (-1380.938) (-1382.449) [-1377.244] (-1385.382) * (-1384.952) [-1383.226] (-1381.675) (-1381.396) -- 0:02:28
212500 -- (-1381.687) (-1377.450) [-1377.840] (-1378.767) * [-1378.504] (-1381.711) (-1382.913) (-1384.024) -- 0:02:28
213000 -- (-1380.175) (-1379.043) (-1377.486) [-1381.902] * [-1381.572] (-1381.458) (-1380.696) (-1378.984) -- 0:02:27
213500 -- [-1378.201] (-1377.512) (-1381.403) (-1383.166) * (-1380.549) (-1381.653) [-1374.362] (-1383.388) -- 0:02:27
214000 -- [-1379.638] (-1376.747) (-1379.606) (-1377.114) * [-1380.923] (-1382.456) (-1376.769) (-1385.716) -- 0:02:30
214500 -- [-1377.296] (-1379.983) (-1377.648) (-1377.265) * (-1377.928) (-1383.792) [-1383.743] (-1378.604) -- 0:02:30
215000 -- (-1382.745) [-1380.014] (-1376.283) (-1377.379) * [-1376.021] (-1381.422) (-1383.575) (-1380.659) -- 0:02:29
Average standard deviation of split frequencies: 0.004365
215500 -- (-1389.925) (-1377.206) [-1376.533] (-1378.791) * (-1377.161) (-1378.658) [-1382.084] (-1381.137) -- 0:02:29
216000 -- (-1384.906) [-1380.388] (-1382.881) (-1381.309) * (-1381.742) (-1377.447) (-1375.786) [-1376.331] -- 0:02:28
216500 -- (-1380.942) (-1380.055) [-1375.936] (-1378.742) * (-1377.259) (-1379.405) (-1379.155) [-1378.019] -- 0:02:28
217000 -- (-1383.312) (-1380.257) (-1381.011) [-1379.933] * (-1376.577) (-1376.040) (-1382.875) [-1379.847] -- 0:02:27
217500 -- (-1377.508) (-1382.884) (-1374.717) [-1378.197] * [-1377.933] (-1378.326) (-1386.576) (-1375.095) -- 0:02:27
218000 -- [-1379.797] (-1385.428) (-1378.401) (-1382.883) * (-1379.982) (-1377.354) [-1382.932] (-1378.391) -- 0:02:27
218500 -- (-1383.299) [-1377.563] (-1380.257) (-1381.578) * (-1377.583) (-1377.824) (-1387.222) [-1375.034] -- 0:02:26
219000 -- [-1386.015] (-1383.807) (-1377.557) (-1382.165) * [-1377.866] (-1376.229) (-1381.252) (-1376.273) -- 0:02:29
219500 -- (-1379.562) [-1380.411] (-1377.350) (-1376.891) * [-1378.634] (-1379.261) (-1388.126) (-1379.117) -- 0:02:29
220000 -- (-1380.983) (-1376.632) [-1378.285] (-1380.507) * (-1382.534) [-1375.040] (-1382.529) (-1377.400) -- 0:02:28
Average standard deviation of split frequencies: 0.004273
220500 -- (-1380.783) (-1377.781) (-1375.462) [-1375.793] * [-1376.689] (-1378.018) (-1382.942) (-1389.293) -- 0:02:28
221000 -- (-1388.001) (-1379.705) [-1378.280] (-1377.035) * (-1378.870) (-1375.671) [-1377.034] (-1386.067) -- 0:02:28
221500 -- (-1379.799) (-1376.644) [-1373.468] (-1380.304) * (-1378.274) [-1379.628] (-1383.509) (-1379.527) -- 0:02:27
222000 -- (-1378.692) (-1378.759) [-1379.206] (-1382.116) * (-1379.709) (-1377.913) (-1378.651) [-1377.276] -- 0:02:27
222500 -- (-1382.305) (-1377.486) (-1377.575) [-1376.947] * (-1375.173) (-1375.881) [-1378.982] (-1380.368) -- 0:02:26
223000 -- (-1378.877) (-1377.384) (-1378.994) [-1376.654] * (-1379.140) (-1378.636) (-1374.937) [-1375.910] -- 0:02:26
223500 -- (-1378.004) [-1375.217] (-1381.769) (-1382.179) * (-1375.311) [-1375.499] (-1376.421) (-1376.050) -- 0:02:25
224000 -- (-1379.750) [-1374.941] (-1386.809) (-1378.631) * [-1375.252] (-1376.005) (-1376.429) (-1383.101) -- 0:02:25
224500 -- (-1376.904) (-1378.685) (-1381.069) [-1376.222] * (-1375.949) (-1385.949) (-1377.950) [-1377.077] -- 0:02:28
225000 -- (-1374.081) [-1374.919] (-1383.680) (-1381.985) * (-1374.211) (-1376.880) [-1377.212] (-1379.060) -- 0:02:28
Average standard deviation of split frequencies: 0.004172
225500 -- (-1375.583) (-1381.956) (-1377.825) [-1376.778] * (-1381.401) (-1380.776) [-1376.617] (-1377.856) -- 0:02:27
226000 -- [-1382.084] (-1381.623) (-1376.317) (-1381.628) * (-1393.536) (-1378.225) [-1378.702] (-1378.956) -- 0:02:27
226500 -- (-1383.802) [-1377.449] (-1383.876) (-1386.700) * (-1393.122) (-1382.946) (-1379.502) [-1388.207] -- 0:02:26
227000 -- (-1387.088) (-1377.802) [-1375.515] (-1388.985) * (-1385.747) (-1381.697) (-1380.789) [-1377.785] -- 0:02:26
227500 -- [-1379.717] (-1383.212) (-1379.861) (-1393.537) * [-1382.683] (-1383.519) (-1375.710) (-1385.187) -- 0:02:26
228000 -- [-1377.377] (-1379.300) (-1383.491) (-1376.359) * (-1378.076) [-1378.216] (-1377.989) (-1378.558) -- 0:02:25
228500 -- (-1382.242) (-1378.329) (-1380.912) [-1379.316] * [-1384.402] (-1376.719) (-1381.638) (-1376.808) -- 0:02:25
229000 -- (-1377.730) (-1384.494) [-1382.042] (-1381.602) * [-1378.778] (-1375.540) (-1387.333) (-1379.418) -- 0:02:24
229500 -- (-1376.708) [-1375.311] (-1380.424) (-1378.683) * (-1379.844) (-1379.138) (-1384.729) [-1378.627] -- 0:02:24
230000 -- (-1379.579) [-1383.649] (-1383.878) (-1379.157) * [-1376.482] (-1377.754) (-1377.964) (-1376.228) -- 0:02:27
Average standard deviation of split frequencies: 0.005109
230500 -- (-1374.051) (-1380.194) (-1376.147) [-1375.215] * (-1379.980) (-1381.810) [-1377.140] (-1377.486) -- 0:02:26
231000 -- (-1376.565) (-1384.419) (-1375.760) [-1374.841] * [-1382.525] (-1374.906) (-1383.307) (-1379.349) -- 0:02:26
231500 -- (-1377.293) [-1379.921] (-1378.591) (-1387.858) * [-1381.309] (-1387.544) (-1376.035) (-1382.921) -- 0:02:26
232000 -- (-1376.764) (-1378.417) (-1380.012) [-1377.323] * (-1382.583) [-1386.773] (-1384.553) (-1381.139) -- 0:02:25
232500 -- (-1381.589) [-1379.915] (-1382.689) (-1382.951) * (-1375.732) [-1382.043] (-1381.591) (-1381.829) -- 0:02:25
233000 -- (-1379.664) (-1385.165) (-1379.299) [-1379.073] * [-1378.948] (-1386.931) (-1380.040) (-1385.856) -- 0:02:24
233500 -- (-1380.704) [-1385.342] (-1375.963) (-1380.672) * (-1376.605) [-1380.960] (-1377.089) (-1381.385) -- 0:02:24
234000 -- [-1376.079] (-1389.389) (-1378.914) (-1380.739) * (-1378.154) (-1379.352) (-1380.812) [-1378.179] -- 0:02:24
234500 -- [-1376.318] (-1378.545) (-1378.517) (-1384.464) * (-1377.534) [-1380.906] (-1374.903) (-1382.932) -- 0:02:23
235000 -- (-1378.802) [-1374.972] (-1383.933) (-1380.196) * [-1378.113] (-1381.278) (-1380.037) (-1381.334) -- 0:02:26
Average standard deviation of split frequencies: 0.004994
235500 -- (-1379.840) (-1377.997) (-1378.336) [-1377.892] * (-1379.428) [-1377.452] (-1385.602) (-1380.907) -- 0:02:26
236000 -- (-1377.336) (-1378.723) (-1381.342) [-1378.348] * [-1375.728] (-1381.063) (-1386.174) (-1382.407) -- 0:02:25
236500 -- [-1373.983] (-1379.636) (-1377.009) (-1381.938) * (-1375.693) (-1376.321) (-1385.987) [-1382.275] -- 0:02:25
237000 -- [-1376.085] (-1388.735) (-1378.561) (-1378.273) * (-1379.672) (-1381.165) [-1381.008] (-1379.700) -- 0:02:24
237500 -- (-1380.141) (-1384.020) (-1379.176) [-1377.108] * (-1381.839) (-1382.672) [-1377.078] (-1380.876) -- 0:02:24
238000 -- (-1382.974) [-1380.497] (-1389.184) (-1380.302) * (-1381.191) [-1380.239] (-1374.762) (-1379.737) -- 0:02:24
238500 -- (-1375.117) (-1376.127) [-1381.469] (-1382.724) * (-1381.809) [-1382.629] (-1379.083) (-1375.641) -- 0:02:23
239000 -- (-1378.202) (-1384.713) [-1378.511] (-1380.188) * (-1380.743) (-1377.799) [-1379.330] (-1378.919) -- 0:02:23
239500 -- (-1375.285) (-1377.392) (-1387.909) [-1378.940] * [-1374.787] (-1379.882) (-1378.692) (-1379.863) -- 0:02:22
240000 -- (-1382.092) [-1379.674] (-1385.256) (-1383.434) * [-1379.535] (-1378.028) (-1375.821) (-1378.456) -- 0:02:22
Average standard deviation of split frequencies: 0.002938
240500 -- (-1385.946) (-1381.500) [-1382.033] (-1379.207) * (-1379.662) (-1385.346) (-1380.668) [-1375.957] -- 0:02:25
241000 -- (-1378.826) (-1385.483) (-1382.450) [-1383.008] * (-1384.610) (-1380.761) [-1376.755] (-1379.207) -- 0:02:24
241500 -- (-1382.780) (-1374.981) [-1381.631] (-1379.131) * (-1382.339) (-1381.309) [-1373.675] (-1379.247) -- 0:02:24
242000 -- (-1378.198) (-1379.599) (-1378.750) [-1374.649] * (-1379.484) (-1387.230) [-1376.866] (-1382.443) -- 0:02:24
242500 -- [-1377.360] (-1375.171) (-1381.913) (-1375.810) * (-1376.888) (-1393.153) [-1376.014] (-1383.674) -- 0:02:23
243000 -- (-1380.573) [-1380.565] (-1379.557) (-1379.718) * (-1379.113) (-1380.946) [-1376.599] (-1381.514) -- 0:02:23
243500 -- (-1376.710) [-1378.078] (-1378.673) (-1375.237) * (-1381.546) (-1382.641) (-1377.622) [-1378.805] -- 0:02:22
244000 -- (-1376.466) (-1377.953) (-1389.722) [-1382.970] * (-1386.669) [-1378.679] (-1377.375) (-1380.400) -- 0:02:22
244500 -- (-1375.428) [-1389.156] (-1382.744) (-1377.693) * (-1377.741) [-1379.326] (-1379.353) (-1381.639) -- 0:02:22
245000 -- (-1377.370) [-1376.521] (-1383.630) (-1382.459) * (-1384.678) (-1382.941) [-1382.238] (-1385.469) -- 0:02:21
Average standard deviation of split frequencies: 0.001916
245500 -- (-1379.624) [-1381.942] (-1379.925) (-1382.784) * (-1381.002) (-1385.113) [-1377.920] (-1381.854) -- 0:02:24
246000 -- (-1384.272) (-1384.545) [-1379.498] (-1379.392) * (-1387.658) [-1383.347] (-1382.716) (-1379.122) -- 0:02:24
246500 -- [-1381.583] (-1386.914) (-1388.460) (-1380.360) * (-1384.769) (-1386.454) (-1378.610) [-1383.586] -- 0:02:23
247000 -- (-1383.000) (-1383.393) (-1383.927) [-1383.811] * (-1383.671) (-1398.110) [-1382.057] (-1378.347) -- 0:02:23
247500 -- (-1379.910) [-1376.727] (-1378.981) (-1380.395) * (-1388.137) (-1379.180) [-1380.892] (-1378.995) -- 0:02:22
248000 -- (-1380.483) (-1376.761) [-1375.107] (-1382.005) * (-1384.555) (-1384.860) (-1380.345) [-1381.606] -- 0:02:22
248500 -- (-1386.082) (-1378.326) [-1376.892] (-1392.471) * [-1383.774] (-1381.581) (-1385.531) (-1380.315) -- 0:02:22
249000 -- (-1388.537) (-1377.469) [-1381.910] (-1385.628) * [-1376.926] (-1379.720) (-1379.287) (-1376.198) -- 0:02:21
249500 -- (-1388.528) (-1384.946) [-1376.842] (-1379.845) * (-1380.287) (-1378.605) (-1377.616) [-1379.439] -- 0:02:21
250000 -- [-1383.289] (-1379.601) (-1379.609) (-1381.475) * [-1377.943] (-1377.600) (-1379.253) (-1386.185) -- 0:02:21
Average standard deviation of split frequencies: 0.001881
250500 -- (-1381.628) (-1384.717) (-1379.311) [-1381.792] * (-1384.241) [-1382.136] (-1374.658) (-1381.816) -- 0:02:20
251000 -- [-1381.068] (-1388.592) (-1379.254) (-1377.927) * [-1375.487] (-1382.786) (-1376.300) (-1385.861) -- 0:02:23
251500 -- (-1378.610) (-1380.951) [-1381.003] (-1375.983) * [-1383.571] (-1381.279) (-1383.443) (-1379.899) -- 0:02:22
252000 -- (-1386.403) [-1381.097] (-1378.345) (-1387.554) * (-1376.253) (-1387.577) [-1390.307] (-1380.585) -- 0:02:22
252500 -- (-1381.753) [-1377.599] (-1378.544) (-1379.097) * (-1379.562) (-1382.869) (-1382.162) [-1378.608] -- 0:02:22
253000 -- (-1383.242) (-1379.625) [-1375.140] (-1387.549) * (-1380.940) (-1382.226) (-1376.294) [-1383.183] -- 0:02:21
253500 -- (-1382.126) (-1377.442) [-1378.562] (-1377.771) * (-1380.933) (-1385.144) (-1378.061) [-1381.844] -- 0:02:21
254000 -- (-1379.897) (-1383.236) [-1375.691] (-1380.513) * (-1376.853) [-1381.612] (-1382.848) (-1380.035) -- 0:02:20
254500 -- [-1378.431] (-1381.206) (-1378.139) (-1381.140) * (-1382.565) [-1378.882] (-1379.092) (-1381.209) -- 0:02:20
255000 -- (-1382.174) [-1378.629] (-1381.516) (-1386.647) * (-1375.011) (-1388.399) (-1375.366) [-1376.146] -- 0:02:20
Average standard deviation of split frequencies: 0.001841
255500 -- [-1384.474] (-1381.900) (-1378.454) (-1377.493) * [-1379.457] (-1380.027) (-1382.169) (-1376.829) -- 0:02:19
256000 -- (-1384.757) (-1379.679) (-1378.793) [-1374.373] * (-1385.581) (-1375.305) [-1382.924] (-1379.607) -- 0:02:22
256500 -- (-1381.922) (-1379.802) [-1379.922] (-1377.968) * (-1383.700) (-1386.766) [-1376.835] (-1382.235) -- 0:02:22
257000 -- [-1376.058] (-1378.332) (-1384.633) (-1376.170) * (-1381.635) (-1376.636) [-1377.812] (-1377.220) -- 0:02:21
257500 -- (-1378.614) (-1376.276) (-1376.467) [-1374.041] * [-1380.377] (-1383.202) (-1376.588) (-1374.862) -- 0:02:21
258000 -- (-1383.461) (-1377.640) [-1378.790] (-1382.485) * (-1381.026) [-1378.764] (-1381.937) (-1374.233) -- 0:02:20
258500 -- (-1383.187) (-1380.785) [-1377.970] (-1377.752) * (-1386.886) (-1397.278) (-1379.970) [-1384.027] -- 0:02:20
259000 -- (-1375.790) (-1379.998) [-1376.237] (-1376.659) * (-1380.871) (-1383.930) [-1383.478] (-1378.374) -- 0:02:20
259500 -- (-1383.911) (-1381.454) (-1375.732) [-1382.290] * [-1380.336] (-1376.706) (-1385.090) (-1379.574) -- 0:02:19
260000 -- (-1376.172) (-1375.604) [-1380.522] (-1378.529) * (-1378.009) (-1384.781) [-1377.958] (-1375.341) -- 0:02:19
Average standard deviation of split frequencies: 0.001808
260500 -- (-1377.314) (-1381.180) [-1375.507] (-1378.222) * [-1377.143] (-1379.211) (-1378.171) (-1377.240) -- 0:02:19
261000 -- [-1379.098] (-1383.573) (-1378.763) (-1379.531) * (-1386.155) [-1377.402] (-1374.718) (-1378.644) -- 0:02:18
261500 -- (-1377.531) (-1376.905) [-1381.194] (-1378.182) * (-1390.381) (-1378.818) [-1375.956] (-1376.834) -- 0:02:21
262000 -- (-1377.288) (-1377.573) [-1382.911] (-1382.837) * [-1383.051] (-1383.992) (-1380.944) (-1381.208) -- 0:02:20
262500 -- (-1379.602) (-1379.850) (-1383.533) [-1381.908] * (-1384.166) [-1380.642] (-1381.333) (-1379.004) -- 0:02:20
263000 -- [-1379.162] (-1385.987) (-1389.475) (-1383.235) * (-1386.840) (-1379.875) [-1379.092] (-1377.737) -- 0:02:20
263500 -- (-1380.083) (-1383.941) (-1388.756) [-1381.052] * [-1379.003] (-1384.144) (-1385.992) (-1378.897) -- 0:02:19
264000 -- (-1375.948) (-1383.682) [-1374.860] (-1385.115) * (-1383.022) [-1379.762] (-1383.804) (-1375.537) -- 0:02:19
264500 -- (-1378.171) (-1383.598) [-1375.897] (-1381.440) * (-1378.570) (-1382.169) (-1377.984) [-1381.867] -- 0:02:19
265000 -- (-1378.149) (-1376.699) [-1378.337] (-1376.114) * [-1377.703] (-1380.109) (-1382.161) (-1381.335) -- 0:02:18
Average standard deviation of split frequencies: 0.001772
265500 -- (-1376.271) [-1377.295] (-1378.024) (-1376.639) * (-1385.932) [-1376.296] (-1378.726) (-1382.013) -- 0:02:18
266000 -- (-1376.976) (-1378.685) (-1377.843) [-1375.348] * (-1378.780) [-1373.772] (-1379.098) (-1381.852) -- 0:02:17
266500 -- (-1385.350) [-1376.297] (-1381.013) (-1377.612) * (-1380.900) [-1380.689] (-1377.420) (-1375.271) -- 0:02:20
267000 -- (-1380.120) (-1380.171) (-1377.224) [-1378.900] * [-1380.721] (-1378.342) (-1384.227) (-1380.712) -- 0:02:20
267500 -- [-1374.120] (-1380.609) (-1387.873) (-1379.643) * (-1376.934) [-1377.717] (-1375.525) (-1376.580) -- 0:02:19
268000 -- [-1376.451] (-1377.973) (-1388.949) (-1376.199) * (-1379.810) (-1378.521) (-1385.202) [-1377.741] -- 0:02:19
268500 -- [-1376.646] (-1381.651) (-1379.786) (-1384.484) * (-1378.156) (-1382.951) (-1384.755) [-1378.703] -- 0:02:18
269000 -- (-1378.418) (-1387.125) [-1380.252] (-1379.714) * (-1381.478) (-1376.258) [-1379.597] (-1384.895) -- 0:02:18
269500 -- [-1382.204] (-1383.677) (-1384.342) (-1378.673) * (-1380.513) [-1377.298] (-1380.902) (-1383.778) -- 0:02:18
270000 -- (-1377.674) [-1389.566] (-1379.734) (-1378.014) * [-1381.988] (-1379.857) (-1381.915) (-1378.711) -- 0:02:17
Average standard deviation of split frequencies: 0.001742
270500 -- (-1377.431) [-1376.996] (-1380.086) (-1375.782) * (-1379.714) (-1381.329) [-1377.444] (-1378.507) -- 0:02:17
271000 -- (-1380.109) (-1381.265) (-1380.690) [-1384.338] * (-1382.471) [-1376.678] (-1381.129) (-1383.354) -- 0:02:17
271500 -- (-1378.149) (-1384.559) [-1378.359] (-1381.094) * [-1376.102] (-1378.183) (-1380.792) (-1377.310) -- 0:02:16
272000 -- (-1380.595) (-1383.642) [-1379.867] (-1380.970) * [-1379.807] (-1379.893) (-1378.744) (-1378.628) -- 0:02:19
272500 -- (-1379.287) [-1381.059] (-1381.522) (-1380.484) * (-1380.121) (-1384.197) [-1378.244] (-1381.929) -- 0:02:18
273000 -- (-1380.382) [-1377.471] (-1379.634) (-1387.837) * (-1381.428) [-1378.424] (-1383.800) (-1380.632) -- 0:02:18
273500 -- [-1380.648] (-1381.969) (-1378.799) (-1382.835) * (-1379.015) (-1382.428) (-1380.057) [-1376.921] -- 0:02:18
274000 -- [-1376.701] (-1384.379) (-1378.055) (-1384.086) * (-1377.449) (-1379.050) [-1379.076] (-1377.176) -- 0:02:17
274500 -- [-1377.805] (-1384.171) (-1375.399) (-1385.034) * (-1379.830) (-1378.674) [-1373.349] (-1379.422) -- 0:02:17
275000 -- (-1386.239) (-1376.620) [-1379.488] (-1381.776) * (-1383.179) (-1381.001) (-1376.449) [-1376.405] -- 0:02:17
Average standard deviation of split frequencies: 0.001708
275500 -- [-1376.415] (-1378.121) (-1387.474) (-1381.954) * (-1385.542) (-1376.638) (-1377.762) [-1376.052] -- 0:02:16
276000 -- (-1382.065) [-1380.340] (-1385.387) (-1378.685) * (-1380.078) (-1385.041) [-1385.140] (-1378.542) -- 0:02:16
276500 -- (-1377.814) (-1373.955) (-1382.544) [-1373.632] * (-1385.498) [-1379.032] (-1382.617) (-1383.047) -- 0:02:16
277000 -- (-1378.967) (-1375.220) (-1375.037) [-1377.105] * (-1388.557) (-1384.179) [-1381.238] (-1375.768) -- 0:02:15
277500 -- (-1375.705) (-1376.322) [-1375.452] (-1375.981) * [-1381.217] (-1385.066) (-1379.411) (-1378.341) -- 0:02:17
278000 -- (-1379.194) (-1385.254) (-1378.510) [-1376.256] * [-1379.567] (-1376.382) (-1379.413) (-1381.989) -- 0:02:17
278500 -- (-1380.143) [-1378.571] (-1387.202) (-1379.958) * (-1387.544) (-1378.850) (-1379.360) [-1377.527] -- 0:02:17
279000 -- (-1386.536) (-1378.811) (-1373.784) [-1378.584] * (-1394.950) [-1376.249] (-1381.143) (-1381.307) -- 0:02:16
279500 -- (-1391.592) (-1380.692) (-1377.198) [-1379.819] * (-1385.050) (-1376.227) [-1377.718] (-1380.349) -- 0:02:16
280000 -- (-1378.882) (-1376.764) (-1386.916) [-1376.365] * (-1389.197) (-1376.565) [-1382.164] (-1378.665) -- 0:02:16
Average standard deviation of split frequencies: 0.001680
280500 -- (-1387.236) (-1378.641) [-1376.869] (-1383.376) * (-1383.907) (-1379.290) [-1379.358] (-1384.233) -- 0:02:15
281000 -- (-1382.228) (-1378.769) (-1379.129) [-1376.932] * (-1387.942) (-1381.014) (-1380.046) [-1377.680] -- 0:02:15
281500 -- [-1378.343] (-1378.639) (-1381.399) (-1378.965) * (-1388.102) (-1378.749) (-1378.417) [-1375.100] -- 0:02:15
282000 -- (-1379.775) [-1378.155] (-1380.658) (-1385.616) * (-1380.546) [-1379.536] (-1380.087) (-1378.324) -- 0:02:14
282500 -- [-1377.455] (-1380.120) (-1383.918) (-1376.634) * [-1381.281] (-1380.126) (-1385.586) (-1379.488) -- 0:02:17
283000 -- (-1382.553) (-1382.689) (-1382.152) [-1378.844] * (-1382.336) [-1373.324] (-1392.829) (-1374.614) -- 0:02:16
283500 -- (-1380.342) [-1379.784] (-1381.813) (-1377.917) * (-1389.743) (-1389.854) [-1379.412] (-1380.495) -- 0:02:16
284000 -- (-1383.796) (-1381.923) (-1376.517) [-1383.486] * (-1382.633) [-1379.209] (-1377.635) (-1381.597) -- 0:02:16
284500 -- (-1381.945) (-1377.173) [-1382.164] (-1377.489) * (-1393.578) (-1376.975) [-1380.970] (-1378.536) -- 0:02:15
285000 -- (-1384.614) (-1385.833) (-1378.604) [-1376.723] * [-1376.573] (-1374.740) (-1377.802) (-1377.078) -- 0:02:15
Average standard deviation of split frequencies: 0.001648
285500 -- (-1377.580) (-1379.911) [-1375.587] (-1386.103) * (-1382.062) [-1381.994] (-1378.020) (-1379.035) -- 0:02:15
286000 -- [-1380.975] (-1378.938) (-1375.332) (-1384.671) * (-1381.051) (-1379.234) [-1380.504] (-1379.304) -- 0:02:14
286500 -- (-1379.553) (-1378.556) (-1382.734) [-1377.399] * [-1380.168] (-1376.517) (-1377.236) (-1377.138) -- 0:02:14
287000 -- (-1388.469) [-1375.522] (-1376.595) (-1378.891) * (-1377.297) [-1377.823] (-1376.390) (-1376.925) -- 0:02:14
287500 -- (-1380.196) (-1383.142) [-1376.218] (-1379.980) * (-1382.464) (-1376.691) [-1375.937] (-1379.977) -- 0:02:13
288000 -- (-1380.683) (-1378.517) [-1379.496] (-1376.737) * (-1380.836) [-1376.340] (-1380.630) (-1380.623) -- 0:02:15
288500 -- (-1373.420) [-1378.793] (-1379.447) (-1377.834) * (-1378.503) [-1374.248] (-1377.582) (-1381.551) -- 0:02:15
289000 -- (-1381.128) (-1388.091) [-1381.835] (-1377.549) * [-1379.486] (-1377.314) (-1381.051) (-1386.672) -- 0:02:15
289500 -- (-1382.015) (-1373.965) [-1379.705] (-1381.401) * (-1379.152) [-1376.858] (-1381.033) (-1382.411) -- 0:02:14
290000 -- (-1386.487) (-1377.986) (-1377.281) [-1378.441] * (-1379.931) [-1375.876] (-1380.368) (-1384.900) -- 0:02:14
Average standard deviation of split frequencies: 0.001622
290500 -- [-1383.696] (-1377.988) (-1380.034) (-1382.877) * (-1379.452) (-1375.921) [-1387.938] (-1377.600) -- 0:02:14
291000 -- (-1378.466) (-1378.953) [-1379.431] (-1375.498) * (-1381.368) [-1379.756] (-1394.404) (-1381.103) -- 0:02:14
291500 -- (-1383.697) [-1380.088] (-1384.649) (-1379.045) * (-1382.901) [-1375.975] (-1389.389) (-1378.747) -- 0:02:13
292000 -- (-1375.643) [-1383.228] (-1380.120) (-1383.316) * (-1386.244) (-1379.320) (-1386.809) [-1381.929] -- 0:02:13
292500 -- (-1376.853) (-1384.134) (-1379.697) [-1379.659] * (-1381.422) [-1376.952] (-1385.547) (-1377.245) -- 0:02:13
293000 -- [-1378.899] (-1387.208) (-1377.850) (-1376.761) * (-1381.001) (-1383.011) (-1386.578) [-1378.174] -- 0:02:15
293500 -- [-1379.947] (-1385.567) (-1380.241) (-1382.169) * [-1383.267] (-1376.251) (-1397.390) (-1375.795) -- 0:02:14
294000 -- [-1379.973] (-1380.715) (-1379.662) (-1381.563) * (-1377.718) [-1377.658] (-1394.671) (-1375.446) -- 0:02:14
294500 -- (-1380.875) (-1384.634) (-1376.724) [-1377.712] * [-1377.543] (-1377.806) (-1383.319) (-1380.737) -- 0:02:14
295000 -- (-1382.228) (-1377.233) [-1375.361] (-1380.157) * [-1374.904] (-1376.735) (-1378.724) (-1375.627) -- 0:02:13
Average standard deviation of split frequencies: 0.001593
295500 -- (-1374.223) (-1383.565) [-1377.276] (-1380.407) * [-1375.206] (-1373.871) (-1378.348) (-1376.643) -- 0:02:13
296000 -- (-1379.999) [-1385.918] (-1381.701) (-1378.954) * (-1381.988) [-1377.807] (-1378.584) (-1377.370) -- 0:02:13
296500 -- (-1377.850) (-1381.351) (-1378.784) [-1378.042] * (-1378.505) [-1375.741] (-1383.709) (-1383.850) -- 0:02:12
297000 -- (-1390.809) (-1383.884) (-1377.491) [-1377.714] * (-1377.422) (-1377.243) (-1378.195) [-1382.053] -- 0:02:12
297500 -- [-1375.754] (-1385.436) (-1374.205) (-1378.535) * (-1378.630) (-1380.918) (-1378.801) [-1381.391] -- 0:02:12
298000 -- (-1378.708) (-1382.935) [-1383.654] (-1383.176) * (-1384.084) (-1378.617) [-1375.482] (-1378.439) -- 0:02:11
298500 -- (-1375.668) (-1383.978) [-1385.006] (-1376.383) * (-1380.199) [-1379.355] (-1376.754) (-1379.630) -- 0:02:13
299000 -- [-1376.663] (-1387.653) (-1384.713) (-1377.691) * (-1380.528) (-1383.109) (-1379.658) [-1383.922] -- 0:02:13
299500 -- (-1382.698) (-1380.261) [-1380.364] (-1381.841) * (-1381.354) (-1379.614) (-1384.794) [-1379.611] -- 0:02:13
300000 -- (-1382.061) (-1380.935) [-1377.468] (-1380.074) * (-1377.418) (-1381.158) (-1381.470) [-1378.689] -- 0:02:13
Average standard deviation of split frequencies: 0.001568
300500 -- (-1382.956) (-1382.922) [-1380.708] (-1381.927) * (-1378.670) [-1376.482] (-1386.610) (-1383.940) -- 0:02:12
301000 -- (-1378.346) [-1382.352] (-1379.135) (-1381.390) * [-1387.085] (-1381.033) (-1381.119) (-1379.808) -- 0:02:12
301500 -- (-1380.274) [-1376.125] (-1376.835) (-1385.186) * [-1379.686] (-1378.994) (-1383.923) (-1379.536) -- 0:02:12
302000 -- (-1379.985) (-1375.599) (-1380.964) [-1376.516] * [-1380.279] (-1381.162) (-1381.604) (-1381.191) -- 0:02:11
302500 -- (-1382.370) [-1376.378] (-1381.309) (-1380.409) * [-1379.345] (-1379.660) (-1377.720) (-1376.410) -- 0:02:11
303000 -- [-1381.078] (-1378.680) (-1378.423) (-1386.959) * [-1380.030] (-1382.445) (-1377.194) (-1384.253) -- 0:02:11
303500 -- [-1384.256] (-1383.186) (-1378.420) (-1387.183) * [-1376.268] (-1380.266) (-1374.077) (-1380.285) -- 0:02:13
304000 -- (-1384.389) (-1382.227) [-1381.531] (-1380.691) * [-1374.862] (-1380.631) (-1378.422) (-1376.140) -- 0:02:12
304500 -- (-1378.716) [-1383.146] (-1377.004) (-1383.824) * (-1377.730) [-1380.474] (-1377.242) (-1381.045) -- 0:02:12
305000 -- [-1377.435] (-1385.599) (-1379.510) (-1377.401) * (-1378.198) (-1380.264) (-1382.174) [-1379.519] -- 0:02:12
Average standard deviation of split frequencies: 0.001541
305500 -- (-1379.513) (-1389.728) (-1375.615) [-1379.003] * (-1386.049) [-1379.684] (-1377.548) (-1381.269) -- 0:02:11
306000 -- [-1378.458] (-1383.878) (-1378.495) (-1389.209) * (-1385.989) (-1378.116) (-1384.883) [-1376.037] -- 0:02:11
306500 -- (-1376.398) [-1375.297] (-1382.055) (-1383.313) * (-1389.459) (-1378.990) [-1380.810] (-1379.323) -- 0:02:11
307000 -- [-1377.740] (-1378.024) (-1381.635) (-1384.075) * (-1384.651) (-1377.743) [-1375.108] (-1383.673) -- 0:02:10
307500 -- [-1381.126] (-1377.360) (-1377.590) (-1381.031) * (-1376.755) [-1375.837] (-1381.748) (-1380.146) -- 0:02:10
308000 -- [-1376.208] (-1382.242) (-1375.767) (-1377.476) * (-1377.456) [-1380.257] (-1387.037) (-1377.997) -- 0:02:10
308500 -- (-1377.203) (-1385.823) [-1377.149] (-1378.259) * (-1394.485) (-1376.709) (-1379.829) [-1377.170] -- 0:02:10
309000 -- [-1377.488] (-1384.415) (-1377.025) (-1382.536) * [-1380.984] (-1383.710) (-1379.439) (-1391.404) -- 0:02:11
309500 -- [-1381.378] (-1383.247) (-1376.895) (-1377.993) * (-1381.293) (-1386.446) [-1380.253] (-1383.559) -- 0:02:11
310000 -- (-1374.629) (-1374.586) (-1378.506) [-1378.221] * [-1374.910] (-1384.631) (-1382.502) (-1376.384) -- 0:02:11
Average standard deviation of split frequencies: 0.001517
310500 -- (-1379.521) (-1382.408) [-1380.736] (-1383.878) * (-1377.646) [-1375.730] (-1383.312) (-1379.657) -- 0:02:11
311000 -- (-1377.032) [-1385.235] (-1379.340) (-1374.896) * [-1379.784] (-1375.576) (-1383.524) (-1377.246) -- 0:02:10
311500 -- (-1380.914) (-1383.691) [-1377.167] (-1380.868) * (-1383.152) (-1382.206) (-1386.783) [-1377.568] -- 0:02:10
312000 -- (-1385.114) (-1382.528) [-1375.957] (-1381.524) * (-1380.106) (-1379.533) [-1380.513] (-1377.846) -- 0:02:10
312500 -- (-1378.892) [-1381.329] (-1384.125) (-1380.980) * [-1377.782] (-1387.456) (-1380.605) (-1377.227) -- 0:02:09
313000 -- [-1377.312] (-1377.182) (-1378.310) (-1388.291) * (-1377.036) (-1391.308) (-1377.920) [-1378.798] -- 0:02:09
313500 -- (-1377.141) (-1379.637) [-1377.673] (-1377.914) * [-1381.688] (-1381.708) (-1378.489) (-1381.411) -- 0:02:09
314000 -- (-1377.922) (-1381.659) (-1385.343) [-1374.094] * [-1379.342] (-1389.632) (-1388.603) (-1386.851) -- 0:02:08
314500 -- [-1378.446] (-1378.124) (-1383.000) (-1376.725) * [-1377.431] (-1377.307) (-1381.410) (-1380.299) -- 0:02:10
315000 -- [-1380.846] (-1380.644) (-1384.459) (-1378.274) * (-1382.267) (-1375.309) [-1375.287] (-1377.651) -- 0:02:10
Average standard deviation of split frequencies: 0.001492
315500 -- [-1375.264] (-1378.658) (-1380.322) (-1377.548) * (-1379.459) [-1375.912] (-1385.238) (-1378.284) -- 0:02:10
316000 -- (-1375.848) (-1378.374) (-1374.066) [-1378.401] * (-1378.197) [-1381.126] (-1380.185) (-1378.491) -- 0:02:09
316500 -- (-1377.844) (-1388.629) (-1382.244) [-1379.666] * (-1374.370) [-1379.142] (-1382.839) (-1379.408) -- 0:02:09
317000 -- (-1378.858) (-1379.522) [-1375.288] (-1380.898) * (-1378.429) [-1379.938] (-1384.384) (-1378.270) -- 0:02:09
317500 -- [-1377.306] (-1378.462) (-1377.675) (-1377.633) * [-1374.735] (-1380.813) (-1381.818) (-1381.496) -- 0:02:08
318000 -- (-1374.197) (-1376.566) (-1377.734) [-1378.738] * [-1382.319] (-1385.488) (-1390.118) (-1379.465) -- 0:02:08
318500 -- (-1380.605) (-1373.609) [-1381.420] (-1377.835) * (-1380.044) [-1382.447] (-1383.783) (-1380.772) -- 0:02:08
319000 -- [-1378.198] (-1380.487) (-1379.321) (-1384.430) * (-1377.415) (-1385.791) [-1381.486] (-1384.596) -- 0:02:08
319500 -- (-1376.738) (-1384.803) (-1380.416) [-1376.677] * (-1374.857) (-1380.374) (-1384.681) [-1375.644] -- 0:02:09
320000 -- (-1388.251) [-1376.860] (-1380.191) (-1380.450) * (-1381.518) [-1383.128] (-1385.899) (-1376.834) -- 0:02:09
Average standard deviation of split frequencies: 0.001470
320500 -- [-1383.322] (-1381.641) (-1378.717) (-1375.643) * [-1379.368] (-1386.552) (-1378.867) (-1383.857) -- 0:02:09
321000 -- (-1375.726) (-1384.900) (-1379.327) [-1376.933] * (-1374.677) (-1380.193) [-1379.114] (-1383.156) -- 0:02:09
321500 -- (-1389.206) (-1384.622) (-1385.128) [-1380.254] * (-1377.139) [-1382.481] (-1379.303) (-1378.789) -- 0:02:08
322000 -- (-1379.884) [-1378.173] (-1377.779) (-1376.819) * (-1375.622) [-1378.963] (-1385.655) (-1379.746) -- 0:02:08
322500 -- (-1381.997) [-1377.811] (-1384.033) (-1386.356) * (-1379.281) [-1375.439] (-1382.355) (-1381.312) -- 0:02:08
323000 -- (-1378.742) (-1386.960) (-1376.294) [-1380.931] * (-1382.107) (-1376.311) [-1377.206] (-1384.879) -- 0:02:07
323500 -- (-1380.947) (-1384.459) [-1374.937] (-1382.065) * (-1378.796) [-1378.520] (-1381.431) (-1377.723) -- 0:02:07
324000 -- (-1377.039) [-1382.028] (-1390.074) (-1379.051) * (-1377.231) [-1379.086] (-1376.635) (-1377.533) -- 0:02:07
324500 -- (-1382.035) (-1384.141) [-1376.148] (-1381.540) * [-1376.462] (-1380.850) (-1377.983) (-1379.420) -- 0:02:06
325000 -- (-1383.367) (-1384.613) [-1376.105] (-1383.164) * [-1379.080] (-1378.604) (-1375.907) (-1381.831) -- 0:02:08
Average standard deviation of split frequencies: 0.000723
325500 -- [-1374.514] (-1380.712) (-1376.743) (-1373.784) * [-1380.013] (-1379.825) (-1379.207) (-1379.162) -- 0:02:08
326000 -- [-1375.347] (-1379.712) (-1378.334) (-1378.541) * [-1377.075] (-1377.849) (-1380.945) (-1380.005) -- 0:02:08
326500 -- (-1378.206) (-1376.492) (-1379.726) [-1380.225] * (-1377.638) [-1377.050] (-1383.677) (-1375.284) -- 0:02:07
327000 -- (-1380.739) [-1377.121] (-1383.416) (-1377.632) * (-1383.928) (-1377.225) [-1382.615] (-1376.764) -- 0:02:07
327500 -- [-1382.016] (-1376.722) (-1381.497) (-1378.214) * (-1383.999) [-1376.907] (-1388.047) (-1377.791) -- 0:02:07
328000 -- (-1379.880) (-1381.022) [-1378.818] (-1377.998) * [-1385.908] (-1376.567) (-1379.270) (-1377.657) -- 0:02:07
328500 -- (-1377.474) (-1375.682) (-1385.532) [-1377.469] * (-1383.009) [-1381.630] (-1382.606) (-1380.818) -- 0:02:06
329000 -- (-1383.241) [-1379.034] (-1376.506) (-1375.530) * (-1378.507) (-1376.713) (-1380.643) [-1379.182] -- 0:02:06
329500 -- (-1383.428) (-1378.575) [-1382.216] (-1378.260) * (-1376.783) (-1375.724) [-1380.629] (-1379.581) -- 0:02:06
330000 -- [-1383.036] (-1381.259) (-1375.193) (-1376.239) * (-1380.058) (-1380.547) (-1380.273) [-1378.676] -- 0:02:07
Average standard deviation of split frequencies: 0.000713
330500 -- (-1376.951) (-1385.750) (-1375.090) [-1376.828] * (-1377.778) [-1385.930] (-1379.555) (-1384.685) -- 0:02:07
331000 -- (-1383.641) (-1383.271) [-1376.843] (-1383.187) * (-1378.764) [-1376.620] (-1380.478) (-1379.358) -- 0:02:07
331500 -- (-1383.748) (-1377.822) (-1380.366) [-1381.158] * (-1382.757) (-1378.203) (-1383.075) [-1383.414] -- 0:02:07
332000 -- (-1383.872) [-1377.493] (-1377.286) (-1389.094) * (-1379.776) [-1378.184] (-1379.013) (-1376.308) -- 0:02:06
332500 -- (-1379.431) [-1378.542] (-1382.827) (-1384.490) * [-1376.011] (-1376.308) (-1377.183) (-1378.481) -- 0:02:06
333000 -- (-1383.101) [-1383.734] (-1378.678) (-1380.108) * (-1385.520) (-1376.390) [-1375.725] (-1375.792) -- 0:02:06
333500 -- (-1379.515) (-1374.803) (-1385.475) [-1374.968] * (-1381.955) (-1379.621) (-1381.782) [-1373.765] -- 0:02:05
334000 -- [-1381.235] (-1383.056) (-1379.630) (-1383.048) * (-1384.366) (-1379.538) (-1376.924) [-1379.329] -- 0:02:05
334500 -- (-1382.003) [-1381.253] (-1381.905) (-1378.477) * [-1379.770] (-1376.419) (-1383.165) (-1376.266) -- 0:02:05
335000 -- (-1385.516) (-1378.574) [-1376.923] (-1375.942) * [-1383.277] (-1376.686) (-1377.290) (-1381.175) -- 0:02:05
Average standard deviation of split frequencies: 0.000701
335500 -- [-1376.899] (-1382.987) (-1383.547) (-1374.973) * [-1377.321] (-1382.525) (-1377.066) (-1385.304) -- 0:02:06
336000 -- [-1374.807] (-1381.193) (-1389.828) (-1378.897) * (-1379.117) (-1378.200) [-1383.990] (-1384.201) -- 0:02:06
336500 -- (-1376.505) [-1373.051] (-1386.331) (-1387.602) * (-1380.138) [-1382.447] (-1376.486) (-1383.964) -- 0:02:06
337000 -- (-1378.358) (-1377.357) [-1378.038] (-1385.957) * (-1382.430) [-1377.843] (-1377.532) (-1385.647) -- 0:02:05
337500 -- (-1379.302) (-1381.545) [-1378.656] (-1381.973) * [-1378.832] (-1377.478) (-1379.770) (-1386.139) -- 0:02:05
338000 -- (-1378.563) (-1380.888) [-1379.518] (-1384.303) * [-1382.498] (-1382.146) (-1384.199) (-1380.520) -- 0:02:05
338500 -- (-1377.961) (-1391.109) [-1381.405] (-1384.513) * (-1384.758) [-1379.722] (-1377.363) (-1382.959) -- 0:02:05
339000 -- (-1382.471) [-1381.318] (-1376.602) (-1382.431) * [-1378.620] (-1379.187) (-1386.559) (-1383.498) -- 0:02:04
339500 -- (-1376.703) (-1384.594) [-1380.224] (-1385.923) * (-1375.984) (-1373.856) (-1378.631) [-1376.986] -- 0:02:04
340000 -- (-1385.331) (-1387.959) (-1383.875) [-1382.443] * (-1378.984) (-1376.163) [-1377.199] (-1382.768) -- 0:02:04
Average standard deviation of split frequencies: 0.000692
340500 -- (-1376.292) (-1379.204) [-1376.264] (-1388.004) * (-1380.935) [-1378.070] (-1376.656) (-1374.113) -- 0:02:05
341000 -- [-1384.077] (-1380.621) (-1384.908) (-1380.879) * [-1379.027] (-1383.728) (-1384.159) (-1376.040) -- 0:02:05
341500 -- [-1377.213] (-1383.291) (-1378.401) (-1378.623) * (-1378.716) [-1384.112] (-1376.902) (-1384.372) -- 0:02:05
342000 -- (-1381.637) (-1375.301) (-1379.939) [-1377.284] * (-1381.135) (-1387.288) [-1376.970] (-1379.592) -- 0:02:05
342500 -- (-1386.896) (-1377.526) (-1385.656) [-1378.803] * (-1381.675) (-1383.999) [-1378.921] (-1376.115) -- 0:02:04
343000 -- (-1391.030) (-1379.617) [-1379.477] (-1379.502) * (-1376.839) (-1382.962) (-1379.074) [-1382.635] -- 0:02:04
343500 -- (-1385.407) (-1379.708) (-1380.934) [-1377.140] * (-1380.038) (-1376.934) (-1384.853) [-1375.281] -- 0:02:04
344000 -- (-1381.885) (-1382.831) (-1383.939) [-1376.356] * (-1378.659) [-1377.741] (-1385.946) (-1377.791) -- 0:02:03
344500 -- (-1386.047) [-1378.138] (-1382.457) (-1378.233) * [-1378.917] (-1376.941) (-1391.229) (-1381.073) -- 0:02:03
345000 -- (-1383.456) (-1379.110) [-1380.269] (-1382.214) * [-1377.227] (-1374.773) (-1395.129) (-1379.711) -- 0:02:03
Average standard deviation of split frequencies: 0.000681
345500 -- (-1382.925) [-1375.676] (-1379.996) (-1383.211) * (-1389.067) (-1376.056) (-1384.120) [-1375.952] -- 0:02:05
346000 -- (-1377.618) (-1386.627) [-1380.572] (-1380.866) * (-1384.743) (-1384.341) (-1383.524) [-1372.906] -- 0:02:04
346500 -- (-1380.635) (-1384.771) [-1376.768] (-1378.521) * [-1373.819] (-1376.486) (-1380.705) (-1375.289) -- 0:02:04
347000 -- [-1377.707] (-1385.922) (-1386.604) (-1377.995) * [-1373.893] (-1382.689) (-1382.543) (-1379.543) -- 0:02:04
347500 -- (-1379.351) (-1379.025) (-1382.793) [-1379.380] * [-1377.510] (-1380.476) (-1383.180) (-1380.148) -- 0:02:03
348000 -- [-1377.394] (-1377.431) (-1376.991) (-1377.457) * (-1379.413) (-1380.390) (-1381.720) [-1380.173] -- 0:02:03
348500 -- (-1375.944) [-1374.402] (-1380.367) (-1378.756) * (-1385.001) (-1377.901) [-1379.347] (-1382.440) -- 0:02:03
349000 -- [-1376.474] (-1377.042) (-1379.154) (-1379.876) * [-1380.724] (-1382.834) (-1377.887) (-1385.359) -- 0:02:03
349500 -- (-1380.200) (-1384.463) (-1378.278) [-1379.633] * (-1373.573) (-1383.411) [-1374.975] (-1383.070) -- 0:02:02
350000 -- (-1381.231) [-1386.148] (-1377.996) (-1380.649) * [-1377.435] (-1384.715) (-1380.539) (-1377.158) -- 0:02:02
Average standard deviation of split frequencies: 0.000000
350500 -- (-1387.357) (-1381.532) (-1377.857) [-1376.006] * [-1380.046] (-1385.806) (-1383.265) (-1379.466) -- 0:02:02
351000 -- (-1379.787) [-1379.960] (-1380.711) (-1382.469) * (-1385.650) [-1379.968] (-1381.048) (-1382.020) -- 0:02:03
351500 -- (-1377.562) [-1377.469] (-1378.057) (-1380.223) * [-1382.918] (-1378.746) (-1383.288) (-1380.506) -- 0:02:03
352000 -- (-1384.941) (-1375.478) (-1387.114) [-1384.503] * (-1384.657) (-1377.799) [-1381.230] (-1376.547) -- 0:02:03
352500 -- (-1387.798) [-1385.017] (-1377.299) (-1378.349) * [-1379.973] (-1377.092) (-1379.537) (-1377.197) -- 0:02:03
353000 -- [-1381.702] (-1381.869) (-1375.608) (-1377.482) * (-1387.640) [-1379.591] (-1384.268) (-1377.353) -- 0:02:02
353500 -- (-1386.418) (-1381.889) [-1379.767] (-1380.098) * (-1382.053) [-1373.816] (-1383.935) (-1378.098) -- 0:02:02
354000 -- (-1388.550) (-1379.573) (-1380.921) [-1375.140] * [-1379.139] (-1385.115) (-1392.158) (-1378.665) -- 0:02:02
354500 -- (-1390.863) [-1375.706] (-1380.852) (-1382.421) * (-1380.655) (-1387.617) (-1382.975) [-1375.103] -- 0:02:01
355000 -- (-1390.032) (-1381.828) (-1382.076) [-1383.016] * (-1379.055) (-1378.205) (-1382.248) [-1381.211] -- 0:02:01
Average standard deviation of split frequencies: 0.000662
355500 -- (-1384.242) (-1383.472) [-1380.713] (-1377.177) * [-1379.467] (-1382.194) (-1380.668) (-1377.329) -- 0:02:03
356000 -- [-1379.985] (-1377.474) (-1379.468) (-1379.813) * (-1378.690) (-1377.968) [-1374.847] (-1374.814) -- 0:02:03
356500 -- (-1384.661) [-1381.067] (-1381.434) (-1384.003) * (-1387.639) [-1380.427] (-1382.705) (-1379.615) -- 0:02:02
357000 -- (-1386.258) (-1382.968) (-1379.770) [-1381.655] * (-1381.279) (-1380.786) (-1376.984) [-1384.655] -- 0:02:02
357500 -- (-1380.093) [-1374.021] (-1378.075) (-1390.630) * (-1382.446) (-1380.284) [-1378.327] (-1389.124) -- 0:02:02
358000 -- (-1376.863) (-1380.102) [-1379.565] (-1381.198) * (-1380.169) [-1380.033] (-1387.898) (-1379.419) -- 0:02:01
358500 -- (-1383.858) (-1385.771) [-1381.170] (-1376.415) * [-1378.214] (-1381.139) (-1380.817) (-1376.989) -- 0:02:01
359000 -- [-1378.309] (-1379.285) (-1374.821) (-1382.174) * (-1379.418) (-1377.844) (-1382.493) [-1382.210] -- 0:02:01
359500 -- (-1377.765) (-1377.150) [-1378.294] (-1380.444) * (-1379.761) (-1376.686) (-1380.853) [-1386.702] -- 0:02:01
360000 -- [-1381.839] (-1379.650) (-1383.804) (-1384.017) * (-1382.555) (-1379.281) (-1387.107) [-1376.629] -- 0:02:00
Average standard deviation of split frequencies: 0.000654
360500 -- (-1376.376) [-1379.785] (-1381.666) (-1389.945) * (-1377.787) [-1376.456] (-1384.202) (-1374.223) -- 0:02:00
361000 -- (-1386.211) (-1385.324) (-1394.950) [-1382.749] * (-1378.022) (-1377.602) (-1381.598) [-1379.393] -- 0:02:02
361500 -- (-1377.371) (-1377.836) (-1381.955) [-1378.849] * (-1380.249) (-1381.073) (-1375.431) [-1375.413] -- 0:02:01
362000 -- (-1377.009) [-1379.192] (-1383.600) (-1378.417) * [-1381.234] (-1380.113) (-1383.066) (-1376.910) -- 0:02:01
362500 -- (-1378.069) (-1379.505) [-1377.844] (-1384.398) * (-1376.450) (-1376.753) (-1377.832) [-1375.237] -- 0:02:01
363000 -- (-1377.019) (-1380.989) (-1373.934) [-1377.718] * (-1379.940) [-1372.638] (-1378.253) (-1379.544) -- 0:02:01
363500 -- (-1384.168) (-1378.574) [-1376.583] (-1379.501) * (-1382.545) (-1386.596) [-1380.975] (-1379.233) -- 0:02:00
364000 -- [-1382.761] (-1378.404) (-1377.621) (-1380.045) * (-1378.923) (-1380.605) [-1378.835] (-1377.451) -- 0:02:00
364500 -- (-1377.570) (-1377.620) [-1378.606] (-1386.257) * (-1378.668) (-1382.111) (-1380.423) [-1377.760] -- 0:02:00
365000 -- (-1380.988) (-1382.079) [-1377.813] (-1380.655) * (-1378.030) [-1381.557] (-1377.389) (-1376.666) -- 0:02:00
Average standard deviation of split frequencies: 0.000644
365500 -- [-1379.674] (-1383.021) (-1380.607) (-1383.347) * [-1379.376] (-1380.725) (-1378.340) (-1378.420) -- 0:01:59
366000 -- (-1383.245) (-1380.886) (-1377.919) [-1379.063] * [-1376.497] (-1382.824) (-1383.168) (-1378.508) -- 0:02:01
366500 -- (-1383.784) (-1374.259) [-1375.885] (-1374.350) * (-1374.299) [-1375.052] (-1377.094) (-1383.868) -- 0:02:00
367000 -- (-1383.949) [-1373.549] (-1381.736) (-1377.983) * [-1378.034] (-1378.657) (-1377.131) (-1379.065) -- 0:02:00
367500 -- (-1377.743) (-1377.806) (-1381.881) [-1379.659] * (-1377.455) [-1377.094] (-1379.072) (-1379.240) -- 0:02:00
368000 -- (-1375.752) [-1375.328] (-1378.533) (-1387.886) * (-1376.783) [-1375.065] (-1376.734) (-1383.596) -- 0:02:00
368500 -- (-1376.741) [-1376.833] (-1376.003) (-1382.151) * (-1378.659) [-1375.728] (-1374.958) (-1380.981) -- 0:01:59
369000 -- (-1377.765) (-1378.652) [-1382.607] (-1381.645) * (-1384.566) (-1376.069) [-1378.555] (-1378.680) -- 0:01:59
369500 -- (-1377.899) [-1380.371] (-1383.594) (-1378.987) * (-1376.234) (-1382.535) (-1380.542) [-1382.364] -- 0:01:59
370000 -- (-1378.987) (-1379.637) (-1378.332) [-1381.325] * [-1381.317] (-1385.272) (-1380.990) (-1386.665) -- 0:01:59
Average standard deviation of split frequencies: 0.001908
370500 -- (-1378.034) [-1380.160] (-1376.784) (-1381.397) * (-1377.186) [-1377.936] (-1384.481) (-1391.170) -- 0:01:58
371000 -- (-1383.197) [-1393.363] (-1383.916) (-1377.501) * (-1383.119) (-1380.765) [-1381.052] (-1385.483) -- 0:01:58
371500 -- (-1374.828) (-1380.199) (-1388.738) [-1376.636] * (-1381.677) (-1383.787) [-1380.406] (-1380.070) -- 0:02:00
372000 -- [-1377.904] (-1379.027) (-1385.947) (-1378.299) * (-1378.722) [-1379.009] (-1382.759) (-1382.195) -- 0:01:59
372500 -- [-1381.032] (-1380.240) (-1378.474) (-1374.903) * [-1381.916] (-1383.398) (-1379.535) (-1390.691) -- 0:01:59
373000 -- [-1378.290] (-1377.804) (-1373.892) (-1378.256) * [-1379.702] (-1380.609) (-1373.920) (-1380.610) -- 0:01:59
373500 -- [-1379.116] (-1386.384) (-1377.926) (-1378.901) * (-1382.712) (-1383.391) [-1378.879] (-1381.242) -- 0:01:59
374000 -- (-1378.904) (-1382.649) (-1376.093) [-1378.804] * (-1374.999) (-1385.052) [-1374.240] (-1382.851) -- 0:01:58
374500 -- [-1379.415] (-1378.149) (-1376.660) (-1382.539) * (-1380.354) (-1376.544) [-1378.818] (-1390.052) -- 0:01:58
375000 -- (-1382.914) (-1375.397) (-1377.548) [-1377.326] * [-1375.796] (-1374.993) (-1381.916) (-1381.922) -- 0:01:58
Average standard deviation of split frequencies: 0.002507
375500 -- [-1377.898] (-1378.157) (-1385.022) (-1377.860) * (-1372.859) (-1386.715) [-1380.648] (-1380.857) -- 0:01:58
376000 -- (-1381.165) [-1378.799] (-1381.637) (-1378.176) * (-1379.317) [-1380.945] (-1382.769) (-1380.741) -- 0:01:57
376500 -- (-1379.698) (-1380.252) (-1380.964) [-1376.314] * [-1384.107] (-1379.822) (-1384.451) (-1379.040) -- 0:01:59
377000 -- (-1379.648) (-1383.931) (-1378.542) [-1382.045] * [-1377.410] (-1385.064) (-1381.821) (-1376.239) -- 0:01:58
377500 -- (-1385.799) (-1376.551) [-1375.589] (-1379.823) * (-1379.922) [-1380.368] (-1381.987) (-1377.709) -- 0:01:58
378000 -- (-1379.070) (-1384.477) (-1375.156) [-1377.615] * (-1373.787) (-1381.543) (-1380.563) [-1376.761] -- 0:01:58
378500 -- (-1385.728) (-1380.127) [-1378.726] (-1379.431) * (-1378.048) (-1379.772) [-1379.786] (-1378.657) -- 0:01:58
379000 -- (-1389.728) (-1383.024) (-1379.590) [-1378.280] * [-1381.087] (-1376.628) (-1392.585) (-1380.357) -- 0:01:57
379500 -- (-1380.523) [-1382.080] (-1381.712) (-1377.993) * (-1374.447) (-1379.689) (-1385.493) [-1379.942] -- 0:01:57
380000 -- [-1378.106] (-1377.828) (-1381.759) (-1380.994) * (-1376.506) (-1379.416) [-1378.300] (-1379.457) -- 0:01:57
Average standard deviation of split frequencies: 0.001858
380500 -- (-1387.243) (-1374.598) [-1379.071] (-1380.711) * (-1380.288) [-1383.151] (-1379.487) (-1382.470) -- 0:01:57
381000 -- [-1377.687] (-1382.563) (-1378.858) (-1380.665) * (-1380.180) (-1381.000) [-1377.233] (-1378.832) -- 0:01:56
381500 -- [-1380.972] (-1376.966) (-1381.717) (-1379.480) * (-1378.038) [-1380.990] (-1375.036) (-1382.671) -- 0:01:58
382000 -- (-1377.543) (-1380.000) (-1376.155) [-1379.542] * [-1380.602] (-1383.711) (-1386.798) (-1377.437) -- 0:01:58
382500 -- (-1383.481) [-1377.474] (-1383.089) (-1374.395) * [-1375.718] (-1382.747) (-1384.915) (-1373.719) -- 0:01:57
383000 -- (-1375.284) (-1380.989) [-1379.499] (-1379.224) * (-1377.461) (-1381.520) (-1378.977) [-1375.502] -- 0:01:57
383500 -- (-1378.110) (-1379.895) [-1379.482] (-1377.026) * (-1384.893) [-1374.739] (-1379.946) (-1374.238) -- 0:01:57
384000 -- (-1376.773) (-1380.123) (-1381.956) [-1383.016] * (-1387.049) (-1377.530) (-1381.035) [-1375.989] -- 0:01:57
384500 -- (-1380.375) (-1378.435) (-1379.213) [-1380.257] * (-1376.369) (-1382.370) (-1377.393) [-1377.509] -- 0:01:56
385000 -- (-1376.573) (-1377.476) (-1385.797) [-1377.251] * (-1376.918) (-1379.240) (-1378.243) [-1373.873] -- 0:01:56
Average standard deviation of split frequencies: 0.001832
385500 -- (-1379.468) (-1382.999) [-1377.397] (-1382.214) * (-1380.771) [-1378.265] (-1379.920) (-1374.934) -- 0:01:56
386000 -- (-1377.581) [-1377.773] (-1381.722) (-1383.148) * (-1384.849) (-1376.856) [-1376.718] (-1374.522) -- 0:01:56
386500 -- [-1383.273] (-1380.632) (-1376.134) (-1381.367) * [-1381.266] (-1378.968) (-1380.322) (-1390.086) -- 0:01:55
387000 -- [-1383.744] (-1380.807) (-1379.772) (-1387.919) * (-1380.476) [-1380.736] (-1382.925) (-1383.104) -- 0:01:57
387500 -- (-1377.167) [-1377.706] (-1373.611) (-1385.150) * [-1380.484] (-1376.876) (-1379.500) (-1381.791) -- 0:01:56
388000 -- (-1379.366) [-1377.578] (-1381.724) (-1383.216) * [-1378.270] (-1377.938) (-1382.014) (-1386.329) -- 0:01:56
388500 -- (-1381.091) (-1377.901) [-1376.753] (-1382.390) * (-1379.153) (-1379.258) (-1377.924) [-1388.570] -- 0:01:56
389000 -- (-1379.481) (-1373.868) (-1382.508) [-1379.944] * (-1379.997) [-1377.498] (-1380.479) (-1378.235) -- 0:01:56
389500 -- [-1377.475] (-1378.244) (-1380.694) (-1381.528) * [-1383.486] (-1385.251) (-1375.537) (-1378.411) -- 0:01:55
390000 -- [-1378.558] (-1379.713) (-1379.812) (-1378.297) * (-1380.853) [-1385.195] (-1380.986) (-1384.193) -- 0:01:55
Average standard deviation of split frequencies: 0.001810
390500 -- (-1379.666) (-1377.188) (-1377.631) [-1376.293] * (-1376.497) [-1378.029] (-1380.852) (-1382.931) -- 0:01:55
391000 -- (-1375.168) (-1377.067) [-1378.342] (-1378.951) * (-1381.779) [-1376.551] (-1380.377) (-1379.756) -- 0:01:55
391500 -- (-1385.251) (-1380.343) [-1384.788] (-1377.079) * [-1378.186] (-1379.636) (-1377.379) (-1385.867) -- 0:01:55
392000 -- [-1376.924] (-1379.643) (-1380.522) (-1378.931) * (-1378.369) (-1379.748) (-1383.944) [-1377.358] -- 0:01:56
392500 -- (-1373.719) (-1376.201) (-1386.235) [-1376.469] * (-1379.968) [-1376.759] (-1379.356) (-1376.251) -- 0:01:56
393000 -- [-1377.018] (-1386.965) (-1379.855) (-1384.622) * [-1380.064] (-1382.094) (-1375.824) (-1381.469) -- 0:01:55
393500 -- (-1376.294) [-1381.708] (-1375.984) (-1378.333) * (-1376.946) (-1383.767) [-1379.947] (-1378.939) -- 0:01:55
394000 -- (-1376.619) (-1381.948) [-1379.804] (-1378.652) * (-1378.998) (-1376.460) (-1375.242) [-1377.930] -- 0:01:55
394500 -- [-1375.871] (-1381.254) (-1379.282) (-1382.807) * (-1383.087) [-1373.701] (-1376.361) (-1379.391) -- 0:01:55
395000 -- (-1378.273) (-1380.503) (-1377.719) [-1376.335] * (-1382.295) (-1379.458) [-1374.168] (-1383.170) -- 0:01:54
Average standard deviation of split frequencies: 0.001786
395500 -- (-1380.497) [-1376.500] (-1383.440) (-1383.990) * (-1384.188) [-1380.140] (-1379.370) (-1375.426) -- 0:01:54
396000 -- [-1376.409] (-1379.711) (-1378.410) (-1379.258) * (-1379.123) [-1378.073] (-1376.115) (-1376.367) -- 0:01:54
396500 -- (-1384.416) (-1378.718) [-1380.663] (-1378.435) * (-1378.681) [-1376.658] (-1385.724) (-1382.871) -- 0:01:54
397000 -- [-1382.897] (-1375.370) (-1375.989) (-1375.568) * (-1377.529) (-1382.457) [-1378.872] (-1381.140) -- 0:01:53
397500 -- (-1381.942) (-1379.313) (-1391.150) [-1376.201] * [-1385.542] (-1378.122) (-1381.388) (-1383.741) -- 0:01:55
398000 -- (-1383.949) [-1376.211] (-1382.677) (-1384.114) * (-1374.055) (-1377.374) (-1389.624) [-1378.692] -- 0:01:54
398500 -- (-1377.731) (-1378.769) [-1377.376] (-1380.722) * [-1379.929] (-1378.032) (-1381.146) (-1378.965) -- 0:01:54
399000 -- (-1382.352) [-1380.365] (-1381.278) (-1379.563) * (-1378.821) (-1378.745) [-1378.060] (-1381.341) -- 0:01:54
399500 -- [-1384.571] (-1379.762) (-1382.860) (-1378.130) * (-1380.013) [-1382.861] (-1377.823) (-1378.772) -- 0:01:54
400000 -- (-1386.443) (-1379.540) (-1381.031) [-1376.556] * (-1374.639) [-1383.651] (-1382.877) (-1376.594) -- 0:01:54
Average standard deviation of split frequencies: 0.001765
400500 -- (-1381.854) (-1376.639) [-1379.663] (-1375.234) * (-1375.606) [-1386.827] (-1387.928) (-1384.765) -- 0:01:53
401000 -- [-1383.300] (-1379.678) (-1377.394) (-1379.214) * [-1377.402] (-1388.737) (-1382.027) (-1388.624) -- 0:01:53
401500 -- (-1384.241) (-1380.354) (-1386.697) [-1376.284] * (-1376.454) (-1386.292) [-1380.373] (-1385.064) -- 0:01:53
402000 -- (-1386.036) (-1389.015) [-1380.111] (-1377.633) * [-1375.384] (-1378.615) (-1378.332) (-1380.596) -- 0:01:53
402500 -- (-1379.951) [-1382.494] (-1383.616) (-1382.636) * (-1377.571) (-1380.896) [-1380.345] (-1375.975) -- 0:01:54
403000 -- (-1379.200) (-1388.705) [-1382.505] (-1387.960) * (-1378.481) (-1380.541) (-1384.246) [-1383.130] -- 0:01:54
403500 -- (-1380.940) (-1385.338) (-1383.453) [-1381.142] * [-1378.942] (-1377.793) (-1380.696) (-1380.807) -- 0:01:53
404000 -- (-1380.610) (-1378.686) (-1380.926) [-1379.162] * (-1381.509) (-1388.742) (-1378.715) [-1377.868] -- 0:01:53
404500 -- (-1380.797) (-1381.226) (-1379.276) [-1376.142] * (-1386.663) [-1377.911] (-1379.315) (-1377.361) -- 0:01:53
405000 -- (-1375.573) (-1378.022) [-1376.678] (-1373.078) * (-1381.119) [-1375.001] (-1380.620) (-1378.251) -- 0:01:53
Average standard deviation of split frequencies: 0.001742
405500 -- (-1376.250) (-1382.656) (-1377.542) [-1382.239] * (-1373.790) (-1377.439) (-1380.219) [-1383.330] -- 0:01:52
406000 -- (-1381.840) (-1386.535) (-1376.152) [-1375.761] * (-1378.225) (-1376.226) [-1373.341] (-1386.561) -- 0:01:52
406500 -- (-1380.010) [-1382.165] (-1375.338) (-1377.004) * [-1376.775] (-1378.708) (-1379.981) (-1377.600) -- 0:01:52
407000 -- [-1377.797] (-1382.505) (-1377.516) (-1379.652) * [-1381.270] (-1385.961) (-1377.313) (-1377.496) -- 0:01:52
407500 -- (-1376.653) [-1385.761] (-1380.582) (-1380.874) * (-1381.106) [-1381.304] (-1378.978) (-1378.144) -- 0:01:51
408000 -- (-1381.598) [-1379.741] (-1381.169) (-1378.530) * (-1378.464) (-1376.562) [-1377.290] (-1376.131) -- 0:01:53
408500 -- (-1385.485) [-1378.985] (-1378.915) (-1376.664) * (-1378.978) [-1376.583] (-1387.502) (-1374.902) -- 0:01:52
409000 -- (-1380.561) [-1376.468] (-1378.486) (-1377.448) * (-1382.286) [-1378.943] (-1377.111) (-1376.624) -- 0:01:52
409500 -- (-1382.383) [-1376.499] (-1380.781) (-1375.815) * (-1381.723) (-1378.317) (-1381.136) [-1374.141] -- 0:01:52
410000 -- (-1373.897) [-1377.067] (-1382.060) (-1380.530) * (-1380.944) (-1377.954) (-1381.252) [-1376.503] -- 0:01:52
Average standard deviation of split frequencies: 0.001722
410500 -- [-1378.414] (-1379.215) (-1375.210) (-1379.294) * (-1388.477) (-1379.056) [-1378.839] (-1376.499) -- 0:01:52
411000 -- (-1375.031) (-1385.546) (-1378.584) [-1377.088] * (-1386.147) (-1377.902) (-1377.753) [-1377.219] -- 0:01:51
411500 -- (-1384.659) [-1381.516] (-1379.235) (-1379.001) * (-1386.241) (-1379.587) [-1374.343] (-1378.396) -- 0:01:51
412000 -- (-1385.967) (-1384.560) (-1381.067) [-1378.374] * (-1381.867) [-1381.007] (-1382.067) (-1379.558) -- 0:01:51
412500 -- [-1378.426] (-1382.861) (-1378.964) (-1387.684) * [-1383.793] (-1387.045) (-1380.239) (-1380.124) -- 0:01:51
413000 -- [-1377.608] (-1387.920) (-1378.145) (-1381.612) * (-1381.555) (-1380.937) [-1380.342] (-1377.106) -- 0:01:52
413500 -- (-1378.892) (-1377.080) (-1379.422) [-1381.379] * (-1386.287) [-1377.927] (-1383.059) (-1378.417) -- 0:01:52
414000 -- [-1380.848] (-1379.899) (-1380.408) (-1378.726) * (-1381.495) (-1377.278) (-1379.213) [-1375.543] -- 0:01:51
414500 -- [-1379.263] (-1380.711) (-1381.463) (-1383.514) * (-1384.642) (-1378.590) [-1377.534] (-1380.116) -- 0:01:51
415000 -- (-1374.620) [-1381.698] (-1382.031) (-1378.210) * (-1383.427) (-1378.663) (-1382.119) [-1374.251] -- 0:01:51
Average standard deviation of split frequencies: 0.001700
415500 -- (-1375.542) [-1378.247] (-1380.307) (-1378.447) * (-1378.931) (-1379.397) [-1376.419] (-1381.664) -- 0:01:51
416000 -- (-1378.195) (-1382.269) [-1380.088] (-1380.152) * (-1390.693) (-1379.807) [-1379.362] (-1385.964) -- 0:01:50
416500 -- (-1375.633) (-1377.512) (-1375.073) [-1375.598] * (-1391.740) [-1374.013] (-1380.099) (-1378.517) -- 0:01:50
417000 -- [-1377.383] (-1385.803) (-1379.468) (-1379.538) * (-1386.095) (-1374.905) [-1381.591] (-1381.908) -- 0:01:50
417500 -- (-1377.609) (-1381.573) (-1376.478) [-1379.467] * (-1381.838) (-1378.699) [-1378.346] (-1385.717) -- 0:01:50
418000 -- (-1381.602) (-1377.661) [-1377.676] (-1377.222) * (-1380.842) (-1379.611) (-1376.538) [-1381.423] -- 0:01:49
418500 -- (-1379.347) (-1382.240) (-1378.597) [-1379.422] * (-1376.570) (-1380.225) [-1381.619] (-1389.915) -- 0:01:51
419000 -- [-1375.050] (-1379.317) (-1378.345) (-1379.715) * (-1375.161) [-1381.480] (-1384.449) (-1379.006) -- 0:01:50
419500 -- [-1376.034] (-1383.054) (-1374.793) (-1382.656) * (-1389.602) (-1378.571) (-1377.670) [-1378.429] -- 0:01:50
420000 -- (-1375.465) [-1380.383] (-1376.361) (-1383.812) * (-1384.641) [-1374.832] (-1382.291) (-1374.416) -- 0:01:50
Average standard deviation of split frequencies: 0.001121
420500 -- (-1379.361) (-1382.800) (-1375.499) [-1378.349] * (-1381.187) (-1381.906) (-1381.083) [-1377.048] -- 0:01:50
421000 -- [-1376.033] (-1385.308) (-1373.924) (-1385.202) * (-1380.087) [-1376.730] (-1387.747) (-1378.504) -- 0:01:50
421500 -- (-1379.559) (-1384.082) (-1376.139) [-1379.511] * (-1375.181) (-1382.898) (-1378.554) [-1375.495] -- 0:01:49
422000 -- (-1379.976) (-1386.048) [-1376.922] (-1379.810) * (-1378.618) (-1381.513) (-1380.421) [-1379.972] -- 0:01:49
422500 -- [-1377.948] (-1382.357) (-1383.208) (-1376.458) * (-1381.983) (-1380.514) [-1376.651] (-1381.920) -- 0:01:49
423000 -- [-1379.874] (-1384.863) (-1378.559) (-1382.692) * (-1379.156) (-1390.215) [-1378.991] (-1380.907) -- 0:01:49
423500 -- (-1375.153) (-1378.283) [-1378.355] (-1382.462) * (-1383.515) (-1389.336) [-1377.606] (-1379.297) -- 0:01:50
424000 -- (-1376.716) (-1377.122) [-1375.143] (-1381.629) * (-1385.513) (-1378.700) [-1385.691] (-1381.436) -- 0:01:50
424500 -- (-1378.533) (-1375.251) [-1378.876] (-1377.610) * (-1390.207) (-1385.170) (-1384.924) [-1377.978] -- 0:01:49
425000 -- [-1378.014] (-1377.398) (-1379.756) (-1375.204) * (-1376.798) (-1384.263) (-1381.738) [-1381.220] -- 0:01:49
Average standard deviation of split frequencies: 0.001107
425500 -- [-1378.563] (-1378.731) (-1378.873) (-1374.694) * (-1376.488) (-1387.725) [-1380.059] (-1394.165) -- 0:01:49
426000 -- [-1386.364] (-1380.037) (-1377.795) (-1381.828) * (-1375.104) (-1385.159) (-1384.017) [-1380.673] -- 0:01:49
426500 -- (-1386.421) (-1387.517) (-1379.377) [-1380.982] * (-1381.072) [-1377.653] (-1379.410) (-1381.792) -- 0:01:48
427000 -- (-1381.681) (-1381.822) [-1377.342] (-1378.844) * [-1377.221] (-1382.538) (-1398.739) (-1374.804) -- 0:01:48
427500 -- (-1387.400) (-1380.000) [-1379.049] (-1376.774) * (-1389.950) [-1376.429] (-1389.380) (-1379.467) -- 0:01:48
428000 -- (-1383.360) (-1382.871) (-1378.417) [-1376.247] * (-1379.878) (-1377.317) (-1379.797) [-1379.640] -- 0:01:48
428500 -- (-1379.353) [-1378.107] (-1381.989) (-1381.102) * (-1380.620) (-1382.488) (-1378.684) [-1381.424] -- 0:01:49
429000 -- [-1381.011] (-1385.976) (-1375.831) (-1378.013) * (-1379.600) [-1381.947] (-1390.271) (-1382.389) -- 0:01:49
429500 -- (-1381.988) (-1377.764) [-1374.830] (-1376.077) * (-1385.825) (-1381.659) (-1381.932) [-1381.676] -- 0:01:48
430000 -- [-1377.078] (-1379.478) (-1380.522) (-1383.541) * (-1377.046) (-1382.610) (-1381.003) [-1382.678] -- 0:01:48
Average standard deviation of split frequencies: 0.001095
430500 -- (-1376.748) (-1379.712) (-1382.410) [-1374.438] * (-1376.238) (-1385.713) (-1379.048) [-1381.442] -- 0:01:48
431000 -- (-1385.112) (-1378.986) (-1379.389) [-1377.629] * (-1382.076) (-1383.032) (-1382.329) [-1382.410] -- 0:01:48
431500 -- (-1382.892) (-1375.896) (-1382.153) [-1377.777] * (-1375.573) (-1390.515) (-1377.689) [-1380.466] -- 0:01:48
432000 -- [-1380.572] (-1379.867) (-1385.324) (-1384.891) * (-1382.177) [-1377.343] (-1379.534) (-1388.143) -- 0:01:47
432500 -- (-1381.961) [-1381.354] (-1381.534) (-1385.466) * (-1390.980) (-1380.385) [-1377.775] (-1384.724) -- 0:01:47
433000 -- (-1378.901) [-1377.475] (-1382.708) (-1380.722) * (-1377.994) (-1376.266) (-1379.847) [-1377.608] -- 0:01:47
433500 -- (-1382.685) (-1384.221) [-1376.986] (-1383.031) * (-1376.132) [-1383.098] (-1377.218) (-1381.796) -- 0:01:47
434000 -- [-1377.833] (-1379.197) (-1380.676) (-1379.269) * (-1381.853) (-1381.947) [-1381.723] (-1383.377) -- 0:01:48
434500 -- [-1379.424] (-1378.898) (-1375.861) (-1377.983) * [-1378.792] (-1376.301) (-1385.288) (-1373.514) -- 0:01:48
435000 -- (-1378.698) [-1378.907] (-1377.398) (-1379.558) * (-1375.943) (-1377.672) [-1378.686] (-1376.030) -- 0:01:47
Average standard deviation of split frequencies: 0.001622
435500 -- (-1380.561) (-1386.485) (-1379.425) [-1376.861] * (-1375.208) [-1381.102] (-1379.989) (-1376.756) -- 0:01:47
436000 -- [-1389.787] (-1381.666) (-1378.776) (-1375.995) * (-1376.298) (-1376.821) (-1374.758) [-1379.827] -- 0:01:47
436500 -- (-1380.417) (-1383.924) [-1381.049] (-1373.880) * (-1379.591) [-1373.601] (-1379.980) (-1375.592) -- 0:01:47
437000 -- (-1381.489) [-1381.877] (-1381.622) (-1373.446) * (-1381.777) (-1377.986) [-1380.817] (-1380.069) -- 0:01:46
437500 -- (-1381.282) (-1385.644) (-1378.201) [-1377.925] * [-1383.424] (-1378.086) (-1379.071) (-1383.444) -- 0:01:46
438000 -- (-1377.532) (-1378.288) [-1378.524] (-1383.820) * (-1383.520) (-1376.705) [-1376.937] (-1385.669) -- 0:01:46
438500 -- [-1377.995] (-1384.511) (-1380.420) (-1380.770) * (-1379.960) (-1386.111) [-1379.659] (-1380.873) -- 0:01:46
439000 -- (-1384.911) (-1389.195) (-1380.702) [-1385.538] * (-1381.857) (-1386.034) [-1377.079] (-1380.214) -- 0:01:47
439500 -- (-1377.528) [-1377.289] (-1382.250) (-1387.646) * (-1382.727) [-1380.320] (-1378.924) (-1387.770) -- 0:01:47
440000 -- (-1381.847) (-1381.356) [-1374.326] (-1384.154) * (-1381.159) [-1379.595] (-1381.867) (-1377.387) -- 0:01:46
Average standard deviation of split frequencies: 0.001605
440500 -- (-1386.550) (-1381.793) (-1374.870) [-1377.137] * (-1383.056) [-1378.084] (-1380.281) (-1379.473) -- 0:01:46
441000 -- (-1384.343) (-1376.816) (-1376.563) [-1382.652] * (-1379.670) (-1376.110) (-1379.323) [-1379.121] -- 0:01:46
441500 -- (-1380.061) (-1378.453) [-1378.940] (-1376.352) * [-1378.467] (-1379.533) (-1377.901) (-1379.351) -- 0:01:46
442000 -- (-1384.935) (-1382.763) [-1377.579] (-1380.263) * (-1385.517) (-1378.406) [-1378.905] (-1378.504) -- 0:01:46
442500 -- (-1378.489) [-1384.411] (-1379.655) (-1383.580) * [-1379.117] (-1376.253) (-1381.342) (-1376.965) -- 0:01:45
443000 -- [-1377.709] (-1376.390) (-1376.496) (-1380.117) * (-1376.640) [-1381.863] (-1381.647) (-1379.335) -- 0:01:45
443500 -- (-1374.504) [-1380.957] (-1379.331) (-1380.635) * [-1377.299] (-1386.340) (-1380.410) (-1383.495) -- 0:01:45
444000 -- (-1375.978) (-1382.110) (-1379.094) [-1383.934] * [-1375.842] (-1385.860) (-1378.920) (-1388.544) -- 0:01:45
444500 -- (-1377.400) (-1379.734) (-1378.940) [-1381.671] * [-1376.370] (-1381.913) (-1386.064) (-1380.229) -- 0:01:46
445000 -- [-1378.523] (-1378.296) (-1379.502) (-1381.695) * [-1378.482] (-1388.896) (-1380.537) (-1382.560) -- 0:01:46
Average standard deviation of split frequencies: 0.001585
445500 -- (-1385.537) (-1375.601) [-1374.361] (-1379.914) * (-1378.508) (-1380.456) (-1378.892) [-1378.852] -- 0:01:45
446000 -- (-1380.624) [-1379.544] (-1375.480) (-1379.329) * (-1378.994) (-1383.382) (-1377.551) [-1383.707] -- 0:01:45
446500 -- [-1378.326] (-1377.382) (-1376.817) (-1373.980) * [-1375.102] (-1383.204) (-1375.008) (-1386.428) -- 0:01:45
447000 -- (-1382.350) [-1378.467] (-1380.075) (-1381.399) * (-1377.757) [-1376.953] (-1379.213) (-1389.570) -- 0:01:45
447500 -- [-1379.756] (-1382.370) (-1376.808) (-1375.259) * [-1383.493] (-1377.350) (-1379.295) (-1377.575) -- 0:01:44
448000 -- [-1376.692] (-1377.520) (-1383.933) (-1378.179) * (-1382.081) (-1378.299) (-1378.136) [-1376.587] -- 0:01:44
448500 -- (-1376.218) [-1380.382] (-1376.290) (-1376.824) * (-1383.105) (-1382.278) [-1380.732] (-1377.071) -- 0:01:44
449000 -- (-1380.737) [-1378.678] (-1378.286) (-1378.968) * [-1384.692] (-1382.203) (-1379.468) (-1377.105) -- 0:01:44
449500 -- [-1382.387] (-1378.603) (-1388.855) (-1378.489) * (-1382.789) (-1377.645) (-1377.803) [-1378.493] -- 0:01:45
450000 -- (-1382.361) (-1382.197) (-1375.500) [-1376.785] * (-1381.092) (-1382.381) (-1376.983) [-1373.985] -- 0:01:45
Average standard deviation of split frequencies: 0.001569
450500 -- (-1377.110) (-1379.538) [-1379.856] (-1376.222) * (-1378.191) (-1381.950) [-1377.902] (-1376.133) -- 0:01:44
451000 -- (-1377.556) (-1384.359) [-1380.221] (-1382.530) * (-1375.682) [-1379.606] (-1375.526) (-1375.964) -- 0:01:44
451500 -- (-1381.053) [-1384.427] (-1384.936) (-1384.375) * (-1379.567) (-1384.096) [-1375.727] (-1377.614) -- 0:01:44
452000 -- [-1378.150] (-1381.176) (-1381.591) (-1377.614) * (-1377.309) (-1383.140) [-1378.110] (-1376.349) -- 0:01:44
452500 -- (-1380.951) (-1379.272) (-1387.394) [-1382.201] * (-1377.880) (-1379.280) [-1378.258] (-1380.091) -- 0:01:44
453000 -- [-1381.663] (-1381.919) (-1380.489) (-1382.986) * (-1380.223) [-1375.813] (-1380.088) (-1383.511) -- 0:01:43
453500 -- (-1375.914) [-1376.588] (-1377.551) (-1379.269) * [-1379.660] (-1381.775) (-1384.654) (-1384.415) -- 0:01:43
454000 -- [-1379.364] (-1379.246) (-1381.405) (-1384.808) * [-1377.599] (-1377.472) (-1377.191) (-1380.058) -- 0:01:43
454500 -- (-1374.767) (-1390.107) (-1378.915) [-1381.160] * [-1377.688] (-1381.496) (-1378.260) (-1390.043) -- 0:01:43
455000 -- (-1380.525) (-1378.988) (-1379.904) [-1375.010] * (-1383.450) (-1378.871) (-1375.713) [-1384.854] -- 0:01:44
Average standard deviation of split frequencies: 0.001034
455500 -- [-1384.847] (-1384.564) (-1380.200) (-1373.986) * [-1382.499] (-1381.105) (-1380.047) (-1381.851) -- 0:01:43
456000 -- (-1379.661) [-1388.976] (-1377.681) (-1378.811) * [-1379.042] (-1382.613) (-1379.289) (-1376.407) -- 0:01:43
456500 -- [-1380.370] (-1386.927) (-1374.550) (-1375.312) * [-1378.820] (-1381.750) (-1382.518) (-1379.336) -- 0:01:43
457000 -- [-1377.720] (-1383.001) (-1382.047) (-1379.035) * (-1385.576) (-1385.406) [-1379.883] (-1377.016) -- 0:01:43
457500 -- (-1377.806) (-1381.726) [-1374.493] (-1382.983) * (-1381.800) (-1378.915) [-1375.232] (-1383.658) -- 0:01:43
458000 -- (-1378.400) (-1380.492) (-1379.838) [-1380.502] * (-1381.032) [-1375.273] (-1385.238) (-1379.924) -- 0:01:42
458500 -- (-1384.524) [-1376.731] (-1378.488) (-1381.674) * [-1378.084] (-1383.355) (-1379.415) (-1377.742) -- 0:01:42
459000 -- (-1377.589) [-1378.558] (-1378.743) (-1380.838) * (-1382.201) (-1380.861) [-1380.006] (-1380.736) -- 0:01:42
459500 -- (-1377.868) [-1381.079] (-1381.750) (-1384.841) * [-1374.383] (-1379.652) (-1382.006) (-1386.228) -- 0:01:42
460000 -- (-1377.843) (-1378.251) (-1383.972) [-1375.117] * (-1382.108) (-1380.503) [-1380.266] (-1382.432) -- 0:01:43
Average standard deviation of split frequencies: 0.001023
460500 -- (-1378.660) [-1378.289] (-1383.356) (-1381.636) * [-1382.845] (-1384.687) (-1382.231) (-1385.333) -- 0:01:43
461000 -- (-1379.001) [-1381.121] (-1383.972) (-1377.687) * (-1378.428) [-1377.237] (-1380.595) (-1385.523) -- 0:01:42
461500 -- [-1376.794] (-1379.994) (-1379.310) (-1382.006) * (-1378.322) (-1380.607) (-1381.092) [-1381.639] -- 0:01:42
462000 -- (-1378.573) (-1379.218) [-1376.492] (-1382.534) * (-1381.759) (-1379.423) (-1380.142) [-1382.638] -- 0:01:42
462500 -- (-1382.228) (-1380.632) (-1378.494) [-1375.818] * (-1380.746) (-1377.781) [-1378.950] (-1375.432) -- 0:01:42
463000 -- (-1378.726) (-1374.204) [-1376.708] (-1378.487) * (-1382.164) [-1383.235] (-1377.268) (-1382.534) -- 0:01:42
463500 -- (-1380.508) (-1380.178) (-1383.265) [-1375.077] * (-1376.518) (-1377.695) (-1377.417) [-1377.610] -- 0:01:41
464000 -- (-1378.429) (-1382.057) [-1380.993] (-1375.826) * (-1390.289) (-1378.218) (-1381.962) [-1377.788] -- 0:01:41
464500 -- [-1377.932] (-1385.940) (-1381.260) (-1375.571) * [-1378.551] (-1383.083) (-1384.305) (-1379.448) -- 0:01:41
465000 -- (-1384.770) (-1377.722) [-1378.163] (-1380.656) * (-1378.450) (-1378.951) [-1380.113] (-1381.953) -- 0:01:41
Average standard deviation of split frequencies: 0.001012
465500 -- (-1381.443) (-1381.509) [-1379.518] (-1381.430) * (-1380.385) (-1375.878) (-1376.677) [-1381.258] -- 0:01:42
466000 -- (-1380.674) [-1378.457] (-1379.022) (-1379.020) * (-1385.598) [-1376.871] (-1377.996) (-1377.250) -- 0:01:41
466500 -- (-1382.180) (-1385.084) (-1373.998) [-1376.037] * (-1387.086) (-1377.162) (-1384.164) [-1377.309] -- 0:01:41
467000 -- (-1376.699) (-1379.173) (-1383.870) [-1376.323] * (-1382.249) [-1376.831] (-1374.136) (-1378.504) -- 0:01:41
467500 -- (-1374.734) [-1381.269] (-1380.610) (-1380.439) * (-1391.678) (-1376.360) (-1378.866) [-1376.917] -- 0:01:41
468000 -- (-1379.392) (-1376.022) [-1379.893] (-1376.386) * [-1376.804] (-1379.879) (-1375.285) (-1377.163) -- 0:01:41
468500 -- (-1379.025) (-1377.644) [-1382.673] (-1378.438) * (-1380.573) (-1382.623) [-1376.068] (-1379.964) -- 0:01:40
469000 -- (-1385.621) (-1378.499) (-1377.700) [-1383.958] * (-1379.991) (-1382.288) (-1381.295) [-1380.132] -- 0:01:40
469500 -- [-1380.644] (-1379.548) (-1378.124) (-1379.895) * (-1379.907) (-1378.313) (-1377.098) [-1377.657] -- 0:01:40
470000 -- (-1381.123) (-1379.678) (-1376.769) [-1376.534] * (-1379.762) [-1375.050] (-1384.106) (-1378.246) -- 0:01:40
Average standard deviation of split frequencies: 0.001002
470500 -- (-1381.159) (-1381.270) [-1377.118] (-1376.179) * (-1385.123) (-1376.277) (-1379.156) [-1382.785] -- 0:01:41
471000 -- (-1378.964) (-1377.609) [-1378.688] (-1385.268) * (-1379.092) [-1376.867] (-1383.186) (-1380.525) -- 0:01:41
471500 -- (-1377.599) (-1381.356) [-1377.800] (-1380.181) * (-1381.277) [-1378.193] (-1389.732) (-1380.933) -- 0:01:40
472000 -- (-1377.845) [-1377.879] (-1374.827) (-1380.612) * (-1383.736) [-1374.819] (-1383.598) (-1384.232) -- 0:01:40
472500 -- (-1381.009) [-1379.167] (-1380.150) (-1382.113) * (-1379.162) (-1376.808) [-1382.201] (-1377.609) -- 0:01:40
473000 -- (-1377.934) [-1373.590] (-1381.690) (-1379.492) * [-1377.018] (-1375.697) (-1377.224) (-1378.136) -- 0:01:40
473500 -- (-1376.369) [-1376.241] (-1378.353) (-1386.023) * [-1379.448] (-1377.163) (-1380.989) (-1376.142) -- 0:01:40
474000 -- (-1382.815) (-1379.107) [-1376.238] (-1384.859) * [-1375.164] (-1381.491) (-1378.871) (-1382.355) -- 0:01:39
474500 -- [-1378.078] (-1385.602) (-1373.756) (-1376.344) * (-1378.570) (-1386.404) [-1374.542] (-1374.377) -- 0:01:39
475000 -- [-1378.322] (-1388.437) (-1379.202) (-1378.484) * (-1379.950) (-1388.355) (-1379.725) [-1374.613] -- 0:01:39
Average standard deviation of split frequencies: 0.000990
475500 -- (-1379.738) (-1382.950) [-1383.148] (-1382.292) * (-1378.721) (-1387.239) (-1377.762) [-1376.210] -- 0:01:40
476000 -- (-1378.351) (-1385.191) [-1381.781] (-1379.891) * [-1377.425] (-1382.376) (-1381.925) (-1376.448) -- 0:01:40
476500 -- (-1379.919) (-1380.425) [-1378.220] (-1383.723) * [-1375.532] (-1378.134) (-1381.922) (-1381.290) -- 0:01:39
477000 -- [-1380.997] (-1382.469) (-1376.057) (-1376.552) * (-1380.417) (-1380.961) (-1386.875) [-1378.869] -- 0:01:39
477500 -- (-1384.429) (-1385.144) (-1385.224) [-1375.919] * (-1377.321) [-1378.394] (-1387.857) (-1378.985) -- 0:01:39
478000 -- (-1383.315) (-1386.518) (-1380.910) [-1378.542] * (-1374.876) (-1379.028) [-1382.215] (-1381.532) -- 0:01:39
478500 -- (-1384.207) (-1380.667) (-1384.167) [-1377.360] * (-1378.024) (-1380.633) (-1387.309) [-1376.608] -- 0:01:39
479000 -- [-1382.563] (-1382.330) (-1376.974) (-1385.054) * (-1379.236) [-1377.931] (-1380.664) (-1381.926) -- 0:01:38
479500 -- (-1375.855) (-1386.239) (-1383.782) [-1377.509] * (-1382.150) (-1379.992) (-1379.867) [-1376.581] -- 0:01:38
480000 -- (-1380.413) (-1388.932) [-1382.279] (-1379.957) * (-1379.959) (-1382.722) (-1381.307) [-1377.387] -- 0:01:38
Average standard deviation of split frequencies: 0.000981
480500 -- (-1379.579) (-1380.320) (-1383.064) [-1377.594] * (-1381.047) (-1378.012) (-1380.272) [-1374.312] -- 0:01:38
481000 -- [-1377.305] (-1377.989) (-1386.548) (-1378.502) * (-1377.091) (-1385.095) [-1383.961] (-1378.925) -- 0:01:39
481500 -- [-1382.215] (-1384.306) (-1384.891) (-1377.590) * [-1379.106] (-1384.703) (-1389.759) (-1378.833) -- 0:01:39
482000 -- [-1384.826] (-1383.218) (-1384.629) (-1380.443) * (-1381.542) [-1380.846] (-1378.073) (-1382.592) -- 0:01:38
482500 -- (-1374.950) (-1379.099) (-1384.608) [-1380.795] * (-1381.665) (-1377.564) (-1375.342) [-1380.957] -- 0:01:38
483000 -- [-1378.022] (-1384.150) (-1390.521) (-1380.725) * (-1374.618) (-1377.922) [-1379.615] (-1380.546) -- 0:01:38
483500 -- (-1383.048) (-1385.480) [-1380.772] (-1380.917) * [-1374.052] (-1374.677) (-1379.985) (-1377.985) -- 0:01:38
484000 -- (-1381.942) [-1382.731] (-1377.362) (-1378.422) * (-1380.196) (-1375.933) (-1380.177) [-1389.340] -- 0:01:38
484500 -- (-1381.550) (-1384.779) [-1376.091] (-1380.402) * [-1376.383] (-1377.352) (-1377.595) (-1381.625) -- 0:01:37
485000 -- (-1377.923) (-1380.162) (-1380.290) [-1384.576] * (-1380.419) [-1372.793] (-1379.062) (-1380.593) -- 0:01:37
Average standard deviation of split frequencies: 0.000970
485500 -- (-1379.386) (-1385.777) [-1380.401] (-1380.956) * (-1380.482) (-1379.571) (-1378.227) [-1379.247] -- 0:01:37
486000 -- (-1375.258) (-1380.080) (-1379.829) [-1378.906] * [-1383.171] (-1377.589) (-1380.533) (-1382.962) -- 0:01:38
486500 -- [-1376.832] (-1383.090) (-1380.160) (-1384.736) * (-1382.380) (-1380.679) [-1377.808] (-1383.054) -- 0:01:38
487000 -- (-1377.596) (-1384.932) [-1374.340] (-1382.464) * (-1388.321) (-1380.681) [-1376.334] (-1379.307) -- 0:01:37
487500 -- (-1376.323) [-1377.948] (-1375.951) (-1375.650) * (-1380.565) (-1378.457) [-1379.640] (-1380.206) -- 0:01:37
488000 -- (-1380.956) (-1378.087) [-1377.572] (-1380.731) * (-1379.094) (-1384.936) [-1386.680] (-1376.525) -- 0:01:37
488500 -- (-1381.455) [-1381.543] (-1376.591) (-1378.161) * (-1380.911) (-1387.914) [-1378.701] (-1382.613) -- 0:01:37
489000 -- (-1383.056) (-1378.367) (-1378.456) [-1380.363] * (-1380.190) (-1385.063) (-1379.186) [-1373.569] -- 0:01:37
489500 -- (-1383.501) (-1395.980) (-1376.528) [-1375.495] * (-1380.706) (-1380.567) [-1379.450] (-1379.496) -- 0:01:36
490000 -- (-1375.142) (-1386.630) [-1377.549] (-1375.121) * [-1377.352] (-1385.098) (-1383.916) (-1379.112) -- 0:01:36
Average standard deviation of split frequencies: 0.000961
490500 -- (-1377.012) (-1388.648) [-1377.814] (-1384.314) * [-1382.120] (-1386.896) (-1384.390) (-1380.883) -- 0:01:36
491000 -- [-1377.889] (-1390.273) (-1376.101) (-1385.125) * (-1381.053) (-1377.553) [-1375.021] (-1385.161) -- 0:01:36
491500 -- (-1379.033) (-1399.015) [-1377.703] (-1382.010) * (-1376.500) [-1381.990] (-1380.359) (-1380.635) -- 0:01:37
492000 -- (-1383.628) (-1374.274) (-1377.365) [-1378.455] * (-1379.131) (-1377.279) [-1380.559] (-1383.789) -- 0:01:37
492500 -- [-1380.161] (-1383.521) (-1383.398) (-1384.313) * (-1380.644) [-1377.942] (-1380.224) (-1380.693) -- 0:01:36
493000 -- (-1378.996) (-1379.100) (-1384.942) [-1375.006] * (-1378.998) (-1383.401) [-1377.136] (-1382.048) -- 0:01:36
493500 -- (-1377.204) [-1376.646] (-1380.312) (-1377.045) * (-1382.896) (-1380.585) [-1380.632] (-1382.172) -- 0:01:36
494000 -- [-1376.196] (-1380.659) (-1378.126) (-1382.717) * (-1387.707) [-1377.977] (-1380.462) (-1381.921) -- 0:01:36
494500 -- (-1378.736) [-1382.249] (-1378.973) (-1377.484) * (-1375.554) (-1376.856) (-1374.973) [-1378.626] -- 0:01:36
495000 -- (-1379.096) [-1377.450] (-1380.504) (-1377.155) * (-1376.720) (-1381.222) [-1375.591] (-1378.613) -- 0:01:35
Average standard deviation of split frequencies: 0.000475
495500 -- [-1376.717] (-1380.703) (-1378.215) (-1381.213) * (-1377.732) (-1380.951) (-1383.128) [-1377.807] -- 0:01:35
496000 -- [-1376.663] (-1383.831) (-1382.683) (-1379.440) * (-1382.397) (-1377.693) (-1392.009) [-1378.080] -- 0:01:35
496500 -- (-1377.821) (-1384.623) (-1378.908) [-1378.901] * (-1378.289) (-1385.951) (-1382.528) [-1381.829] -- 0:01:36
497000 -- (-1377.027) (-1381.139) (-1383.330) [-1378.259] * (-1384.180) (-1383.494) [-1373.653] (-1375.008) -- 0:01:36
497500 -- (-1376.984) (-1379.157) (-1380.641) [-1377.493] * (-1380.510) [-1376.273] (-1385.894) (-1377.547) -- 0:01:35
498000 -- (-1382.547) (-1380.294) [-1377.470] (-1377.921) * [-1379.111] (-1380.882) (-1384.272) (-1376.476) -- 0:01:35
498500 -- (-1378.309) [-1379.487] (-1384.592) (-1379.462) * (-1377.929) (-1378.960) (-1381.540) [-1376.864] -- 0:01:35
499000 -- (-1378.013) (-1376.727) [-1378.888] (-1378.379) * (-1373.986) (-1377.920) (-1381.877) [-1374.473] -- 0:01:35
499500 -- (-1383.124) (-1389.185) (-1381.220) [-1379.348] * (-1377.157) [-1379.372] (-1376.738) (-1374.399) -- 0:01:35
500000 -- [-1380.122] (-1381.089) (-1377.411) (-1386.293) * (-1377.767) [-1377.076] (-1377.495) (-1375.486) -- 0:01:35
Average standard deviation of split frequencies: 0.000942
500500 -- (-1378.382) (-1384.086) [-1374.223] (-1387.655) * (-1379.363) (-1375.276) [-1379.798] (-1376.748) -- 0:01:34
501000 -- [-1375.278] (-1379.337) (-1377.355) (-1385.948) * (-1378.833) [-1373.733] (-1384.824) (-1376.696) -- 0:01:34
501500 -- (-1378.277) (-1382.301) [-1377.536] (-1379.280) * (-1382.493) [-1376.535] (-1379.616) (-1379.043) -- 0:01:34
502000 -- (-1377.462) [-1377.823] (-1375.673) (-1381.002) * (-1377.491) [-1375.028] (-1379.690) (-1374.324) -- 0:01:35
502500 -- [-1379.727] (-1381.222) (-1381.231) (-1384.148) * (-1386.615) (-1380.810) (-1379.860) [-1377.591] -- 0:01:35
503000 -- [-1378.128] (-1379.710) (-1379.459) (-1384.797) * (-1380.502) [-1379.631] (-1377.847) (-1377.428) -- 0:01:34
503500 -- (-1379.052) [-1382.186] (-1374.554) (-1380.077) * (-1381.520) (-1375.760) (-1378.656) [-1376.794] -- 0:01:34
504000 -- [-1378.146] (-1384.871) (-1375.452) (-1385.471) * (-1380.049) (-1375.604) [-1377.352] (-1381.747) -- 0:01:34
504500 -- (-1384.138) [-1378.012] (-1377.261) (-1384.213) * [-1376.375] (-1378.451) (-1379.040) (-1377.295) -- 0:01:34
505000 -- (-1385.917) (-1375.136) [-1378.099] (-1376.356) * (-1378.211) (-1377.047) (-1379.513) [-1379.566] -- 0:01:34
Average standard deviation of split frequencies: 0.000932
505500 -- (-1379.582) (-1383.021) (-1378.994) [-1383.661] * (-1373.670) (-1379.354) [-1377.126] (-1375.967) -- 0:01:33
506000 -- (-1380.110) [-1384.968] (-1375.350) (-1376.405) * (-1374.830) [-1376.846] (-1380.736) (-1375.791) -- 0:01:33
506500 -- (-1380.953) [-1382.781] (-1388.538) (-1380.917) * (-1382.568) [-1374.815] (-1381.294) (-1383.143) -- 0:01:33
507000 -- (-1382.424) (-1383.310) (-1383.942) [-1377.542] * (-1379.876) (-1377.692) [-1379.758] (-1378.224) -- 0:01:34
507500 -- (-1382.062) (-1377.849) (-1381.393) [-1378.043] * (-1379.549) [-1380.061] (-1381.062) (-1377.096) -- 0:01:34
508000 -- (-1387.722) (-1376.512) (-1380.424) [-1378.010] * (-1380.654) (-1380.780) [-1380.798] (-1378.071) -- 0:01:33
508500 -- [-1381.195] (-1376.212) (-1380.823) (-1376.882) * (-1386.162) (-1377.476) (-1379.800) [-1380.840] -- 0:01:33
509000 -- (-1376.891) [-1382.589] (-1381.647) (-1379.723) * (-1387.637) (-1383.575) [-1374.434] (-1380.065) -- 0:01:33
509500 -- (-1380.219) (-1383.012) (-1378.284) [-1374.542] * (-1382.042) (-1385.221) [-1378.930] (-1380.597) -- 0:01:33
510000 -- (-1379.594) [-1378.560] (-1377.637) (-1383.832) * (-1377.134) [-1382.060] (-1380.838) (-1376.346) -- 0:01:33
Average standard deviation of split frequencies: 0.001385
510500 -- (-1377.660) (-1386.325) (-1381.093) [-1378.558] * (-1379.905) (-1379.952) (-1380.685) [-1382.871] -- 0:01:33
511000 -- (-1384.150) [-1376.818] (-1377.411) (-1383.041) * [-1379.386] (-1374.567) (-1385.868) (-1381.445) -- 0:01:32
511500 -- [-1381.074] (-1380.605) (-1383.509) (-1382.767) * (-1386.700) (-1378.905) [-1383.091] (-1384.501) -- 0:01:32
512000 -- (-1381.210) (-1381.906) (-1375.161) [-1374.268] * (-1377.665) (-1380.160) (-1385.579) [-1383.267] -- 0:01:32
512500 -- (-1379.326) (-1379.020) (-1378.766) [-1379.750] * (-1376.162) [-1381.927] (-1385.983) (-1377.956) -- 0:01:33
513000 -- (-1379.481) (-1383.240) (-1381.767) [-1376.175] * (-1379.591) (-1383.275) [-1378.845] (-1385.675) -- 0:01:33
513500 -- (-1377.844) (-1380.473) [-1381.936] (-1375.754) * (-1381.403) (-1384.778) [-1377.576] (-1378.833) -- 0:01:32
514000 -- (-1377.820) (-1385.930) (-1382.674) [-1372.737] * (-1379.355) (-1379.674) (-1385.445) [-1379.517] -- 0:01:32
514500 -- [-1382.915] (-1381.597) (-1379.908) (-1379.301) * (-1379.968) (-1380.294) (-1375.907) [-1381.418] -- 0:01:32
515000 -- (-1375.967) (-1381.655) [-1382.954] (-1382.065) * (-1382.242) (-1381.478) (-1378.776) [-1377.696] -- 0:01:32
Average standard deviation of split frequencies: 0.001370
515500 -- (-1380.578) (-1387.982) (-1377.783) [-1377.570] * (-1383.384) [-1376.235] (-1378.040) (-1379.935) -- 0:01:32
516000 -- (-1381.098) (-1387.244) (-1377.953) [-1379.745] * (-1380.005) [-1376.839] (-1378.068) (-1383.256) -- 0:01:31
516500 -- (-1380.033) (-1388.195) [-1379.957] (-1378.304) * (-1381.160) (-1380.601) (-1379.359) [-1379.160] -- 0:01:31
517000 -- (-1378.506) (-1386.427) (-1381.118) [-1379.986] * (-1381.881) (-1387.298) [-1376.068] (-1381.281) -- 0:01:31
517500 -- [-1380.189] (-1386.587) (-1378.956) (-1375.341) * (-1379.566) (-1384.972) [-1377.420] (-1388.293) -- 0:01:32
518000 -- [-1382.611] (-1384.865) (-1375.720) (-1377.416) * (-1378.610) [-1373.462] (-1380.718) (-1380.020) -- 0:01:32
518500 -- (-1388.445) (-1375.214) [-1377.332] (-1373.896) * (-1377.246) (-1380.308) (-1381.393) [-1380.347] -- 0:01:31
519000 -- (-1376.474) (-1387.206) (-1382.794) [-1377.601] * (-1377.593) (-1387.099) (-1377.051) [-1379.324] -- 0:01:31
519500 -- [-1375.884] (-1380.279) (-1378.714) (-1383.093) * (-1380.508) [-1382.034] (-1381.105) (-1379.686) -- 0:01:31
520000 -- [-1376.496] (-1381.799) (-1377.795) (-1384.792) * (-1379.608) (-1386.255) [-1377.187] (-1375.920) -- 0:01:31
Average standard deviation of split frequencies: 0.001811
520500 -- (-1383.389) [-1377.645] (-1388.623) (-1383.266) * (-1378.807) [-1379.218] (-1386.575) (-1380.291) -- 0:01:31
521000 -- (-1377.799) (-1380.608) [-1382.538] (-1383.079) * (-1380.204) (-1380.872) [-1380.571] (-1383.351) -- 0:01:31
521500 -- [-1377.922] (-1379.032) (-1382.108) (-1384.574) * [-1381.025] (-1387.397) (-1387.626) (-1387.451) -- 0:01:30
522000 -- [-1374.878] (-1381.223) (-1385.134) (-1383.564) * (-1376.849) (-1381.993) (-1385.216) [-1378.745] -- 0:01:30
522500 -- (-1377.204) (-1376.087) (-1383.002) [-1383.282] * (-1384.153) (-1381.733) [-1384.356] (-1380.606) -- 0:01:30
523000 -- (-1376.582) (-1377.928) (-1381.313) [-1379.420] * (-1388.271) [-1374.908] (-1385.131) (-1375.366) -- 0:01:31
523500 -- (-1379.683) (-1377.425) [-1383.351] (-1378.996) * (-1377.649) [-1382.714] (-1383.589) (-1380.327) -- 0:01:31
524000 -- (-1383.359) (-1381.215) (-1379.473) [-1376.726] * (-1380.278) (-1380.257) (-1383.747) [-1378.548] -- 0:01:30
524500 -- (-1379.175) (-1385.937) (-1383.235) [-1376.483] * (-1378.562) (-1384.592) [-1379.578] (-1383.054) -- 0:01:30
525000 -- (-1379.691) (-1382.957) [-1378.185] (-1378.190) * (-1383.885) (-1379.161) [-1381.761] (-1383.788) -- 0:01:30
Average standard deviation of split frequencies: 0.001792
525500 -- (-1382.053) [-1382.667] (-1382.919) (-1376.180) * (-1380.756) (-1388.940) (-1378.678) [-1380.800] -- 0:01:30
526000 -- (-1382.361) (-1379.536) (-1384.810) [-1376.878] * [-1379.970] (-1385.435) (-1375.456) (-1376.529) -- 0:01:30
526500 -- (-1383.890) (-1379.058) (-1381.174) [-1378.007] * (-1380.891) [-1386.542] (-1379.348) (-1379.984) -- 0:01:29
527000 -- (-1380.978) [-1376.811] (-1383.315) (-1378.817) * (-1381.030) [-1383.502] (-1378.577) (-1382.683) -- 0:01:29
527500 -- (-1379.298) (-1380.856) (-1381.068) [-1375.282] * (-1382.108) (-1378.806) (-1380.093) [-1378.990] -- 0:01:29
528000 -- (-1381.258) (-1385.727) (-1392.524) [-1377.321] * (-1376.339) (-1381.539) (-1382.490) [-1380.927] -- 0:01:30
528500 -- (-1381.809) (-1378.969) (-1381.739) [-1379.627] * (-1378.233) (-1380.233) (-1375.888) [-1377.621] -- 0:01:30
529000 -- (-1380.342) (-1382.142) (-1378.500) [-1376.828] * [-1377.864] (-1390.057) (-1383.547) (-1375.991) -- 0:01:29
529500 -- (-1378.391) (-1378.775) [-1380.235] (-1384.308) * (-1389.198) (-1395.213) [-1375.806] (-1379.814) -- 0:01:29
530000 -- [-1381.972] (-1384.522) (-1378.847) (-1387.768) * (-1380.699) (-1391.210) [-1380.632] (-1382.231) -- 0:01:29
Average standard deviation of split frequencies: 0.001777
530500 -- [-1375.162] (-1383.063) (-1381.741) (-1383.031) * (-1382.459) (-1380.566) [-1389.538] (-1380.314) -- 0:01:29
531000 -- [-1373.987] (-1378.161) (-1380.360) (-1381.393) * (-1387.472) [-1378.041] (-1379.334) (-1379.810) -- 0:01:29
531500 -- [-1375.792] (-1378.923) (-1383.662) (-1381.589) * [-1374.844] (-1374.820) (-1385.387) (-1382.483) -- 0:01:29
532000 -- (-1377.203) [-1380.786] (-1380.312) (-1375.415) * (-1375.714) (-1379.513) (-1378.123) [-1377.877] -- 0:01:28
532500 -- [-1380.555] (-1381.317) (-1376.903) (-1380.181) * (-1374.075) [-1379.225] (-1377.859) (-1377.791) -- 0:01:28
533000 -- (-1385.370) [-1376.950] (-1375.999) (-1373.058) * (-1376.166) (-1374.021) (-1382.802) [-1375.844] -- 0:01:29
533500 -- (-1384.853) (-1376.776) (-1374.176) [-1373.909] * [-1375.927] (-1379.541) (-1383.519) (-1380.812) -- 0:01:29
534000 -- (-1384.699) (-1373.805) (-1378.165) [-1381.972] * (-1385.027) (-1377.926) (-1380.465) [-1381.135] -- 0:01:29
534500 -- (-1382.670) (-1378.840) (-1377.384) [-1378.949] * (-1381.048) (-1384.260) (-1383.614) [-1380.967] -- 0:01:28
535000 -- [-1377.674] (-1381.439) (-1380.534) (-1381.023) * (-1379.870) (-1383.139) [-1382.516] (-1375.287) -- 0:01:28
Average standard deviation of split frequencies: 0.001759
535500 -- (-1376.725) [-1376.778] (-1379.398) (-1376.087) * [-1375.485] (-1386.340) (-1382.786) (-1380.779) -- 0:01:28
536000 -- (-1380.070) (-1382.518) [-1378.506] (-1372.794) * [-1378.200] (-1384.309) (-1379.467) (-1376.763) -- 0:01:28
536500 -- (-1379.772) (-1383.500) (-1385.001) [-1379.552] * (-1377.950) (-1378.466) [-1377.998] (-1380.089) -- 0:01:28
537000 -- (-1376.558) [-1385.058] (-1377.361) (-1382.510) * (-1388.671) (-1383.129) [-1381.762] (-1381.768) -- 0:01:27
537500 -- (-1377.326) (-1385.162) (-1390.639) [-1385.620] * (-1382.627) (-1381.107) (-1380.170) [-1381.224] -- 0:01:27
538000 -- [-1376.688] (-1380.637) (-1382.100) (-1378.191) * (-1378.484) (-1380.778) [-1381.074] (-1380.699) -- 0:01:27
538500 -- (-1380.663) (-1380.213) (-1381.459) [-1379.191] * (-1375.147) [-1377.810] (-1377.425) (-1376.319) -- 0:01:28
539000 -- (-1376.356) (-1379.204) (-1375.669) [-1381.755] * [-1377.502] (-1379.059) (-1380.888) (-1376.790) -- 0:01:28
539500 -- (-1379.018) (-1376.796) [-1375.237] (-1378.948) * [-1373.972] (-1378.335) (-1377.607) (-1379.401) -- 0:01:27
540000 -- [-1379.956] (-1378.827) (-1379.644) (-1384.099) * (-1379.626) (-1378.431) [-1378.139] (-1380.006) -- 0:01:27
Average standard deviation of split frequencies: 0.001308
540500 -- (-1381.653) [-1376.549] (-1376.478) (-1381.374) * (-1382.464) (-1386.126) (-1379.253) [-1378.910] -- 0:01:27
541000 -- (-1377.476) (-1379.123) (-1378.288) [-1375.760] * (-1383.558) (-1378.258) [-1376.619] (-1380.116) -- 0:01:27
541500 -- [-1377.541] (-1384.665) (-1392.507) (-1374.120) * (-1380.465) [-1378.613] (-1373.159) (-1382.603) -- 0:01:27
542000 -- (-1377.918) (-1381.022) (-1383.963) [-1379.912] * (-1385.000) [-1382.468] (-1377.325) (-1377.636) -- 0:01:27
542500 -- (-1377.049) (-1376.103) (-1380.018) [-1383.577] * (-1380.504) (-1376.703) (-1384.697) [-1379.574] -- 0:01:26
543000 -- (-1379.811) (-1379.146) [-1378.960] (-1395.645) * (-1382.821) (-1376.910) [-1378.952] (-1376.681) -- 0:01:26
543500 -- (-1383.058) [-1375.784] (-1376.978) (-1380.001) * (-1378.913) [-1377.032] (-1378.641) (-1377.987) -- 0:01:27
544000 -- (-1382.694) (-1378.590) [-1379.361] (-1380.594) * (-1379.483) [-1379.145] (-1377.110) (-1382.557) -- 0:01:27
544500 -- [-1374.883] (-1383.077) (-1381.642) (-1381.574) * (-1380.342) (-1376.982) [-1382.266] (-1379.606) -- 0:01:27
545000 -- (-1380.846) [-1379.029] (-1378.559) (-1381.486) * (-1379.424) (-1378.402) [-1375.172] (-1383.407) -- 0:01:26
Average standard deviation of split frequencies: 0.001295
545500 -- (-1379.027) (-1384.244) [-1383.491] (-1380.811) * (-1386.586) (-1377.548) [-1376.138] (-1380.493) -- 0:01:26
546000 -- [-1378.620] (-1381.507) (-1379.175) (-1380.702) * (-1380.035) [-1381.590] (-1375.398) (-1377.774) -- 0:01:26
546500 -- [-1376.192] (-1378.069) (-1381.848) (-1385.692) * (-1389.025) (-1384.804) (-1378.421) [-1376.263] -- 0:01:26
547000 -- (-1382.698) [-1379.129] (-1377.827) (-1380.417) * (-1378.781) [-1378.898] (-1383.239) (-1386.338) -- 0:01:26
547500 -- (-1383.195) (-1386.345) (-1379.941) [-1377.737] * (-1392.272) (-1380.951) (-1378.799) [-1381.012] -- 0:01:25
548000 -- (-1385.705) (-1381.627) [-1376.400] (-1374.053) * (-1381.264) (-1382.720) [-1377.054] (-1382.493) -- 0:01:25
548500 -- (-1379.647) (-1378.726) (-1378.296) [-1377.369] * [-1378.381] (-1381.915) (-1377.633) (-1379.838) -- 0:01:25
549000 -- (-1378.581) (-1380.106) (-1374.386) [-1376.852] * (-1380.395) (-1385.685) (-1385.538) [-1379.142] -- 0:01:26
549500 -- [-1381.454] (-1382.429) (-1375.971) (-1378.442) * [-1378.458] (-1382.574) (-1379.154) (-1375.960) -- 0:01:26
550000 -- [-1386.558] (-1379.895) (-1380.577) (-1380.734) * [-1385.153] (-1377.596) (-1382.545) (-1377.288) -- 0:01:25
Average standard deviation of split frequencies: 0.001284
550500 -- (-1379.426) (-1378.574) (-1384.874) [-1380.043] * (-1379.581) [-1382.457] (-1383.545) (-1376.032) -- 0:01:25
551000 -- (-1380.553) (-1383.088) [-1379.022] (-1378.185) * [-1379.901] (-1375.219) (-1377.196) (-1377.103) -- 0:01:25
551500 -- (-1379.391) [-1375.605] (-1383.014) (-1378.531) * (-1379.036) (-1378.349) (-1376.818) [-1377.077] -- 0:01:25
552000 -- [-1380.749] (-1383.514) (-1377.680) (-1384.136) * (-1377.922) (-1376.966) (-1378.804) [-1375.044] -- 0:01:25
552500 -- (-1380.463) (-1382.169) (-1384.285) [-1375.768] * (-1381.672) (-1380.369) (-1381.750) [-1377.012] -- 0:01:25
553000 -- [-1375.055] (-1380.745) (-1376.445) (-1379.000) * (-1377.780) [-1379.073] (-1379.416) (-1378.045) -- 0:01:24
553500 -- (-1376.253) (-1383.569) [-1378.286] (-1376.482) * [-1380.166] (-1376.130) (-1376.673) (-1373.655) -- 0:01:24
554000 -- (-1378.207) (-1381.069) (-1384.462) [-1379.371] * (-1381.165) (-1376.838) (-1383.395) [-1374.103] -- 0:01:25
554500 -- [-1379.339] (-1377.633) (-1378.513) (-1388.133) * (-1381.126) [-1380.113] (-1389.580) (-1379.426) -- 0:01:25
555000 -- (-1373.708) [-1379.069] (-1374.228) (-1381.274) * (-1379.054) [-1376.192] (-1380.301) (-1378.954) -- 0:01:24
Average standard deviation of split frequencies: 0.001272
555500 -- (-1379.848) [-1376.139] (-1379.526) (-1377.659) * (-1375.496) (-1380.124) (-1376.370) [-1385.609] -- 0:01:24
556000 -- [-1383.346] (-1382.933) (-1379.761) (-1380.613) * (-1376.103) (-1377.085) [-1375.547] (-1381.509) -- 0:01:24
556500 -- [-1377.220] (-1382.189) (-1391.358) (-1380.853) * (-1376.726) (-1375.661) (-1378.788) [-1375.591] -- 0:01:24
557000 -- (-1378.926) (-1376.273) [-1377.348] (-1385.583) * (-1386.834) (-1384.239) [-1374.808] (-1380.817) -- 0:01:24
557500 -- (-1376.442) (-1381.114) [-1380.034] (-1382.289) * (-1382.650) (-1377.915) (-1377.399) [-1380.096] -- 0:01:24
558000 -- (-1374.737) (-1375.971) [-1382.678] (-1380.420) * (-1385.688) [-1374.453] (-1378.391) (-1376.544) -- 0:01:23
558500 -- [-1375.515] (-1380.260) (-1378.996) (-1378.096) * (-1385.493) [-1377.654] (-1382.178) (-1383.534) -- 0:01:23
559000 -- [-1376.130] (-1378.342) (-1380.262) (-1378.357) * (-1382.444) (-1376.325) [-1376.546] (-1381.935) -- 0:01:23
559500 -- [-1382.134] (-1382.359) (-1380.687) (-1386.357) * (-1379.622) (-1373.605) (-1380.375) [-1375.698] -- 0:01:24
560000 -- (-1385.544) (-1377.860) (-1380.733) [-1381.508] * [-1377.375] (-1384.366) (-1377.473) (-1378.226) -- 0:01:24
Average standard deviation of split frequencies: 0.001261
560500 -- (-1379.476) [-1376.712] (-1377.414) (-1384.080) * (-1378.822) (-1380.963) [-1377.095] (-1374.424) -- 0:01:23
561000 -- [-1379.128] (-1378.300) (-1377.236) (-1381.518) * (-1384.580) [-1384.956] (-1374.856) (-1380.421) -- 0:01:23
561500 -- [-1374.542] (-1380.383) (-1379.407) (-1381.511) * (-1380.296) (-1380.565) (-1380.547) [-1379.758] -- 0:01:23
562000 -- [-1376.861] (-1380.091) (-1379.862) (-1382.752) * (-1380.288) (-1379.188) (-1384.134) [-1376.917] -- 0:01:23
562500 -- (-1378.557) [-1381.415] (-1377.732) (-1378.887) * (-1378.126) (-1380.793) (-1380.075) [-1376.645] -- 0:01:23
563000 -- (-1379.123) (-1382.725) (-1374.973) [-1380.285] * (-1385.184) (-1385.135) (-1379.964) [-1379.376] -- 0:01:23
563500 -- (-1374.746) (-1382.086) (-1379.351) [-1377.023] * (-1384.519) (-1384.649) (-1385.107) [-1376.396] -- 0:01:22
564000 -- (-1381.226) [-1382.580] (-1381.709) (-1382.426) * (-1381.125) (-1379.119) (-1386.099) [-1379.960] -- 0:01:22
564500 -- (-1377.620) (-1379.061) (-1381.374) [-1377.735] * (-1381.555) (-1380.328) (-1376.585) [-1378.049] -- 0:01:23
565000 -- (-1375.535) (-1377.471) (-1377.696) [-1377.749] * (-1383.727) (-1373.465) (-1376.078) [-1377.565] -- 0:01:23
Average standard deviation of split frequencies: 0.001249
565500 -- [-1375.587] (-1375.165) (-1379.293) (-1377.456) * (-1383.187) [-1378.180] (-1380.309) (-1377.555) -- 0:01:22
566000 -- (-1380.152) (-1379.240) [-1377.294] (-1377.650) * (-1382.715) (-1377.606) (-1381.036) [-1381.814] -- 0:01:22
566500 -- (-1381.424) (-1376.411) (-1378.865) [-1382.465] * (-1383.591) [-1376.736] (-1379.286) (-1388.106) -- 0:01:22
567000 -- (-1383.782) (-1377.624) (-1389.143) [-1380.158] * (-1382.884) [-1381.917] (-1379.441) (-1383.761) -- 0:01:22
567500 -- (-1379.361) [-1374.175] (-1377.230) (-1386.276) * (-1389.018) (-1379.351) [-1380.420] (-1379.226) -- 0:01:22
568000 -- (-1381.893) [-1378.773] (-1375.696) (-1388.886) * (-1385.652) [-1376.422] (-1376.844) (-1383.845) -- 0:01:22
568500 -- (-1382.548) (-1379.321) (-1382.589) [-1378.828] * (-1392.240) [-1378.819] (-1383.639) (-1395.039) -- 0:01:21
569000 -- (-1386.835) (-1380.684) [-1381.621] (-1379.083) * (-1393.039) (-1376.112) [-1384.342] (-1392.239) -- 0:01:21
569500 -- (-1382.793) (-1384.666) (-1376.664) [-1373.499] * (-1381.834) (-1375.665) (-1381.483) [-1382.389] -- 0:01:21
570000 -- [-1377.531] (-1381.093) (-1376.512) (-1376.348) * (-1387.034) (-1385.941) [-1377.159] (-1380.476) -- 0:01:22
Average standard deviation of split frequencies: 0.001239
570500 -- (-1379.632) (-1380.384) (-1378.359) [-1381.201] * (-1383.955) [-1374.783] (-1384.395) (-1378.494) -- 0:01:22
571000 -- (-1381.265) (-1378.808) (-1383.236) [-1376.534] * (-1383.187) (-1376.465) (-1381.242) [-1375.194] -- 0:01:21
571500 -- (-1377.672) (-1379.107) [-1379.730] (-1380.572) * (-1383.239) (-1387.013) (-1378.605) [-1378.699] -- 0:01:21
572000 -- (-1386.027) [-1379.250] (-1388.660) (-1375.218) * (-1381.054) (-1382.088) (-1385.393) [-1377.806] -- 0:01:21
572500 -- (-1379.717) (-1377.046) [-1379.445] (-1378.809) * (-1380.646) [-1381.313] (-1375.799) (-1387.160) -- 0:01:21
573000 -- (-1380.552) (-1376.059) (-1383.207) [-1378.668] * (-1391.456) (-1383.266) [-1375.989] (-1383.829) -- 0:01:21
573500 -- [-1384.303] (-1379.825) (-1378.642) (-1374.907) * (-1383.396) (-1389.071) [-1376.831] (-1379.581) -- 0:01:21
574000 -- [-1377.500] (-1375.852) (-1383.063) (-1381.002) * [-1377.776] (-1383.429) (-1376.691) (-1382.764) -- 0:01:20
574500 -- [-1380.586] (-1375.855) (-1381.637) (-1374.830) * (-1380.817) [-1375.730] (-1381.903) (-1380.853) -- 0:01:20
575000 -- (-1387.288) (-1379.287) (-1376.422) [-1375.768] * (-1381.493) (-1381.464) [-1378.636] (-1375.929) -- 0:01:21
Average standard deviation of split frequencies: 0.001228
575500 -- (-1383.354) (-1375.428) (-1379.640) [-1378.029] * (-1380.653) (-1395.886) (-1382.272) [-1376.157] -- 0:01:21
576000 -- [-1376.941] (-1379.441) (-1375.242) (-1384.761) * [-1380.248] (-1380.628) (-1383.626) (-1373.295) -- 0:01:20
576500 -- [-1376.966] (-1374.079) (-1378.539) (-1379.917) * (-1390.509) [-1377.003] (-1389.321) (-1380.560) -- 0:01:20
577000 -- (-1377.604) [-1378.314] (-1378.389) (-1382.023) * [-1381.036] (-1381.352) (-1382.820) (-1380.111) -- 0:01:20
577500 -- (-1378.877) (-1381.851) [-1381.895] (-1380.998) * [-1379.603] (-1375.035) (-1384.916) (-1375.541) -- 0:01:20
578000 -- [-1382.830] (-1381.011) (-1386.673) (-1377.384) * (-1383.232) (-1383.855) (-1394.203) [-1376.773] -- 0:01:20
578500 -- (-1382.890) [-1377.242] (-1386.454) (-1378.295) * (-1380.679) [-1381.885] (-1377.904) (-1382.724) -- 0:01:20
579000 -- (-1374.473) [-1383.803] (-1383.437) (-1376.581) * (-1386.504) [-1375.892] (-1382.721) (-1383.282) -- 0:01:19
579500 -- (-1381.455) [-1378.669] (-1379.356) (-1378.529) * (-1385.918) (-1378.535) (-1378.682) [-1378.933] -- 0:01:19
580000 -- [-1378.598] (-1381.577) (-1377.511) (-1377.436) * [-1379.227] (-1385.623) (-1375.445) (-1380.648) -- 0:01:20
Average standard deviation of split frequencies: 0.001624
580500 -- (-1385.049) (-1380.733) [-1377.153] (-1379.078) * (-1377.720) (-1380.668) (-1374.901) [-1381.241] -- 0:01:20
581000 -- (-1377.089) [-1382.998] (-1381.498) (-1376.289) * [-1376.829] (-1376.147) (-1374.762) (-1376.834) -- 0:01:20
581500 -- (-1382.650) (-1380.245) (-1381.962) [-1380.329] * (-1376.133) [-1385.603] (-1376.212) (-1380.973) -- 0:01:19
582000 -- [-1388.398] (-1383.509) (-1381.142) (-1382.814) * (-1386.854) (-1377.271) (-1377.586) [-1379.315] -- 0:01:19
582500 -- (-1375.488) [-1382.576] (-1374.362) (-1383.328) * (-1376.824) (-1390.950) (-1382.499) [-1377.259] -- 0:01:19
583000 -- [-1377.622] (-1386.001) (-1376.924) (-1377.487) * (-1378.933) [-1373.454] (-1380.233) (-1384.525) -- 0:01:19
583500 -- (-1376.107) [-1378.616] (-1378.066) (-1376.271) * [-1375.629] (-1373.387) (-1380.744) (-1390.580) -- 0:01:19
584000 -- (-1376.949) [-1379.825] (-1378.762) (-1376.502) * [-1378.926] (-1375.073) (-1385.095) (-1382.149) -- 0:01:19
584500 -- (-1385.367) (-1380.901) [-1381.426] (-1374.792) * (-1382.470) [-1375.245] (-1381.410) (-1383.617) -- 0:01:18
585000 -- [-1386.352] (-1385.180) (-1376.660) (-1380.404) * (-1379.829) (-1376.215) [-1377.380] (-1376.967) -- 0:01:18
Average standard deviation of split frequencies: 0.001609
585500 -- (-1381.624) [-1379.981] (-1378.650) (-1384.549) * [-1379.435] (-1375.774) (-1390.999) (-1376.978) -- 0:01:19
586000 -- (-1381.777) [-1380.659] (-1382.819) (-1383.629) * (-1379.430) (-1375.524) (-1386.196) [-1377.620] -- 0:01:19
586500 -- (-1379.345) (-1383.383) (-1391.245) [-1387.316] * (-1378.279) (-1378.675) (-1384.564) [-1380.986] -- 0:01:18
587000 -- [-1374.657] (-1383.642) (-1378.300) (-1386.928) * (-1379.400) (-1377.472) [-1379.169] (-1383.846) -- 0:01:18
587500 -- (-1381.033) (-1383.693) [-1375.762] (-1379.765) * [-1377.568] (-1383.088) (-1383.326) (-1388.732) -- 0:01:18
588000 -- (-1377.444) (-1378.223) [-1376.992] (-1376.881) * (-1379.056) [-1387.107] (-1380.473) (-1387.034) -- 0:01:18
588500 -- (-1378.325) (-1378.838) (-1380.969) [-1377.253] * [-1378.382] (-1382.241) (-1380.769) (-1383.145) -- 0:01:18
589000 -- (-1379.573) (-1378.456) [-1373.951] (-1379.519) * [-1375.652] (-1379.824) (-1390.032) (-1384.062) -- 0:01:18
589500 -- [-1378.972] (-1376.570) (-1381.476) (-1374.718) * (-1377.622) (-1382.215) [-1380.127] (-1388.412) -- 0:01:17
590000 -- [-1377.541] (-1381.438) (-1385.773) (-1375.668) * (-1381.584) [-1383.335] (-1380.653) (-1385.074) -- 0:01:17
Average standard deviation of split frequencies: 0.001995
590500 -- [-1380.750] (-1377.253) (-1380.838) (-1382.675) * [-1378.800] (-1384.290) (-1379.421) (-1388.456) -- 0:01:18
591000 -- (-1377.087) (-1377.532) (-1380.407) [-1382.604] * (-1376.459) [-1380.865] (-1378.119) (-1388.062) -- 0:01:18
591500 -- (-1377.503) (-1376.690) (-1383.563) [-1375.961] * [-1380.265] (-1373.163) (-1377.387) (-1379.982) -- 0:01:18
592000 -- (-1376.079) (-1387.003) [-1376.093] (-1378.566) * (-1384.044) [-1379.274] (-1381.010) (-1386.295) -- 0:01:17
592500 -- [-1375.886] (-1378.362) (-1380.536) (-1380.998) * (-1382.681) (-1380.707) (-1380.881) [-1380.748] -- 0:01:17
593000 -- (-1377.549) (-1385.153) [-1379.981] (-1384.573) * (-1377.409) [-1377.430] (-1378.583) (-1377.121) -- 0:01:17
593500 -- [-1384.772] (-1379.560) (-1378.783) (-1381.913) * (-1377.305) [-1376.845] (-1377.698) (-1377.649) -- 0:01:17
594000 -- (-1386.270) [-1379.222] (-1386.104) (-1379.260) * (-1382.025) [-1378.476] (-1377.215) (-1382.448) -- 0:01:17
594500 -- (-1386.396) (-1377.656) [-1381.215] (-1381.344) * (-1376.722) (-1381.057) [-1374.970] (-1381.192) -- 0:01:17
595000 -- (-1377.099) [-1381.133] (-1383.733) (-1383.291) * (-1383.193) (-1380.184) [-1377.977] (-1377.907) -- 0:01:16
Average standard deviation of split frequencies: 0.001977
595500 -- (-1379.584) (-1383.681) (-1375.580) [-1381.557] * (-1376.336) (-1379.468) (-1382.446) [-1377.562] -- 0:01:16
596000 -- (-1376.465) (-1384.609) (-1381.983) [-1379.106] * (-1378.547) (-1378.132) [-1378.349] (-1379.274) -- 0:01:17
596500 -- (-1388.548) (-1385.122) [-1381.852] (-1378.384) * [-1377.088] (-1386.530) (-1379.711) (-1379.171) -- 0:01:17
597000 -- (-1394.871) (-1383.753) (-1380.197) [-1381.486] * (-1381.619) [-1380.368] (-1380.439) (-1378.267) -- 0:01:16
597500 -- (-1382.332) (-1377.916) [-1382.496] (-1379.867) * (-1374.758) [-1384.771] (-1381.123) (-1379.992) -- 0:01:16
598000 -- (-1378.709) (-1377.778) [-1376.356] (-1380.292) * (-1376.061) [-1376.657] (-1380.901) (-1381.430) -- 0:01:16
598500 -- (-1383.625) (-1384.293) (-1381.628) [-1379.856] * (-1378.195) (-1387.407) (-1382.032) [-1383.706] -- 0:01:16
599000 -- (-1383.303) (-1380.125) [-1382.039] (-1377.402) * [-1379.705] (-1387.397) (-1379.671) (-1377.182) -- 0:01:16
599500 -- (-1383.711) [-1376.777] (-1378.279) (-1385.381) * (-1380.877) (-1395.736) (-1384.344) [-1379.775] -- 0:01:16
600000 -- [-1374.992] (-1380.584) (-1383.526) (-1380.313) * (-1379.982) (-1381.621) (-1382.159) [-1374.309] -- 0:01:16
Average standard deviation of split frequencies: 0.002354
600500 -- (-1375.686) (-1377.393) [-1384.873] (-1379.437) * [-1378.420] (-1378.814) (-1380.442) (-1375.609) -- 0:01:15
601000 -- [-1377.618] (-1377.419) (-1385.003) (-1383.205) * (-1383.725) (-1384.501) [-1389.239] (-1376.960) -- 0:01:16
601500 -- (-1376.210) (-1374.849) [-1379.266] (-1377.216) * (-1379.439) (-1375.723) (-1387.293) [-1376.952] -- 0:01:16
602000 -- [-1383.093] (-1383.890) (-1378.728) (-1380.540) * (-1392.282) [-1379.918] (-1387.352) (-1379.173) -- 0:01:16
602500 -- [-1377.435] (-1377.750) (-1379.798) (-1379.036) * (-1381.712) [-1377.458] (-1382.599) (-1377.915) -- 0:01:15
603000 -- (-1376.329) (-1384.339) (-1383.202) [-1377.277] * (-1378.129) (-1381.674) [-1391.434] (-1381.576) -- 0:01:15
603500 -- [-1376.527] (-1383.733) (-1381.495) (-1377.903) * (-1374.742) (-1376.865) (-1388.857) [-1375.442] -- 0:01:15
604000 -- [-1381.232] (-1384.268) (-1377.580) (-1383.027) * (-1384.109) (-1379.498) [-1390.215] (-1378.339) -- 0:01:15
604500 -- (-1377.244) (-1381.386) [-1381.735] (-1375.937) * [-1377.934] (-1378.589) (-1380.774) (-1378.776) -- 0:01:15
605000 -- (-1380.134) (-1380.852) (-1380.654) [-1378.047] * [-1379.702] (-1377.455) (-1380.174) (-1374.284) -- 0:01:15
Average standard deviation of split frequencies: 0.002334
605500 -- (-1378.765) (-1381.300) [-1376.886] (-1376.561) * (-1383.092) (-1384.742) (-1380.086) [-1374.820] -- 0:01:14
606000 -- (-1380.009) (-1383.422) [-1380.171] (-1377.471) * (-1379.661) (-1379.627) (-1378.445) [-1377.032] -- 0:01:14
606500 -- (-1377.154) [-1376.868] (-1383.405) (-1386.069) * [-1383.711] (-1384.467) (-1378.685) (-1378.354) -- 0:01:15
607000 -- (-1381.914) [-1381.799] (-1380.130) (-1378.125) * (-1380.772) (-1389.981) (-1376.795) [-1377.258] -- 0:01:15
607500 -- [-1375.484] (-1384.296) (-1379.664) (-1385.290) * [-1384.091] (-1383.428) (-1376.858) (-1381.935) -- 0:01:14
608000 -- [-1374.302] (-1383.672) (-1377.353) (-1379.472) * (-1385.740) (-1376.536) [-1378.151] (-1380.476) -- 0:01:14
608500 -- (-1381.221) [-1380.659] (-1378.338) (-1386.307) * (-1377.036) [-1378.125] (-1387.287) (-1386.910) -- 0:01:14
609000 -- [-1373.172] (-1381.583) (-1378.903) (-1380.101) * (-1379.997) (-1379.494) [-1382.015] (-1374.651) -- 0:01:14
609500 -- (-1379.208) (-1377.440) (-1379.144) [-1377.282] * (-1377.308) (-1387.286) (-1379.261) [-1377.160] -- 0:01:14
610000 -- [-1380.920] (-1380.576) (-1375.555) (-1383.574) * (-1376.948) (-1380.381) [-1377.773] (-1375.384) -- 0:01:14
Average standard deviation of split frequencies: 0.002316
610500 -- (-1378.843) (-1378.088) [-1382.335] (-1376.427) * (-1381.684) (-1385.270) [-1381.102] (-1381.426) -- 0:01:14
611000 -- (-1389.873) (-1377.797) [-1376.797] (-1384.490) * [-1377.699] (-1376.536) (-1377.110) (-1381.202) -- 0:01:13
611500 -- (-1381.979) (-1379.563) [-1377.445] (-1378.262) * (-1379.762) (-1381.614) (-1378.976) [-1378.082] -- 0:01:14
612000 -- (-1379.272) (-1381.039) [-1380.830] (-1378.695) * (-1385.970) [-1375.452] (-1376.824) (-1387.121) -- 0:01:14
612500 -- (-1386.584) [-1379.572] (-1374.535) (-1382.159) * (-1375.300) (-1381.249) [-1379.773] (-1382.152) -- 0:01:14
613000 -- (-1391.673) (-1390.349) [-1376.634] (-1381.982) * [-1380.860] (-1384.383) (-1379.971) (-1376.536) -- 0:01:13
613500 -- (-1382.574) (-1389.502) [-1376.390] (-1380.999) * [-1381.689] (-1380.707) (-1376.830) (-1376.403) -- 0:01:13
614000 -- (-1387.986) (-1391.037) [-1378.630] (-1375.789) * (-1391.024) (-1381.771) [-1380.554] (-1377.623) -- 0:01:13
614500 -- (-1383.229) (-1384.578) (-1376.144) [-1378.122] * (-1379.012) [-1375.227] (-1381.850) (-1377.483) -- 0:01:13
615000 -- [-1378.651] (-1392.497) (-1378.035) (-1378.516) * (-1377.317) (-1376.122) [-1379.768] (-1381.928) -- 0:01:13
Average standard deviation of split frequencies: 0.002296
615500 -- (-1382.076) (-1383.320) [-1380.812] (-1380.698) * [-1377.020] (-1383.683) (-1383.085) (-1379.945) -- 0:01:13
616000 -- (-1379.392) (-1376.431) [-1377.952] (-1380.099) * [-1378.380] (-1377.728) (-1380.468) (-1383.391) -- 0:01:12
616500 -- (-1379.865) (-1381.018) (-1374.594) [-1381.465] * (-1380.787) [-1379.584] (-1377.828) (-1385.294) -- 0:01:13
617000 -- (-1375.240) (-1386.173) (-1381.337) [-1378.020] * (-1382.920) (-1379.020) (-1376.780) [-1376.987] -- 0:01:13
617500 -- (-1377.670) (-1378.850) [-1383.589] (-1382.270) * (-1382.097) (-1378.427) (-1376.277) [-1376.105] -- 0:01:13
618000 -- (-1377.977) (-1377.546) (-1380.954) [-1381.126] * (-1386.621) [-1375.946] (-1384.349) (-1379.635) -- 0:01:12
618500 -- [-1376.376] (-1377.639) (-1389.594) (-1379.234) * (-1378.661) (-1379.313) (-1381.253) [-1375.583] -- 0:01:12
619000 -- [-1376.131] (-1376.054) (-1383.502) (-1379.450) * [-1383.038] (-1379.560) (-1381.700) (-1380.036) -- 0:01:12
619500 -- (-1376.781) (-1388.817) (-1377.814) [-1379.058] * [-1376.051] (-1375.121) (-1382.286) (-1378.757) -- 0:01:12
620000 -- (-1372.120) (-1382.027) [-1382.742] (-1377.110) * (-1378.469) (-1373.520) [-1381.531] (-1378.539) -- 0:01:12
Average standard deviation of split frequencies: 0.002279
620500 -- [-1376.449] (-1382.393) (-1382.033) (-1384.160) * [-1381.280] (-1375.867) (-1377.476) (-1378.547) -- 0:01:12
621000 -- (-1384.571) (-1386.283) [-1377.531] (-1383.424) * (-1377.529) (-1382.986) [-1375.509] (-1381.321) -- 0:01:12
621500 -- [-1379.100] (-1390.963) (-1390.536) (-1380.409) * (-1381.324) (-1383.503) (-1379.001) [-1381.973] -- 0:01:11
622000 -- (-1379.085) (-1378.151) [-1382.807] (-1381.409) * (-1381.931) [-1379.739] (-1377.496) (-1376.435) -- 0:01:12
622500 -- (-1377.602) (-1382.804) [-1380.975] (-1382.855) * (-1379.842) (-1379.861) (-1383.612) [-1381.063] -- 0:01:12
623000 -- (-1374.944) (-1381.210) [-1377.322] (-1383.554) * [-1381.792] (-1378.802) (-1376.302) (-1389.089) -- 0:01:12
623500 -- (-1376.611) (-1384.833) [-1378.128] (-1378.107) * [-1376.037] (-1382.946) (-1379.168) (-1384.468) -- 0:01:11
624000 -- [-1377.798] (-1378.202) (-1376.152) (-1380.306) * [-1378.976] (-1376.113) (-1377.960) (-1384.935) -- 0:01:11
624500 -- (-1378.236) [-1378.858] (-1380.012) (-1381.051) * [-1382.776] (-1377.687) (-1378.719) (-1382.320) -- 0:01:11
625000 -- (-1375.614) (-1380.971) [-1376.439] (-1376.084) * [-1381.646] (-1378.583) (-1379.759) (-1377.944) -- 0:01:11
Average standard deviation of split frequencies: 0.002636
625500 -- (-1379.004) (-1389.538) [-1382.385] (-1380.127) * (-1382.537) (-1389.002) [-1378.113] (-1375.441) -- 0:01:11
626000 -- (-1379.644) (-1391.833) [-1376.473] (-1379.698) * [-1383.342] (-1383.734) (-1376.055) (-1374.459) -- 0:01:11
626500 -- [-1374.224] (-1381.751) (-1377.677) (-1387.671) * (-1379.006) (-1380.223) (-1385.037) [-1378.933] -- 0:01:10
627000 -- (-1385.475) (-1392.078) (-1378.874) [-1377.231] * (-1378.267) (-1376.985) (-1378.497) [-1376.556] -- 0:01:11
627500 -- [-1379.108] (-1384.712) (-1376.038) (-1376.928) * (-1378.332) [-1374.251] (-1381.097) (-1377.481) -- 0:01:11
628000 -- (-1381.493) [-1381.089] (-1376.251) (-1380.923) * [-1381.305] (-1376.753) (-1379.406) (-1382.111) -- 0:01:11
628500 -- [-1379.336] (-1379.030) (-1380.791) (-1377.282) * [-1376.629] (-1385.103) (-1380.718) (-1377.375) -- 0:01:10
629000 -- (-1374.172) [-1378.380] (-1384.013) (-1380.029) * (-1378.607) [-1381.443] (-1379.008) (-1379.930) -- 0:01:10
629500 -- (-1380.606) (-1379.785) (-1379.737) [-1382.321] * [-1389.087] (-1379.829) (-1374.715) (-1376.248) -- 0:01:10
630000 -- [-1377.959] (-1382.774) (-1382.237) (-1380.846) * [-1377.388] (-1379.408) (-1377.169) (-1377.751) -- 0:01:10
Average standard deviation of split frequencies: 0.002616
630500 -- (-1380.584) (-1385.200) [-1377.142] (-1375.322) * (-1378.021) (-1379.796) [-1376.901] (-1383.343) -- 0:01:10
631000 -- (-1376.523) (-1374.972) [-1378.188] (-1381.056) * [-1381.063] (-1379.623) (-1385.939) (-1378.695) -- 0:01:10
631500 -- [-1382.963] (-1380.134) (-1380.568) (-1376.318) * (-1387.540) (-1375.907) (-1376.172) [-1380.821] -- 0:01:10
632000 -- (-1386.011) (-1380.450) (-1380.093) [-1377.452] * [-1381.321] (-1383.469) (-1382.750) (-1384.520) -- 0:01:09
632500 -- [-1380.023] (-1381.080) (-1384.840) (-1379.392) * [-1379.314] (-1381.613) (-1384.845) (-1380.465) -- 0:01:10
633000 -- (-1380.411) (-1382.818) (-1380.897) [-1376.179] * (-1381.781) (-1379.129) (-1383.050) [-1383.989] -- 0:01:10
633500 -- (-1381.323) [-1377.747] (-1385.853) (-1380.283) * (-1387.351) (-1377.717) (-1384.661) [-1383.811] -- 0:01:10
634000 -- [-1382.253] (-1378.707) (-1383.053) (-1377.049) * [-1375.150] (-1381.069) (-1387.437) (-1380.872) -- 0:01:09
634500 -- [-1377.223] (-1374.085) (-1377.920) (-1379.090) * [-1383.259] (-1387.722) (-1383.079) (-1378.933) -- 0:01:09
635000 -- (-1380.300) [-1377.181] (-1379.764) (-1382.242) * (-1382.308) (-1381.460) (-1384.365) [-1381.873] -- 0:01:09
Average standard deviation of split frequencies: 0.002594
635500 -- (-1380.969) (-1378.762) (-1384.968) [-1376.239] * [-1373.534] (-1374.869) (-1389.121) (-1388.096) -- 0:01:09
636000 -- (-1380.526) [-1378.732] (-1380.026) (-1381.198) * [-1383.346] (-1381.193) (-1382.945) (-1381.808) -- 0:01:09
636500 -- (-1388.274) [-1376.812] (-1379.242) (-1378.174) * [-1380.199] (-1379.455) (-1382.949) (-1385.201) -- 0:01:09
637000 -- (-1386.084) (-1384.117) [-1376.610] (-1381.791) * [-1384.135] (-1384.200) (-1388.377) (-1386.148) -- 0:01:08
637500 -- [-1380.130] (-1382.975) (-1378.043) (-1383.520) * (-1382.542) [-1375.917] (-1379.378) (-1379.690) -- 0:01:09
638000 -- (-1375.611) (-1384.395) [-1381.623] (-1377.011) * (-1379.217) [-1375.126] (-1384.905) (-1380.506) -- 0:01:09
638500 -- [-1379.070] (-1385.321) (-1384.029) (-1382.828) * [-1378.123] (-1378.771) (-1381.993) (-1386.717) -- 0:01:09
639000 -- [-1376.060] (-1384.999) (-1376.084) (-1381.202) * (-1376.751) [-1373.970] (-1382.539) (-1380.666) -- 0:01:08
639500 -- (-1379.360) (-1380.281) (-1385.262) [-1378.092] * [-1378.295] (-1390.952) (-1386.754) (-1377.747) -- 0:01:08
640000 -- (-1381.380) (-1376.139) (-1387.179) [-1377.232] * (-1379.211) (-1377.400) [-1376.790] (-1378.661) -- 0:01:08
Average standard deviation of split frequencies: 0.002575
640500 -- (-1383.440) (-1386.992) [-1380.504] (-1379.999) * [-1385.304] (-1372.936) (-1381.159) (-1381.702) -- 0:01:08
641000 -- [-1377.248] (-1384.399) (-1376.086) (-1380.321) * (-1378.305) (-1374.726) (-1379.986) [-1377.163] -- 0:01:08
641500 -- (-1378.108) (-1374.538) [-1380.527] (-1382.906) * (-1381.504) [-1379.955] (-1381.807) (-1376.954) -- 0:01:08
642000 -- (-1376.117) (-1384.135) (-1381.401) [-1376.210] * (-1379.703) [-1378.108] (-1376.479) (-1381.092) -- 0:01:08
642500 -- (-1377.903) (-1376.554) (-1378.978) [-1378.358] * (-1381.216) (-1381.154) (-1377.298) [-1383.024] -- 0:01:07
643000 -- (-1379.447) (-1384.227) (-1377.528) [-1377.975] * (-1381.411) [-1375.691] (-1382.194) (-1380.111) -- 0:01:08
643500 -- (-1385.643) (-1386.500) [-1380.504] (-1379.639) * (-1384.812) (-1386.868) (-1381.070) [-1376.599] -- 0:01:08
644000 -- [-1378.852] (-1381.068) (-1383.535) (-1383.992) * (-1373.805) [-1385.385] (-1382.389) (-1377.621) -- 0:01:07
644500 -- (-1382.075) [-1384.597] (-1382.040) (-1382.366) * [-1384.544] (-1386.177) (-1374.817) (-1382.441) -- 0:01:07
645000 -- (-1378.675) (-1385.766) (-1379.946) [-1380.601] * (-1377.101) (-1384.754) (-1376.880) [-1374.711] -- 0:01:07
Average standard deviation of split frequencies: 0.002554
645500 -- (-1382.662) (-1384.317) (-1386.255) [-1381.653] * [-1383.780] (-1383.465) (-1378.469) (-1375.981) -- 0:01:07
646000 -- (-1378.626) (-1387.292) [-1382.795] (-1380.773) * (-1376.672) (-1378.421) (-1386.998) [-1376.310] -- 0:01:07
646500 -- (-1378.968) (-1380.940) (-1383.777) [-1385.785] * [-1378.842] (-1378.050) (-1384.569) (-1379.401) -- 0:01:07
647000 -- (-1379.730) (-1392.703) [-1382.689] (-1378.749) * (-1380.727) (-1379.049) (-1387.572) [-1378.434] -- 0:01:07
647500 -- (-1389.972) [-1376.104] (-1387.610) (-1379.496) * (-1379.165) (-1384.103) (-1385.423) [-1377.688] -- 0:01:06
648000 -- (-1376.885) (-1382.606) (-1377.810) [-1380.774] * (-1382.737) [-1381.187] (-1378.435) (-1382.732) -- 0:01:07
648500 -- (-1379.928) (-1380.516) (-1380.175) [-1376.129] * (-1380.685) (-1379.214) [-1377.981] (-1379.986) -- 0:01:07
649000 -- (-1380.331) (-1377.892) (-1388.549) [-1381.243] * (-1376.621) (-1378.257) [-1375.001] (-1389.645) -- 0:01:07
649500 -- (-1381.112) (-1376.331) (-1381.142) [-1377.204] * [-1379.393] (-1388.659) (-1378.019) (-1386.188) -- 0:01:06
650000 -- (-1375.349) (-1382.257) [-1379.193] (-1380.549) * (-1378.176) (-1381.895) (-1382.418) [-1377.200] -- 0:01:06
Average standard deviation of split frequencies: 0.002898
650500 -- (-1374.206) [-1379.634] (-1391.545) (-1379.895) * [-1379.793] (-1378.674) (-1377.150) (-1373.985) -- 0:01:06
651000 -- (-1378.278) (-1382.540) [-1378.611] (-1388.228) * (-1382.637) [-1379.420] (-1386.003) (-1383.439) -- 0:01:06
651500 -- (-1380.361) (-1383.633) (-1381.230) [-1380.887] * (-1387.637) [-1378.369] (-1379.658) (-1377.878) -- 0:01:06
652000 -- (-1379.088) [-1378.768] (-1389.287) (-1380.406) * (-1380.985) (-1382.198) (-1385.950) [-1380.331] -- 0:01:06
652500 -- (-1382.557) (-1375.806) (-1378.454) [-1381.866] * (-1384.318) (-1382.196) [-1378.243] (-1384.861) -- 0:01:06
653000 -- (-1379.632) (-1376.768) [-1379.319] (-1379.510) * (-1381.269) (-1382.400) (-1379.602) [-1375.416] -- 0:01:05
653500 -- (-1384.143) [-1377.360] (-1382.198) (-1380.060) * (-1375.870) (-1380.707) [-1375.847] (-1376.223) -- 0:01:06
654000 -- (-1381.405) [-1375.721] (-1376.706) (-1380.640) * (-1375.071) [-1376.760] (-1376.375) (-1374.240) -- 0:01:06
654500 -- (-1380.184) (-1383.790) [-1381.706] (-1379.957) * (-1375.113) (-1380.138) (-1378.080) [-1376.189] -- 0:01:05
655000 -- (-1381.861) (-1378.978) (-1379.533) [-1378.755] * (-1378.826) (-1375.429) [-1388.868] (-1380.818) -- 0:01:05
Average standard deviation of split frequencies: 0.002874
655500 -- (-1383.797) (-1379.794) (-1380.413) [-1376.364] * (-1384.376) (-1375.569) [-1376.847] (-1374.451) -- 0:01:05
656000 -- (-1379.011) (-1377.506) [-1375.682] (-1377.363) * (-1378.941) (-1378.322) [-1375.926] (-1379.971) -- 0:01:05
656500 -- [-1381.080] (-1380.591) (-1377.950) (-1375.865) * (-1378.166) (-1383.484) (-1377.101) [-1378.861] -- 0:01:05
657000 -- [-1382.025] (-1383.893) (-1378.174) (-1381.421) * (-1382.245) (-1375.322) [-1376.305] (-1375.432) -- 0:01:05
657500 -- (-1383.777) (-1378.877) (-1379.440) [-1377.126] * (-1380.964) (-1374.919) (-1383.708) [-1375.688] -- 0:01:05
658000 -- (-1383.228) [-1377.336] (-1380.618) (-1381.347) * (-1380.398) (-1380.639) (-1379.457) [-1374.318] -- 0:01:04
658500 -- (-1384.464) (-1384.477) (-1377.382) [-1381.601] * (-1380.226) (-1376.108) (-1377.669) [-1376.139] -- 0:01:05
659000 -- [-1375.482] (-1376.996) (-1378.929) (-1380.152) * (-1386.423) (-1379.284) [-1375.615] (-1375.858) -- 0:01:05
659500 -- (-1378.323) (-1380.815) (-1375.582) [-1379.471] * (-1379.399) [-1378.709] (-1380.774) (-1398.533) -- 0:01:05
660000 -- (-1381.589) [-1376.290] (-1373.829) (-1374.738) * [-1380.960] (-1378.485) (-1384.916) (-1379.423) -- 0:01:04
Average standard deviation of split frequencies: 0.002854
660500 -- (-1375.457) (-1376.177) (-1375.954) [-1374.621] * (-1377.331) [-1379.208] (-1383.233) (-1381.793) -- 0:01:04
661000 -- [-1378.948] (-1379.020) (-1377.064) (-1374.779) * [-1380.201] (-1387.714) (-1392.557) (-1379.971) -- 0:01:04
661500 -- (-1378.088) (-1375.888) (-1378.186) [-1375.566] * (-1382.852) [-1378.892] (-1380.552) (-1379.547) -- 0:01:04
662000 -- (-1380.593) [-1377.555] (-1377.027) (-1378.302) * (-1374.292) [-1382.158] (-1382.744) (-1379.456) -- 0:01:04
662500 -- (-1383.342) [-1376.001] (-1385.480) (-1379.651) * (-1378.326) [-1375.173] (-1387.609) (-1377.321) -- 0:01:04
663000 -- (-1383.352) [-1377.162] (-1380.334) (-1379.211) * (-1389.693) (-1380.026) (-1383.397) [-1376.631] -- 0:01:04
663500 -- (-1380.813) (-1379.289) (-1381.306) [-1377.741] * (-1384.493) (-1384.110) (-1379.160) [-1378.610] -- 0:01:04
664000 -- (-1381.705) (-1380.445) (-1379.862) [-1380.923] * (-1382.902) (-1379.493) (-1377.278) [-1376.939] -- 0:01:04
664500 -- (-1382.778) [-1376.790] (-1387.974) (-1378.238) * (-1379.654) [-1378.042] (-1381.067) (-1386.357) -- 0:01:04
665000 -- [-1381.649] (-1377.421) (-1383.330) (-1381.253) * (-1380.545) (-1377.117) (-1373.172) [-1377.958] -- 0:01:03
Average standard deviation of split frequencies: 0.002831
665500 -- [-1383.507] (-1374.440) (-1381.402) (-1380.407) * (-1376.310) (-1378.822) [-1376.047] (-1381.792) -- 0:01:03
666000 -- (-1381.949) (-1381.300) (-1377.585) [-1377.535] * (-1380.495) (-1375.401) (-1376.723) [-1375.901] -- 0:01:03
666500 -- (-1388.694) (-1391.689) [-1381.621] (-1382.776) * (-1386.059) [-1378.165] (-1385.316) (-1379.802) -- 0:01:03
667000 -- (-1381.138) (-1378.489) [-1381.167] (-1383.724) * (-1378.700) [-1376.684] (-1380.070) (-1389.417) -- 0:01:03
667500 -- [-1377.807] (-1377.924) (-1379.576) (-1379.858) * [-1374.160] (-1377.531) (-1380.558) (-1382.294) -- 0:01:03
668000 -- (-1379.095) [-1375.551] (-1376.669) (-1383.437) * (-1374.057) (-1381.716) (-1379.772) [-1381.093] -- 0:01:03
668500 -- (-1382.603) [-1384.679] (-1386.247) (-1384.976) * (-1381.303) (-1375.695) [-1375.559] (-1381.459) -- 0:01:02
669000 -- (-1380.191) (-1376.234) (-1377.718) [-1380.311] * (-1378.442) (-1376.264) [-1379.634] (-1385.620) -- 0:01:03
669500 -- (-1375.840) [-1377.614] (-1385.137) (-1380.972) * (-1386.577) (-1382.269) [-1379.722] (-1379.369) -- 0:01:03
670000 -- [-1379.879] (-1379.055) (-1381.669) (-1380.035) * (-1377.513) [-1378.997] (-1378.030) (-1383.645) -- 0:01:03
Average standard deviation of split frequencies: 0.002812
670500 -- (-1382.809) (-1381.973) (-1381.863) [-1382.527] * (-1378.376) (-1381.378) (-1377.707) [-1379.660] -- 0:01:02
671000 -- (-1387.412) (-1382.620) [-1380.309] (-1379.002) * (-1377.939) (-1379.613) [-1377.717] (-1380.384) -- 0:01:02
671500 -- (-1376.984) (-1381.770) [-1376.112] (-1380.932) * (-1379.703) [-1384.294] (-1375.472) (-1377.591) -- 0:01:02
672000 -- (-1376.811) [-1379.950] (-1376.914) (-1384.461) * (-1382.311) (-1384.150) [-1378.829] (-1382.053) -- 0:01:02
672500 -- (-1379.278) (-1381.589) (-1380.486) [-1373.941] * (-1381.170) (-1380.911) (-1378.586) [-1375.622] -- 0:01:02
673000 -- (-1382.647) [-1377.635] (-1375.618) (-1380.048) * (-1388.078) [-1378.571] (-1377.823) (-1379.722) -- 0:01:02
673500 -- (-1383.890) (-1384.527) [-1381.220] (-1376.734) * [-1380.268] (-1382.140) (-1382.569) (-1376.111) -- 0:01:02
674000 -- (-1376.102) (-1384.587) [-1379.209] (-1375.873) * [-1378.525] (-1379.325) (-1390.699) (-1373.727) -- 0:01:02
674500 -- [-1381.033] (-1385.650) (-1378.425) (-1382.641) * (-1377.431) [-1384.816] (-1380.951) (-1372.444) -- 0:01:02
675000 -- (-1378.453) [-1376.345] (-1382.555) (-1384.490) * [-1382.635] (-1384.810) (-1382.812) (-1375.887) -- 0:01:02
Average standard deviation of split frequencies: 0.003138
675500 -- (-1375.703) [-1375.864] (-1377.229) (-1380.322) * (-1381.920) (-1382.072) (-1377.135) [-1374.539] -- 0:01:01
676000 -- [-1373.772] (-1377.562) (-1380.016) (-1385.576) * (-1379.491) [-1379.796] (-1379.175) (-1377.978) -- 0:01:01
676500 -- (-1374.819) [-1377.199] (-1377.794) (-1386.202) * (-1380.231) (-1380.735) (-1376.072) [-1376.698] -- 0:01:01
677000 -- (-1379.680) [-1379.831] (-1378.720) (-1387.891) * (-1381.429) (-1381.758) (-1375.522) [-1378.598] -- 0:01:01
677500 -- (-1377.569) (-1380.986) (-1381.025) [-1379.132] * (-1379.181) (-1380.374) (-1381.738) [-1380.387] -- 0:01:01
678000 -- (-1387.452) (-1387.245) (-1380.385) [-1375.344] * (-1382.066) (-1380.846) [-1378.840] (-1381.341) -- 0:01:01
678500 -- [-1377.069] (-1386.375) (-1382.294) (-1382.429) * (-1382.116) (-1380.730) (-1381.708) [-1377.407] -- 0:01:01
679000 -- (-1379.312) (-1380.430) (-1377.360) [-1377.577] * (-1389.271) [-1375.885] (-1384.935) (-1376.540) -- 0:01:00
679500 -- (-1378.431) (-1376.786) [-1375.674] (-1379.723) * (-1381.966) [-1377.365] (-1386.169) (-1380.054) -- 0:01:01
680000 -- (-1378.658) (-1379.360) (-1379.811) [-1379.817] * (-1376.242) (-1373.484) (-1375.571) [-1374.919] -- 0:01:01
Average standard deviation of split frequencies: 0.003117
680500 -- (-1386.047) (-1382.394) [-1376.170] (-1379.000) * (-1379.779) (-1380.780) (-1376.476) [-1379.033] -- 0:01:01
681000 -- (-1389.809) (-1379.924) (-1380.918) [-1380.474] * [-1374.690] (-1382.898) (-1382.100) (-1377.708) -- 0:01:00
681500 -- [-1381.341] (-1385.223) (-1386.216) (-1379.362) * [-1377.181] (-1377.885) (-1378.932) (-1382.280) -- 0:01:00
682000 -- (-1376.251) (-1386.458) [-1380.723] (-1381.835) * (-1379.881) (-1379.813) (-1386.897) [-1379.262] -- 0:01:00
682500 -- (-1377.233) (-1381.433) [-1378.524] (-1376.984) * (-1378.554) (-1376.958) (-1384.865) [-1380.557] -- 0:01:00
683000 -- (-1382.170) (-1380.636) (-1382.557) [-1379.244] * (-1375.754) (-1383.613) (-1378.660) [-1375.966] -- 0:01:00
683500 -- (-1379.068) [-1382.005] (-1380.444) (-1386.591) * (-1372.984) (-1381.482) [-1375.574] (-1381.517) -- 0:01:00
684000 -- (-1380.190) [-1381.155] (-1379.147) (-1385.367) * (-1380.325) [-1381.610] (-1386.585) (-1385.795) -- 0:01:00
684500 -- (-1377.508) (-1377.465) (-1388.290) [-1378.586] * (-1381.740) (-1381.098) (-1383.093) [-1378.320] -- 0:01:00
685000 -- (-1385.127) (-1374.151) (-1381.255) [-1376.750] * (-1381.278) [-1381.335] (-1382.941) (-1386.830) -- 0:01:00
Average standard deviation of split frequencies: 0.003092
685500 -- (-1384.030) [-1377.459] (-1377.084) (-1378.394) * (-1382.551) (-1381.988) [-1379.971] (-1383.179) -- 0:01:00
686000 -- (-1384.372) [-1374.875] (-1377.846) (-1380.923) * (-1381.304) (-1378.220) [-1376.615] (-1380.700) -- 0:00:59
686500 -- [-1375.555] (-1381.466) (-1380.793) (-1385.742) * (-1380.734) [-1384.162] (-1377.390) (-1375.901) -- 0:00:59
687000 -- (-1375.544) [-1373.771] (-1382.825) (-1381.383) * [-1379.427] (-1385.706) (-1381.543) (-1375.717) -- 0:00:59
687500 -- (-1378.801) [-1375.835] (-1383.663) (-1383.673) * (-1384.237) (-1385.748) [-1379.207] (-1374.561) -- 0:00:59
688000 -- (-1379.445) (-1376.517) (-1384.323) [-1379.893] * (-1386.484) (-1392.566) (-1382.013) [-1378.338] -- 0:00:59
688500 -- (-1377.285) (-1375.135) (-1381.028) [-1380.749] * (-1382.165) (-1388.853) [-1378.312] (-1381.540) -- 0:00:59
689000 -- (-1376.572) (-1375.687) (-1377.562) [-1376.323] * (-1384.276) (-1380.181) (-1382.065) [-1377.748] -- 0:00:59
689500 -- [-1383.129] (-1378.771) (-1380.813) (-1376.341) * (-1388.558) (-1383.001) (-1379.704) [-1381.337] -- 0:00:58
690000 -- (-1377.722) (-1383.012) (-1376.338) [-1380.077] * (-1383.429) (-1380.645) (-1378.997) [-1377.539] -- 0:00:59
Average standard deviation of split frequencies: 0.003071
690500 -- (-1376.192) (-1379.262) [-1377.378] (-1377.959) * (-1376.569) (-1380.319) (-1379.470) [-1380.936] -- 0:00:59
691000 -- (-1381.441) (-1379.524) (-1378.050) [-1382.475] * (-1378.371) (-1378.477) (-1380.251) [-1381.579] -- 0:00:59
691500 -- (-1379.883) (-1380.384) (-1380.336) [-1379.334] * (-1376.391) [-1378.991] (-1379.404) (-1383.333) -- 0:00:58
692000 -- [-1377.685] (-1375.906) (-1379.011) (-1387.915) * (-1378.041) (-1375.727) [-1378.424] (-1372.897) -- 0:00:58
692500 -- [-1374.397] (-1377.412) (-1380.404) (-1381.045) * (-1384.785) (-1383.298) (-1381.560) [-1375.715] -- 0:00:58
693000 -- [-1374.295] (-1382.282) (-1380.670) (-1381.667) * (-1382.132) (-1378.492) (-1383.287) [-1376.167] -- 0:00:58
693500 -- (-1378.306) [-1375.400] (-1379.876) (-1378.789) * (-1381.559) (-1383.158) [-1379.011] (-1377.819) -- 0:00:58
694000 -- (-1375.696) [-1386.272] (-1375.461) (-1374.918) * (-1380.309) (-1384.028) [-1378.726] (-1379.580) -- 0:00:58
694500 -- (-1378.015) (-1381.450) [-1377.464] (-1378.533) * (-1390.206) [-1381.828] (-1386.398) (-1384.332) -- 0:00:58
695000 -- (-1376.476) (-1375.902) [-1378.007] (-1380.817) * (-1384.437) (-1375.349) [-1383.080] (-1383.641) -- 0:00:58
Average standard deviation of split frequencies: 0.003048
695500 -- (-1377.674) [-1386.465] (-1384.956) (-1386.212) * (-1385.040) (-1377.074) [-1376.574] (-1376.613) -- 0:00:58
696000 -- (-1380.172) (-1380.801) [-1378.649] (-1381.930) * [-1380.274] (-1378.391) (-1377.550) (-1382.131) -- 0:00:58
696500 -- (-1378.688) [-1377.419] (-1378.494) (-1382.512) * (-1376.814) (-1381.348) (-1384.526) [-1375.798] -- 0:00:57
697000 -- (-1385.250) [-1379.552] (-1383.888) (-1393.461) * (-1385.982) [-1379.795] (-1378.904) (-1377.719) -- 0:00:57
697500 -- (-1380.031) [-1377.637] (-1382.767) (-1389.729) * (-1377.232) (-1381.049) (-1375.613) [-1377.113] -- 0:00:57
698000 -- [-1380.766] (-1379.146) (-1374.702) (-1387.724) * (-1379.844) (-1381.001) [-1377.109] (-1378.351) -- 0:00:57
698500 -- [-1377.291] (-1383.200) (-1384.060) (-1387.831) * [-1378.205] (-1380.587) (-1377.032) (-1380.878) -- 0:00:57
699000 -- (-1382.461) [-1378.386] (-1376.493) (-1383.721) * [-1376.382] (-1380.644) (-1372.703) (-1378.602) -- 0:00:57
699500 -- (-1378.096) [-1383.647] (-1385.275) (-1384.450) * (-1384.940) [-1381.666] (-1376.225) (-1379.832) -- 0:00:57
700000 -- [-1378.987] (-1375.663) (-1379.634) (-1381.322) * (-1380.310) (-1382.025) [-1373.464] (-1379.512) -- 0:00:57
Average standard deviation of split frequencies: 0.003364
700500 -- [-1377.072] (-1383.319) (-1379.152) (-1378.949) * (-1377.901) [-1382.032] (-1374.991) (-1378.859) -- 0:00:57
701000 -- (-1376.068) (-1381.756) [-1377.786] (-1378.430) * [-1380.208] (-1380.043) (-1376.586) (-1379.467) -- 0:00:57
701500 -- [-1380.433] (-1383.677) (-1380.546) (-1377.411) * (-1392.062) (-1380.007) [-1378.248] (-1377.578) -- 0:00:57
702000 -- (-1380.962) (-1374.972) (-1380.137) [-1382.102] * (-1385.702) (-1380.806) (-1381.374) [-1382.030] -- 0:00:56
702500 -- (-1379.267) (-1383.446) (-1383.227) [-1375.390] * (-1387.492) [-1374.852] (-1379.999) (-1375.647) -- 0:00:56
703000 -- [-1377.972] (-1375.333) (-1378.559) (-1381.550) * (-1384.395) (-1378.825) [-1377.140] (-1380.955) -- 0:00:56
703500 -- (-1383.265) [-1378.745] (-1381.305) (-1381.303) * [-1378.901] (-1380.920) (-1375.934) (-1384.238) -- 0:00:56
704000 -- (-1393.096) (-1380.008) (-1377.807) [-1379.162] * (-1375.483) (-1376.149) [-1382.289] (-1377.457) -- 0:00:56
704500 -- (-1381.045) [-1382.467] (-1382.582) (-1383.494) * (-1393.322) (-1377.723) [-1378.593] (-1378.922) -- 0:00:56
705000 -- (-1381.420) (-1377.004) [-1377.753] (-1380.298) * (-1377.655) [-1381.282] (-1377.881) (-1386.763) -- 0:00:56
Average standard deviation of split frequencies: 0.003672
705500 -- (-1382.868) [-1375.572] (-1382.789) (-1381.914) * (-1377.298) [-1381.777] (-1377.627) (-1383.495) -- 0:00:56
706000 -- (-1385.033) (-1381.433) (-1382.557) [-1379.861] * [-1379.306] (-1381.262) (-1379.152) (-1377.874) -- 0:00:56
706500 -- (-1381.252) (-1381.802) [-1373.799] (-1380.218) * (-1378.101) [-1378.380] (-1379.865) (-1383.935) -- 0:00:56
707000 -- (-1378.141) [-1377.001] (-1377.822) (-1377.594) * (-1380.432) (-1383.874) (-1378.734) [-1387.374] -- 0:00:55
707500 -- (-1378.868) (-1375.291) (-1376.158) [-1386.007] * (-1376.519) [-1378.243] (-1384.247) (-1382.345) -- 0:00:55
708000 -- (-1384.104) (-1378.497) (-1382.521) [-1378.665] * (-1379.781) [-1378.353] (-1377.683) (-1379.561) -- 0:00:55
708500 -- [-1375.824] (-1380.646) (-1376.167) (-1379.787) * (-1378.581) (-1387.395) [-1378.883] (-1377.145) -- 0:00:55
709000 -- (-1383.219) [-1380.144] (-1380.262) (-1379.680) * [-1376.921] (-1378.516) (-1377.394) (-1375.234) -- 0:00:55
709500 -- (-1386.151) (-1375.627) [-1375.319] (-1384.941) * (-1380.868) (-1378.193) (-1386.176) [-1381.049] -- 0:00:55
710000 -- (-1384.301) (-1379.679) (-1375.714) [-1375.004] * [-1377.725] (-1382.353) (-1390.749) (-1379.078) -- 0:00:55
Average standard deviation of split frequencies: 0.003648
710500 -- [-1384.501] (-1390.071) (-1375.905) (-1373.236) * (-1378.611) [-1376.475] (-1383.942) (-1377.321) -- 0:00:55
711000 -- [-1379.949] (-1384.148) (-1381.624) (-1386.829) * (-1387.171) [-1376.274] (-1383.282) (-1376.447) -- 0:00:55
711500 -- [-1379.415] (-1376.474) (-1377.077) (-1387.227) * (-1392.827) (-1380.666) [-1377.109] (-1377.129) -- 0:00:55
712000 -- (-1383.698) (-1380.287) (-1375.317) [-1379.315] * (-1378.955) [-1379.513] (-1377.881) (-1380.821) -- 0:00:55
712500 -- (-1377.536) (-1384.016) (-1378.075) [-1374.532] * (-1374.595) (-1388.832) [-1376.610] (-1382.928) -- 0:00:54
713000 -- (-1381.436) (-1376.648) (-1389.212) [-1379.903] * (-1376.937) (-1381.265) [-1378.339] (-1378.233) -- 0:00:54
713500 -- (-1375.233) (-1378.028) (-1376.531) [-1376.866] * (-1377.259) (-1378.812) [-1378.400] (-1378.285) -- 0:00:54
714000 -- (-1380.053) [-1381.819] (-1377.601) (-1382.818) * (-1379.372) [-1379.025] (-1383.895) (-1378.895) -- 0:00:54
714500 -- [-1375.883] (-1381.338) (-1381.587) (-1380.527) * (-1381.097) (-1377.152) [-1380.425] (-1376.639) -- 0:00:54
715000 -- (-1376.438) [-1376.864] (-1384.784) (-1381.266) * (-1376.934) (-1377.670) [-1378.421] (-1380.535) -- 0:00:54
Average standard deviation of split frequencies: 0.003292
715500 -- (-1377.811) [-1378.430] (-1377.426) (-1386.365) * (-1382.604) (-1374.415) (-1380.049) [-1376.097] -- 0:00:54
716000 -- (-1376.238) [-1377.517] (-1383.597) (-1383.934) * [-1380.541] (-1379.902) (-1380.978) (-1377.201) -- 0:00:54
716500 -- [-1375.978] (-1382.240) (-1379.010) (-1383.095) * [-1382.854] (-1379.188) (-1380.537) (-1386.967) -- 0:00:54
717000 -- [-1386.940] (-1381.262) (-1378.218) (-1384.781) * (-1381.469) (-1380.793) (-1377.209) [-1377.787] -- 0:00:54
717500 -- (-1384.761) (-1388.176) (-1382.861) [-1374.651] * (-1378.468) (-1382.805) [-1377.186] (-1375.233) -- 0:00:53
718000 -- [-1385.929] (-1379.246) (-1381.781) (-1378.341) * (-1376.308) (-1383.018) [-1378.373] (-1376.893) -- 0:00:53
718500 -- (-1380.862) (-1392.712) (-1382.259) [-1378.503] * (-1377.520) (-1384.916) (-1380.834) [-1378.194] -- 0:00:53
719000 -- [-1381.078] (-1377.238) (-1383.534) (-1377.851) * (-1385.838) [-1374.761] (-1384.070) (-1385.308) -- 0:00:53
719500 -- (-1378.549) [-1382.963] (-1387.387) (-1381.090) * (-1379.757) (-1376.281) (-1375.804) [-1378.167] -- 0:00:53
720000 -- (-1375.813) [-1380.349] (-1379.910) (-1379.582) * (-1376.641) [-1385.261] (-1379.541) (-1374.864) -- 0:00:53
Average standard deviation of split frequencies: 0.002944
720500 -- (-1379.228) (-1377.324) (-1381.373) [-1379.743] * (-1379.887) (-1385.283) (-1375.555) [-1380.155] -- 0:00:53
721000 -- (-1383.426) [-1379.927] (-1379.778) (-1382.654) * (-1382.875) (-1386.222) (-1382.436) [-1376.136] -- 0:00:53
721500 -- (-1383.168) (-1376.800) [-1376.329] (-1380.276) * (-1380.876) (-1386.077) [-1382.624] (-1379.165) -- 0:00:53
722000 -- (-1379.777) (-1379.667) (-1376.991) [-1376.947] * (-1388.149) [-1378.021] (-1389.036) (-1380.026) -- 0:00:53
722500 -- (-1380.435) [-1374.356] (-1384.077) (-1382.079) * (-1382.920) (-1385.495) [-1381.930] (-1381.659) -- 0:00:53
723000 -- [-1376.505] (-1379.527) (-1376.740) (-1379.293) * [-1380.392] (-1381.578) (-1376.859) (-1383.035) -- 0:00:52
723500 -- (-1380.056) (-1383.610) (-1382.598) [-1378.011] * [-1379.999] (-1378.421) (-1379.809) (-1379.628) -- 0:00:52
724000 -- (-1379.153) (-1377.307) [-1381.116] (-1377.399) * (-1379.589) (-1382.927) [-1382.333] (-1378.307) -- 0:00:52
724500 -- (-1383.492) [-1377.923] (-1384.902) (-1378.564) * (-1376.865) [-1380.295] (-1386.844) (-1380.980) -- 0:00:52
725000 -- (-1380.785) (-1379.651) (-1379.630) [-1377.760] * (-1377.935) [-1379.996] (-1387.796) (-1373.837) -- 0:00:52
Average standard deviation of split frequencies: 0.002597
725500 -- (-1379.837) (-1377.931) (-1379.934) [-1385.084] * (-1375.419) (-1376.700) (-1386.358) [-1377.663] -- 0:00:52
726000 -- [-1376.850] (-1378.925) (-1379.035) (-1379.657) * (-1381.442) (-1384.031) [-1386.240] (-1378.928) -- 0:00:52
726500 -- [-1375.777] (-1376.275) (-1378.571) (-1378.120) * (-1381.136) [-1381.605] (-1384.018) (-1378.740) -- 0:00:52
727000 -- (-1375.856) (-1377.032) (-1379.282) [-1377.978] * [-1380.816] (-1377.752) (-1385.115) (-1375.441) -- 0:00:52
727500 -- (-1380.645) (-1375.146) [-1380.862] (-1376.092) * (-1386.506) (-1381.611) (-1389.657) [-1379.471] -- 0:00:52
728000 -- [-1375.846] (-1385.212) (-1381.319) (-1377.362) * [-1378.525] (-1378.219) (-1380.898) (-1380.733) -- 0:00:51
728500 -- [-1378.904] (-1380.373) (-1374.763) (-1382.632) * (-1379.393) (-1386.523) (-1378.002) [-1383.511] -- 0:00:51
729000 -- (-1379.367) (-1374.286) [-1375.259] (-1376.671) * (-1380.616) (-1377.868) (-1380.229) [-1375.048] -- 0:00:51
729500 -- (-1380.394) [-1376.464] (-1382.979) (-1374.355) * (-1384.361) [-1383.005] (-1379.531) (-1383.170) -- 0:00:51
730000 -- (-1379.228) [-1376.901] (-1379.266) (-1380.267) * [-1379.557] (-1374.596) (-1377.186) (-1376.984) -- 0:00:51
Average standard deviation of split frequencies: 0.002581
730500 -- (-1380.025) [-1381.186] (-1381.800) (-1376.528) * (-1376.268) (-1381.437) (-1380.370) [-1377.943] -- 0:00:51
731000 -- [-1378.084] (-1379.085) (-1390.115) (-1381.116) * (-1376.267) [-1382.998] (-1381.526) (-1377.969) -- 0:00:51
731500 -- (-1380.673) [-1377.191] (-1384.265) (-1379.243) * (-1377.686) [-1381.840] (-1378.216) (-1378.303) -- 0:00:51
732000 -- (-1385.749) (-1377.724) (-1386.659) [-1378.591] * (-1375.099) (-1381.705) (-1379.282) [-1377.336] -- 0:00:51
732500 -- (-1376.156) (-1380.140) [-1377.443] (-1376.860) * (-1380.429) [-1376.558] (-1382.993) (-1378.852) -- 0:00:51
733000 -- [-1383.195] (-1383.050) (-1376.881) (-1382.793) * [-1377.130] (-1379.589) (-1382.891) (-1379.451) -- 0:00:50
733500 -- (-1379.516) (-1378.674) (-1379.242) [-1376.793] * (-1381.274) (-1383.980) [-1377.135] (-1380.037) -- 0:00:50
734000 -- [-1376.166] (-1385.522) (-1377.176) (-1378.897) * (-1384.817) (-1379.485) (-1380.264) [-1377.525] -- 0:00:50
734500 -- (-1382.356) (-1386.926) [-1384.842] (-1384.391) * (-1384.201) (-1379.253) [-1385.425] (-1376.506) -- 0:00:50
735000 -- (-1376.735) (-1383.782) [-1377.042] (-1387.746) * [-1379.808] (-1379.649) (-1376.667) (-1381.363) -- 0:00:50
Average standard deviation of split frequencies: 0.002562
735500 -- (-1380.375) (-1379.871) (-1378.320) [-1381.486] * (-1379.068) (-1383.942) [-1379.786] (-1382.772) -- 0:00:50
736000 -- [-1379.611] (-1376.924) (-1385.254) (-1385.067) * [-1377.362] (-1379.637) (-1376.984) (-1383.050) -- 0:00:50
736500 -- (-1382.694) (-1377.073) [-1383.991] (-1390.995) * (-1380.613) (-1378.688) (-1379.302) [-1385.906] -- 0:00:50
737000 -- (-1379.456) [-1375.941] (-1384.205) (-1392.252) * (-1379.893) [-1382.899] (-1380.050) (-1378.509) -- 0:00:50
737500 -- (-1377.586) [-1377.449] (-1383.527) (-1386.866) * (-1384.958) [-1380.242] (-1382.597) (-1382.437) -- 0:00:50
738000 -- [-1375.671] (-1380.047) (-1393.804) (-1384.266) * [-1380.552] (-1389.885) (-1379.314) (-1383.508) -- 0:00:50
738500 -- (-1386.601) (-1379.384) (-1383.377) [-1388.664] * (-1374.598) (-1383.243) [-1376.566] (-1379.660) -- 0:00:49
739000 -- (-1376.810) (-1378.881) (-1381.905) [-1381.134] * [-1379.762] (-1383.877) (-1380.444) (-1383.531) -- 0:00:49
739500 -- (-1379.019) (-1380.884) (-1391.853) [-1380.244] * [-1376.107] (-1383.624) (-1381.102) (-1381.932) -- 0:00:49
740000 -- (-1377.423) (-1375.868) (-1380.991) [-1378.845] * (-1385.628) (-1385.936) (-1381.327) [-1377.233] -- 0:00:49
Average standard deviation of split frequencies: 0.002864
740500 -- (-1382.155) (-1376.897) [-1377.694] (-1382.744) * [-1386.776] (-1386.259) (-1374.021) (-1382.463) -- 0:00:49
741000 -- [-1378.029] (-1379.473) (-1380.107) (-1376.961) * (-1387.429) (-1384.209) (-1384.949) [-1383.360] -- 0:00:49
741500 -- [-1373.699] (-1390.066) (-1379.034) (-1375.450) * (-1382.339) (-1386.196) (-1379.801) [-1376.930] -- 0:00:49
742000 -- (-1381.814) (-1380.761) [-1377.938] (-1380.304) * (-1376.960) (-1381.034) [-1377.725] (-1374.913) -- 0:00:49
742500 -- (-1378.511) (-1379.507) (-1378.373) [-1378.019] * (-1377.871) (-1377.618) [-1376.697] (-1382.402) -- 0:00:49
743000 -- (-1378.547) [-1374.444] (-1381.519) (-1378.541) * [-1379.080] (-1378.967) (-1382.017) (-1379.593) -- 0:00:49
743500 -- (-1380.561) (-1380.200) [-1380.168] (-1380.216) * (-1378.493) (-1384.392) [-1379.318] (-1375.880) -- 0:00:48
744000 -- [-1378.529] (-1378.648) (-1382.732) (-1377.067) * [-1388.067] (-1381.139) (-1379.745) (-1380.051) -- 0:00:48
744500 -- (-1380.375) [-1378.384] (-1382.236) (-1380.540) * [-1376.221] (-1379.997) (-1373.206) (-1381.765) -- 0:00:48
745000 -- (-1376.118) (-1378.531) (-1376.933) [-1382.705] * (-1379.800) (-1380.903) [-1376.861] (-1373.501) -- 0:00:48
Average standard deviation of split frequencies: 0.002844
745500 -- (-1382.625) [-1374.625] (-1385.143) (-1388.117) * (-1381.519) (-1379.904) (-1388.454) [-1377.746] -- 0:00:48
746000 -- (-1380.343) (-1377.384) (-1379.480) [-1386.156] * (-1388.082) (-1377.339) (-1380.489) [-1378.176] -- 0:00:48
746500 -- (-1381.641) (-1384.046) (-1388.579) [-1388.687] * (-1380.041) (-1381.472) (-1381.172) [-1377.472] -- 0:00:48
747000 -- (-1383.799) [-1380.885] (-1382.021) (-1386.864) * (-1376.026) [-1381.171] (-1383.118) (-1381.470) -- 0:00:48
747500 -- [-1375.875] (-1382.617) (-1377.728) (-1382.788) * (-1385.304) (-1375.491) (-1377.654) [-1379.385] -- 0:00:48
748000 -- (-1380.578) (-1382.775) [-1380.288] (-1382.645) * (-1385.133) (-1377.042) (-1380.114) [-1376.618] -- 0:00:48
748500 -- (-1379.946) (-1380.000) (-1385.551) [-1380.162] * [-1380.243] (-1379.512) (-1377.577) (-1376.586) -- 0:00:48
749000 -- (-1381.815) (-1382.960) (-1386.045) [-1383.293] * (-1383.600) [-1378.552] (-1378.294) (-1378.032) -- 0:00:47
749500 -- (-1377.036) (-1385.149) (-1397.002) [-1378.165] * (-1385.433) (-1381.587) (-1380.251) [-1376.464] -- 0:00:47
750000 -- (-1382.609) (-1385.985) [-1377.374] (-1377.724) * (-1385.460) (-1389.417) [-1379.918] (-1379.397) -- 0:00:47
Average standard deviation of split frequencies: 0.002826
750500 -- (-1377.438) [-1379.698] (-1382.328) (-1381.405) * [-1381.373] (-1384.852) (-1382.127) (-1379.954) -- 0:00:47
751000 -- (-1378.186) (-1383.507) (-1381.934) [-1375.056] * (-1377.616) (-1381.323) (-1381.331) [-1374.954] -- 0:00:47
751500 -- (-1379.646) (-1379.319) (-1375.339) [-1377.398] * (-1377.846) (-1384.335) (-1379.693) [-1381.467] -- 0:00:47
752000 -- (-1380.279) (-1382.605) (-1379.731) [-1382.617] * (-1375.418) (-1380.523) (-1383.899) [-1378.404] -- 0:00:47
752500 -- (-1387.503) [-1378.887] (-1381.019) (-1388.276) * (-1379.518) (-1379.681) (-1380.353) [-1378.633] -- 0:00:47
753000 -- (-1378.413) (-1385.247) [-1388.587] (-1387.764) * (-1379.442) (-1380.386) (-1379.499) [-1377.276] -- 0:00:47
753500 -- (-1391.723) [-1381.975] (-1384.458) (-1384.253) * (-1394.339) (-1382.715) [-1378.176] (-1375.634) -- 0:00:47
754000 -- [-1383.004] (-1375.502) (-1382.990) (-1383.018) * [-1383.260] (-1376.116) (-1375.984) (-1377.162) -- 0:00:46
754500 -- [-1382.857] (-1377.111) (-1378.912) (-1382.620) * (-1382.688) (-1378.431) (-1377.699) [-1381.279] -- 0:00:46
755000 -- (-1380.753) (-1379.580) (-1382.907) [-1388.010] * (-1384.859) (-1377.778) (-1383.007) [-1382.217] -- 0:00:46
Average standard deviation of split frequencies: 0.003118
755500 -- [-1377.594] (-1377.944) (-1379.783) (-1387.284) * [-1378.670] (-1378.642) (-1382.320) (-1394.235) -- 0:00:46
756000 -- [-1378.422] (-1383.694) (-1378.077) (-1386.039) * [-1382.212] (-1376.186) (-1378.860) (-1387.486) -- 0:00:46
756500 -- (-1375.866) (-1390.267) [-1378.977] (-1382.460) * [-1382.192] (-1380.927) (-1375.320) (-1381.312) -- 0:00:46
757000 -- (-1380.164) (-1391.558) (-1378.380) [-1381.348] * (-1379.717) (-1380.371) [-1376.863] (-1377.738) -- 0:00:46
757500 -- [-1379.694] (-1387.047) (-1382.622) (-1381.788) * [-1378.224] (-1381.652) (-1381.841) (-1388.934) -- 0:00:46
758000 -- (-1387.033) (-1380.694) (-1377.728) [-1389.536] * [-1380.099] (-1385.188) (-1381.666) (-1377.746) -- 0:00:46
758500 -- (-1389.673) (-1376.094) [-1376.947] (-1382.260) * (-1387.263) (-1376.487) (-1382.911) [-1375.169] -- 0:00:46
759000 -- [-1376.655] (-1385.209) (-1377.389) (-1383.623) * (-1374.955) (-1380.144) (-1377.869) [-1382.864] -- 0:00:46
759500 -- (-1380.394) (-1384.059) [-1382.533] (-1377.146) * (-1375.993) (-1378.208) (-1379.394) [-1385.074] -- 0:00:45
760000 -- (-1381.519) [-1376.293] (-1385.664) (-1375.041) * [-1379.906] (-1376.855) (-1380.356) (-1386.940) -- 0:00:45
Average standard deviation of split frequencies: 0.002789
760500 -- (-1377.570) [-1377.110] (-1381.440) (-1378.510) * [-1378.014] (-1374.715) (-1379.487) (-1383.130) -- 0:00:45
761000 -- (-1385.582) (-1376.018) [-1377.889] (-1380.521) * [-1379.519] (-1382.614) (-1378.378) (-1375.586) -- 0:00:45
761500 -- [-1380.906] (-1380.080) (-1382.161) (-1376.880) * (-1378.155) [-1376.625] (-1381.067) (-1383.838) -- 0:00:45
762000 -- (-1379.157) (-1378.908) (-1376.354) [-1375.129] * (-1376.385) (-1377.147) (-1380.418) [-1378.238] -- 0:00:45
762500 -- (-1378.928) (-1380.895) [-1380.914] (-1379.403) * (-1375.767) (-1377.706) (-1377.990) [-1377.273] -- 0:00:45
763000 -- (-1377.544) (-1377.700) [-1379.705] (-1375.324) * (-1380.630) (-1382.043) (-1377.369) [-1375.436] -- 0:00:45
763500 -- (-1374.328) (-1375.326) (-1377.640) [-1380.110] * (-1379.521) (-1378.206) (-1378.040) [-1380.534] -- 0:00:45
764000 -- (-1379.619) [-1380.604] (-1380.490) (-1378.279) * [-1381.443] (-1379.631) (-1378.386) (-1377.714) -- 0:00:45
764500 -- (-1385.283) [-1379.436] (-1378.547) (-1389.224) * (-1376.636) [-1382.497] (-1378.846) (-1384.311) -- 0:00:44
765000 -- (-1385.139) (-1378.689) [-1379.705] (-1384.157) * [-1375.942] (-1377.023) (-1375.800) (-1386.506) -- 0:00:44
Average standard deviation of split frequencies: 0.003077
765500 -- (-1383.218) (-1391.789) (-1377.945) [-1380.400] * (-1380.450) [-1376.012] (-1386.474) (-1378.695) -- 0:00:44
766000 -- [-1377.381] (-1381.572) (-1376.776) (-1386.446) * (-1380.013) [-1378.551] (-1375.849) (-1377.920) -- 0:00:44
766500 -- (-1382.066) (-1379.995) [-1374.338] (-1388.391) * [-1377.834] (-1379.609) (-1380.604) (-1379.852) -- 0:00:44
767000 -- (-1376.145) (-1381.004) [-1378.609] (-1387.792) * (-1379.309) (-1378.874) [-1376.972] (-1388.696) -- 0:00:44
767500 -- [-1374.881] (-1379.211) (-1387.215) (-1382.737) * (-1386.128) (-1376.499) (-1378.725) [-1382.222] -- 0:00:44
768000 -- (-1377.223) [-1378.809] (-1385.325) (-1382.760) * (-1376.761) (-1383.306) (-1378.520) [-1381.250] -- 0:00:44
768500 -- (-1382.549) [-1375.459] (-1383.154) (-1376.743) * (-1381.469) [-1378.775] (-1375.644) (-1383.418) -- 0:00:44
769000 -- (-1386.250) [-1378.504] (-1380.157) (-1379.935) * [-1377.203] (-1383.257) (-1378.115) (-1385.895) -- 0:00:44
769500 -- (-1381.552) (-1378.011) (-1377.045) [-1379.819] * (-1391.707) [-1379.029] (-1378.461) (-1383.112) -- 0:00:44
770000 -- [-1376.148] (-1377.269) (-1380.741) (-1387.404) * (-1381.750) (-1377.408) [-1375.569] (-1377.431) -- 0:00:43
Average standard deviation of split frequencies: 0.003058
770500 -- [-1374.344] (-1380.489) (-1378.966) (-1380.851) * [-1377.487] (-1378.713) (-1382.440) (-1377.037) -- 0:00:43
771000 -- [-1375.565] (-1380.063) (-1385.018) (-1374.032) * (-1376.118) (-1378.674) (-1377.350) [-1381.246] -- 0:00:43
771500 -- (-1377.645) (-1378.716) (-1383.224) [-1378.086] * (-1375.902) [-1379.364] (-1379.590) (-1381.048) -- 0:00:43
772000 -- (-1379.432) (-1378.789) [-1385.747] (-1380.333) * (-1378.742) [-1376.214] (-1375.847) (-1376.786) -- 0:00:43
772500 -- (-1375.572) [-1379.868] (-1380.960) (-1384.440) * (-1378.538) (-1387.681) [-1375.367] (-1381.796) -- 0:00:43
773000 -- (-1376.097) [-1376.930] (-1379.552) (-1381.808) * (-1384.346) (-1385.236) [-1382.680] (-1380.313) -- 0:00:43
773500 -- (-1377.046) [-1382.410] (-1377.367) (-1383.888) * (-1376.070) [-1378.095] (-1379.313) (-1379.213) -- 0:00:43
774000 -- (-1377.066) (-1381.386) (-1381.654) [-1378.368] * (-1377.667) [-1380.355] (-1392.068) (-1380.269) -- 0:00:43
774500 -- (-1376.521) (-1379.702) (-1382.372) [-1379.396] * (-1375.437) [-1379.500] (-1388.896) (-1386.736) -- 0:00:43
775000 -- (-1379.841) [-1375.395] (-1381.526) (-1380.603) * (-1384.740) (-1376.777) [-1384.658] (-1377.968) -- 0:00:42
Average standard deviation of split frequencies: 0.003037
775500 -- (-1381.231) (-1381.626) [-1375.479] (-1384.318) * [-1376.463] (-1380.076) (-1379.969) (-1377.870) -- 0:00:42
776000 -- [-1380.874] (-1382.045) (-1381.105) (-1382.442) * (-1382.289) (-1381.667) (-1379.907) [-1379.124] -- 0:00:42
776500 -- (-1381.134) (-1386.441) (-1386.976) [-1376.995] * (-1384.333) [-1379.281] (-1384.836) (-1378.011) -- 0:00:42
777000 -- (-1378.559) (-1379.008) (-1387.913) [-1379.833] * [-1383.811] (-1380.335) (-1377.952) (-1379.050) -- 0:00:42
777500 -- (-1379.822) (-1384.851) (-1377.801) [-1379.811] * [-1377.713] (-1377.201) (-1381.630) (-1380.176) -- 0:00:42
778000 -- (-1379.128) [-1376.901] (-1375.216) (-1391.918) * [-1377.090] (-1380.605) (-1380.562) (-1379.327) -- 0:00:42
778500 -- [-1379.273] (-1377.899) (-1377.447) (-1378.340) * (-1377.486) [-1376.298] (-1382.268) (-1379.355) -- 0:00:42
779000 -- (-1376.382) (-1375.424) [-1376.562] (-1384.574) * (-1376.217) [-1380.125] (-1380.873) (-1379.197) -- 0:00:42
779500 -- [-1381.753] (-1376.898) (-1379.724) (-1384.607) * [-1376.591] (-1380.014) (-1379.143) (-1382.390) -- 0:00:42
780000 -- [-1379.624] (-1380.777) (-1386.810) (-1379.613) * (-1377.139) (-1385.825) (-1381.784) [-1380.024] -- 0:00:42
Average standard deviation of split frequencies: 0.003019
780500 -- (-1379.320) (-1381.853) [-1388.216] (-1383.938) * (-1378.405) (-1387.477) [-1374.804] (-1377.623) -- 0:00:41
781000 -- [-1374.706] (-1378.217) (-1389.766) (-1387.657) * (-1376.544) (-1386.566) [-1378.037] (-1380.994) -- 0:00:41
781500 -- (-1380.976) (-1384.700) [-1382.065] (-1384.370) * (-1382.139) (-1373.964) (-1379.982) [-1374.321] -- 0:00:41
782000 -- [-1375.418] (-1381.351) (-1381.810) (-1378.068) * (-1377.702) [-1384.277] (-1376.503) (-1374.874) -- 0:00:41
782500 -- (-1380.600) [-1380.299] (-1378.736) (-1382.002) * (-1382.846) [-1379.364] (-1381.035) (-1382.148) -- 0:00:41
783000 -- (-1382.038) [-1378.136] (-1381.022) (-1386.272) * (-1376.451) [-1378.677] (-1387.964) (-1380.660) -- 0:00:41
783500 -- (-1379.561) (-1383.299) (-1376.029) [-1383.270] * (-1382.452) [-1383.379] (-1378.043) (-1388.653) -- 0:00:41
784000 -- (-1377.855) [-1378.180] (-1376.883) (-1380.753) * (-1378.249) (-1384.146) [-1373.238] (-1384.841) -- 0:00:41
784500 -- (-1381.463) (-1383.079) (-1377.807) [-1379.525] * [-1383.833] (-1382.890) (-1377.393) (-1384.140) -- 0:00:41
785000 -- (-1386.520) (-1378.511) (-1385.200) [-1378.892] * (-1386.475) (-1382.719) (-1377.059) [-1376.638] -- 0:00:41
Average standard deviation of split frequencies: 0.002999
785500 -- (-1378.164) [-1380.628] (-1375.013) (-1380.102) * (-1380.367) (-1380.217) (-1380.506) [-1378.491] -- 0:00:40
786000 -- [-1378.024] (-1384.563) (-1378.028) (-1378.500) * [-1381.182] (-1381.915) (-1389.582) (-1380.905) -- 0:00:40
786500 -- [-1378.833] (-1379.154) (-1387.916) (-1378.379) * (-1386.533) [-1386.666] (-1387.287) (-1375.693) -- 0:00:40
787000 -- (-1378.080) [-1375.136] (-1377.629) (-1387.481) * (-1380.603) [-1378.319] (-1381.318) (-1382.935) -- 0:00:40
787500 -- [-1376.021] (-1380.096) (-1379.192) (-1380.629) * [-1379.613] (-1378.826) (-1386.154) (-1380.110) -- 0:00:40
788000 -- (-1380.292) [-1377.688] (-1381.622) (-1377.526) * (-1377.075) (-1377.743) (-1389.081) [-1379.630] -- 0:00:40
788500 -- (-1375.888) (-1375.177) (-1380.299) [-1380.339] * [-1380.241] (-1377.457) (-1384.829) (-1379.350) -- 0:00:40
789000 -- [-1380.979] (-1379.131) (-1376.828) (-1381.005) * (-1377.993) (-1377.542) (-1391.436) [-1376.614] -- 0:00:40
789500 -- (-1376.643) (-1382.772) (-1377.255) [-1376.168] * [-1374.436] (-1375.795) (-1386.352) (-1383.452) -- 0:00:40
790000 -- (-1379.210) [-1375.422] (-1380.374) (-1376.654) * (-1378.335) (-1381.442) (-1379.632) [-1380.516] -- 0:00:40
Average standard deviation of split frequencies: 0.002981
790500 -- (-1381.530) (-1380.474) (-1377.258) [-1375.931] * (-1375.016) (-1377.386) [-1376.236] (-1383.612) -- 0:00:40
791000 -- (-1385.410) (-1379.542) (-1378.831) [-1379.881] * (-1377.208) (-1377.505) [-1377.146] (-1381.470) -- 0:00:39
791500 -- (-1384.818) (-1386.077) (-1385.781) [-1375.628] * (-1383.442) [-1375.512] (-1380.802) (-1378.697) -- 0:00:39
792000 -- (-1385.247) (-1379.538) [-1378.253] (-1386.439) * (-1383.668) [-1375.908] (-1376.648) (-1392.216) -- 0:00:39
792500 -- (-1381.952) (-1384.066) (-1377.494) [-1380.566] * [-1377.858] (-1375.487) (-1385.889) (-1380.624) -- 0:00:39
793000 -- (-1384.867) (-1375.449) [-1375.669] (-1376.851) * [-1379.469] (-1387.768) (-1381.680) (-1379.706) -- 0:00:39
793500 -- [-1384.211] (-1373.157) (-1376.902) (-1382.959) * [-1376.893] (-1377.164) (-1387.230) (-1382.316) -- 0:00:39
794000 -- (-1381.937) (-1377.640) [-1374.190] (-1376.768) * (-1383.994) (-1380.306) (-1382.370) [-1375.584] -- 0:00:39
794500 -- (-1390.972) [-1385.654] (-1379.100) (-1378.949) * (-1378.349) (-1384.350) [-1375.307] (-1384.477) -- 0:00:39
795000 -- [-1379.005] (-1382.844) (-1387.320) (-1380.052) * [-1380.263] (-1378.785) (-1380.238) (-1390.864) -- 0:00:39
Average standard deviation of split frequencies: 0.002961
795500 -- (-1378.448) [-1385.324] (-1380.954) (-1386.851) * (-1380.004) (-1381.804) [-1374.464] (-1389.162) -- 0:00:39
796000 -- (-1381.202) (-1386.652) [-1376.790] (-1379.962) * (-1379.406) (-1379.970) (-1377.647) [-1387.629] -- 0:00:38
796500 -- [-1376.274] (-1388.769) (-1381.168) (-1381.878) * (-1376.645) (-1383.584) (-1379.321) [-1377.215] -- 0:00:38
797000 -- (-1376.916) (-1387.212) (-1377.400) [-1375.015] * [-1379.158] (-1377.793) (-1381.663) (-1377.628) -- 0:00:38
797500 -- [-1381.852] (-1388.530) (-1378.792) (-1383.131) * (-1384.168) (-1377.297) (-1381.012) [-1377.529] -- 0:00:38
798000 -- [-1380.195] (-1390.358) (-1374.124) (-1382.800) * (-1381.304) [-1378.814] (-1382.712) (-1379.374) -- 0:00:38
798500 -- (-1382.785) [-1384.632] (-1376.487) (-1388.957) * (-1379.433) [-1382.108] (-1378.203) (-1376.278) -- 0:00:38
799000 -- (-1379.970) [-1381.946] (-1381.218) (-1379.262) * (-1378.125) (-1382.801) [-1378.346] (-1376.118) -- 0:00:38
799500 -- (-1377.366) (-1376.638) [-1379.007] (-1378.843) * [-1386.942] (-1379.877) (-1380.302) (-1378.269) -- 0:00:38
800000 -- (-1381.787) (-1383.319) [-1376.633] (-1379.901) * (-1384.947) (-1380.384) (-1379.263) [-1378.545] -- 0:00:38
Average standard deviation of split frequencies: 0.002944
800500 -- [-1381.877] (-1379.797) (-1388.076) (-1374.588) * (-1383.984) (-1379.917) (-1380.898) [-1376.499] -- 0:00:38
801000 -- (-1386.796) (-1383.014) (-1388.936) [-1378.008] * (-1378.217) (-1379.718) (-1378.513) [-1380.971] -- 0:00:38
801500 -- (-1380.982) (-1381.781) (-1376.237) [-1378.538] * (-1379.610) (-1377.268) [-1379.645] (-1376.582) -- 0:00:37
802000 -- (-1378.770) [-1379.453] (-1384.142) (-1381.267) * (-1386.300) [-1375.062] (-1384.701) (-1386.090) -- 0:00:37
802500 -- (-1381.261) (-1377.613) [-1379.771] (-1378.804) * (-1376.626) (-1378.809) [-1378.707] (-1386.356) -- 0:00:37
803000 -- [-1376.215] (-1380.794) (-1380.494) (-1376.117) * [-1379.164] (-1378.987) (-1374.205) (-1385.014) -- 0:00:37
803500 -- (-1375.781) (-1375.477) (-1377.940) [-1376.335] * (-1380.876) (-1377.723) (-1378.388) [-1379.468] -- 0:00:37
804000 -- [-1374.132] (-1379.233) (-1380.497) (-1376.249) * (-1384.222) [-1376.693] (-1378.954) (-1373.606) -- 0:00:37
804500 -- [-1375.516] (-1377.877) (-1382.196) (-1379.054) * (-1385.585) (-1378.601) [-1382.811] (-1382.165) -- 0:00:37
805000 -- (-1381.988) (-1391.098) [-1380.292] (-1378.065) * (-1384.203) (-1385.745) [-1378.835] (-1380.223) -- 0:00:37
Average standard deviation of split frequencies: 0.002632
805500 -- (-1377.420) (-1380.255) [-1378.979] (-1380.526) * (-1383.473) (-1381.470) [-1380.283] (-1377.798) -- 0:00:37
806000 -- (-1379.198) [-1379.964] (-1375.349) (-1377.495) * (-1386.311) (-1383.523) (-1378.909) [-1381.625] -- 0:00:37
806500 -- (-1381.761) (-1383.994) [-1379.381] (-1375.993) * (-1380.727) (-1389.485) (-1379.780) [-1376.703] -- 0:00:36
807000 -- [-1376.434] (-1376.876) (-1376.163) (-1381.644) * (-1378.846) (-1381.402) (-1385.207) [-1379.025] -- 0:00:36
807500 -- (-1377.851) (-1377.261) [-1382.185] (-1384.859) * (-1387.444) (-1386.734) [-1385.421] (-1380.270) -- 0:00:36
808000 -- (-1378.851) [-1385.428] (-1379.738) (-1384.061) * (-1382.243) (-1377.967) [-1380.732] (-1377.845) -- 0:00:36
808500 -- (-1378.716) (-1377.759) (-1380.624) [-1374.975] * (-1373.740) (-1377.175) (-1378.983) [-1379.067] -- 0:00:36
809000 -- (-1383.391) (-1379.759) (-1375.265) [-1376.989] * (-1381.379) (-1379.317) (-1385.301) [-1379.849] -- 0:00:36
809500 -- (-1390.555) (-1378.063) (-1375.044) [-1379.692] * (-1387.600) (-1377.883) (-1374.690) [-1379.958] -- 0:00:36
810000 -- [-1378.982] (-1386.259) (-1380.045) (-1378.707) * (-1386.196) [-1375.933] (-1376.928) (-1382.364) -- 0:00:36
Average standard deviation of split frequencies: 0.002617
810500 -- (-1374.484) (-1381.350) (-1380.417) [-1377.698] * [-1379.059] (-1377.888) (-1380.684) (-1382.650) -- 0:00:36
811000 -- (-1377.751) (-1382.690) (-1379.415) [-1376.756] * (-1378.734) [-1374.418] (-1381.756) (-1377.549) -- 0:00:36
811500 -- (-1382.069) (-1375.903) [-1377.217] (-1387.424) * (-1382.749) [-1381.422] (-1380.154) (-1375.920) -- 0:00:36
812000 -- (-1381.400) [-1376.318] (-1377.847) (-1385.982) * (-1375.432) (-1377.644) (-1374.968) [-1382.412] -- 0:00:35
812500 -- (-1381.653) (-1389.493) [-1378.044] (-1383.770) * [-1373.400] (-1381.610) (-1379.592) (-1376.914) -- 0:00:35
813000 -- (-1379.081) (-1385.587) [-1375.469] (-1379.261) * (-1376.084) (-1382.003) [-1373.995] (-1376.885) -- 0:00:35
813500 -- (-1380.131) (-1379.129) [-1380.184] (-1378.124) * [-1378.646] (-1380.208) (-1376.710) (-1376.668) -- 0:00:35
814000 -- (-1387.482) (-1382.023) [-1380.542] (-1379.903) * [-1378.742] (-1386.352) (-1376.046) (-1377.957) -- 0:00:35
814500 -- [-1376.954] (-1382.159) (-1380.180) (-1377.786) * (-1385.308) (-1383.048) [-1381.556] (-1376.464) -- 0:00:35
815000 -- (-1377.186) (-1376.539) [-1381.512] (-1382.351) * (-1379.724) (-1379.970) (-1383.677) [-1377.888] -- 0:00:35
Average standard deviation of split frequencies: 0.002600
815500 -- (-1376.406) [-1376.139] (-1381.199) (-1379.000) * (-1384.787) (-1381.115) [-1377.195] (-1375.484) -- 0:00:35
816000 -- (-1378.506) [-1380.690] (-1381.316) (-1380.369) * (-1379.439) (-1377.348) (-1376.989) [-1376.052] -- 0:00:35
816500 -- (-1382.137) (-1385.323) [-1374.021] (-1376.380) * (-1378.062) [-1379.196] (-1375.257) (-1385.483) -- 0:00:35
817000 -- (-1375.107) (-1382.330) [-1374.109] (-1379.489) * (-1377.585) [-1377.816] (-1377.879) (-1377.802) -- 0:00:34
817500 -- (-1375.495) [-1378.219] (-1377.298) (-1377.069) * (-1377.015) (-1381.365) (-1376.988) [-1382.721] -- 0:00:34
818000 -- (-1379.759) [-1380.697] (-1376.592) (-1385.266) * (-1381.744) (-1382.965) (-1382.990) [-1378.189] -- 0:00:34
818500 -- (-1380.172) [-1378.270] (-1377.346) (-1385.780) * (-1386.351) (-1384.749) [-1376.928] (-1378.657) -- 0:00:34
819000 -- (-1380.056) [-1377.791] (-1378.080) (-1379.120) * (-1374.581) (-1382.961) [-1381.183] (-1381.604) -- 0:00:34
819500 -- (-1378.035) (-1377.393) (-1375.895) [-1379.571] * (-1376.800) (-1377.587) [-1383.963] (-1379.746) -- 0:00:34
820000 -- [-1376.805] (-1385.171) (-1378.535) (-1382.181) * [-1378.326] (-1383.055) (-1374.709) (-1380.443) -- 0:00:34
Average standard deviation of split frequencies: 0.002585
820500 -- (-1377.472) (-1381.276) (-1383.084) [-1378.038] * [-1375.461] (-1382.200) (-1377.802) (-1384.221) -- 0:00:34
821000 -- (-1391.883) [-1373.195] (-1378.342) (-1382.295) * (-1379.135) [-1376.692] (-1380.598) (-1378.822) -- 0:00:34
821500 -- (-1384.160) (-1377.813) [-1375.164] (-1381.474) * [-1379.142] (-1377.418) (-1385.042) (-1379.740) -- 0:00:34
822000 -- [-1379.975] (-1384.990) (-1378.799) (-1386.196) * (-1378.872) (-1378.352) (-1379.278) [-1377.606] -- 0:00:33
822500 -- (-1378.832) (-1383.571) (-1379.270) [-1380.364] * (-1383.288) (-1380.489) [-1377.983] (-1374.504) -- 0:00:33
823000 -- [-1383.371] (-1381.019) (-1375.855) (-1379.420) * (-1379.187) (-1378.778) [-1377.192] (-1384.170) -- 0:00:33
823500 -- (-1383.443) (-1380.624) [-1376.266] (-1377.367) * (-1384.723) (-1381.441) [-1377.581] (-1375.782) -- 0:00:33
824000 -- [-1380.511] (-1376.976) (-1375.418) (-1381.968) * (-1377.677) [-1378.774] (-1378.818) (-1379.542) -- 0:00:33
824500 -- [-1378.331] (-1380.821) (-1381.742) (-1379.928) * (-1382.966) (-1378.713) (-1376.441) [-1377.958] -- 0:00:33
825000 -- (-1382.607) [-1376.286] (-1378.114) (-1376.663) * (-1379.048) [-1379.199] (-1384.781) (-1381.349) -- 0:00:33
Average standard deviation of split frequencies: 0.002568
825500 -- (-1383.170) [-1375.776] (-1378.260) (-1380.431) * (-1379.540) (-1377.744) [-1380.259] (-1381.201) -- 0:00:33
826000 -- (-1383.036) (-1378.930) (-1376.518) [-1384.241] * (-1381.732) (-1377.160) (-1387.951) [-1377.553] -- 0:00:33
826500 -- [-1389.859] (-1381.350) (-1375.193) (-1376.078) * (-1375.688) [-1374.528] (-1383.511) (-1384.812) -- 0:00:33
827000 -- (-1387.351) [-1374.842] (-1375.392) (-1379.003) * [-1383.021] (-1378.235) (-1378.761) (-1378.250) -- 0:00:33
827500 -- (-1377.288) (-1381.732) (-1382.751) [-1374.487] * [-1381.294] (-1380.181) (-1380.396) (-1386.426) -- 0:00:32
828000 -- (-1380.077) (-1375.331) (-1377.238) [-1375.398] * (-1380.328) (-1379.421) [-1376.680] (-1376.550) -- 0:00:32
828500 -- (-1380.582) [-1376.566] (-1379.180) (-1375.755) * [-1388.064] (-1375.997) (-1382.776) (-1379.046) -- 0:00:32
829000 -- (-1386.985) (-1373.792) [-1378.585] (-1376.515) * (-1381.553) (-1384.682) (-1384.937) [-1378.202] -- 0:00:32
829500 -- (-1379.009) (-1380.954) [-1378.403] (-1377.190) * (-1379.766) (-1384.499) [-1375.593] (-1375.755) -- 0:00:32
830000 -- (-1380.587) [-1377.430] (-1381.370) (-1379.068) * (-1383.326) (-1377.857) [-1377.332] (-1378.014) -- 0:00:32
Average standard deviation of split frequencies: 0.002554
830500 -- (-1384.103) [-1378.376] (-1381.661) (-1375.608) * (-1387.544) [-1377.722] (-1379.174) (-1379.639) -- 0:00:32
831000 -- (-1382.836) (-1381.151) [-1382.503] (-1379.104) * (-1382.968) (-1381.962) [-1378.314] (-1379.076) -- 0:00:32
831500 -- (-1382.108) (-1380.982) (-1379.893) [-1383.823] * (-1378.153) (-1384.021) (-1379.457) [-1385.877] -- 0:00:32
832000 -- (-1378.133) (-1376.720) (-1379.739) [-1378.050] * (-1379.612) (-1375.568) (-1380.607) [-1380.125] -- 0:00:32
832500 -- (-1383.109) (-1378.077) (-1387.294) [-1381.506] * [-1379.553] (-1380.098) (-1384.090) (-1378.998) -- 0:00:31
833000 -- (-1384.999) (-1377.362) [-1385.340] (-1386.773) * (-1382.450) (-1382.839) [-1382.956] (-1382.850) -- 0:00:31
833500 -- (-1386.020) [-1376.486] (-1391.600) (-1379.975) * (-1381.319) (-1380.900) (-1376.977) [-1380.430] -- 0:00:31
834000 -- (-1387.104) [-1379.719] (-1379.908) (-1380.528) * (-1375.541) (-1378.251) [-1376.679] (-1375.559) -- 0:00:31
834500 -- (-1381.685) (-1375.914) (-1380.374) [-1382.288] * (-1381.101) (-1381.326) (-1376.852) [-1377.763] -- 0:00:31
835000 -- (-1377.037) (-1388.461) [-1378.311] (-1381.270) * (-1384.410) [-1378.196] (-1377.832) (-1375.736) -- 0:00:31
Average standard deviation of split frequencies: 0.002537
835500 -- [-1379.906] (-1375.973) (-1383.360) (-1384.206) * (-1376.825) [-1380.404] (-1380.342) (-1383.990) -- 0:00:31
836000 -- (-1378.615) [-1383.220] (-1376.345) (-1376.607) * (-1378.117) (-1378.860) [-1386.176] (-1388.581) -- 0:00:31
836500 -- (-1385.435) [-1376.183] (-1383.037) (-1386.245) * [-1381.210] (-1378.916) (-1389.303) (-1385.681) -- 0:00:31
837000 -- (-1385.735) [-1378.432] (-1377.181) (-1383.254) * [-1380.492] (-1377.687) (-1382.241) (-1382.363) -- 0:00:31
837500 -- (-1383.089) [-1380.374] (-1380.843) (-1379.366) * (-1378.322) [-1375.642] (-1391.376) (-1394.431) -- 0:00:31
838000 -- (-1379.356) [-1380.472] (-1379.650) (-1378.400) * [-1377.504] (-1377.802) (-1385.965) (-1389.394) -- 0:00:30
838500 -- (-1380.391) (-1382.621) [-1379.827] (-1382.967) * (-1383.006) [-1373.456] (-1388.719) (-1380.429) -- 0:00:30
839000 -- (-1382.591) (-1379.499) (-1385.068) [-1377.788] * [-1377.235] (-1374.344) (-1376.636) (-1375.693) -- 0:00:30
839500 -- (-1380.021) [-1379.027] (-1378.633) (-1379.290) * [-1377.672] (-1383.247) (-1382.557) (-1377.056) -- 0:00:30
840000 -- (-1379.461) (-1376.547) [-1379.991] (-1381.886) * (-1380.746) (-1377.072) (-1377.008) [-1385.604] -- 0:00:30
Average standard deviation of split frequencies: 0.002523
840500 -- [-1378.870] (-1375.758) (-1381.551) (-1380.663) * (-1381.112) (-1378.872) (-1381.375) [-1381.304] -- 0:00:30
841000 -- (-1383.874) [-1375.694] (-1387.746) (-1378.344) * [-1377.144] (-1377.044) (-1375.911) (-1379.818) -- 0:00:30
841500 -- (-1382.663) [-1373.622] (-1381.749) (-1376.647) * [-1375.151] (-1378.251) (-1379.203) (-1375.717) -- 0:00:30
842000 -- (-1386.731) (-1377.914) (-1383.169) [-1381.999] * (-1377.485) (-1379.489) (-1375.610) [-1373.043] -- 0:00:30
842500 -- (-1382.666) (-1379.409) (-1380.708) [-1379.980] * (-1379.923) (-1376.527) (-1376.422) [-1373.950] -- 0:00:30
843000 -- (-1382.514) [-1376.445] (-1377.356) (-1389.091) * (-1382.631) [-1377.800] (-1380.071) (-1382.014) -- 0:00:29
843500 -- (-1379.639) (-1377.241) [-1379.265] (-1382.062) * (-1374.379) (-1384.237) (-1380.708) [-1379.726] -- 0:00:29
844000 -- (-1379.216) (-1382.966) [-1377.575] (-1380.940) * (-1381.163) (-1380.562) (-1381.771) [-1377.357] -- 0:00:29
844500 -- [-1378.906] (-1381.062) (-1385.691) (-1376.861) * [-1381.448] (-1379.135) (-1377.974) (-1382.860) -- 0:00:29
845000 -- (-1388.355) (-1385.726) [-1378.640] (-1376.326) * (-1383.209) [-1376.864] (-1375.630) (-1386.002) -- 0:00:29
Average standard deviation of split frequencies: 0.002229
845500 -- (-1390.235) (-1382.682) [-1375.161] (-1380.013) * (-1377.579) [-1380.225] (-1377.599) (-1376.367) -- 0:00:29
846000 -- (-1380.900) (-1381.132) (-1377.480) [-1379.525] * (-1378.347) (-1382.276) (-1378.652) [-1377.630] -- 0:00:29
846500 -- (-1378.885) (-1382.361) [-1377.170] (-1384.141) * (-1378.789) [-1381.928] (-1382.058) (-1375.323) -- 0:00:29
847000 -- (-1379.587) (-1378.649) [-1385.886] (-1376.665) * (-1378.313) (-1383.782) [-1381.659] (-1373.968) -- 0:00:29
847500 -- (-1378.380) [-1378.088] (-1386.676) (-1378.233) * (-1377.525) (-1377.888) [-1388.043] (-1375.395) -- 0:00:29
848000 -- (-1382.083) (-1379.316) (-1373.198) [-1378.090] * (-1377.138) [-1377.529] (-1378.398) (-1383.840) -- 0:00:29
848500 -- (-1381.009) [-1378.844] (-1382.046) (-1377.379) * (-1378.770) (-1383.870) (-1383.974) [-1374.752] -- 0:00:28
849000 -- (-1385.796) [-1379.645] (-1377.737) (-1384.871) * (-1379.033) [-1374.932] (-1383.159) (-1379.538) -- 0:00:28
849500 -- (-1382.920) [-1381.166] (-1376.472) (-1376.471) * (-1375.800) [-1375.071] (-1380.787) (-1376.799) -- 0:00:28
850000 -- (-1381.942) (-1383.486) (-1380.155) [-1374.598] * (-1387.094) [-1377.240] (-1385.202) (-1376.458) -- 0:00:28
Average standard deviation of split frequencies: 0.002217
850500 -- (-1379.897) (-1378.289) [-1380.626] (-1379.385) * (-1379.252) (-1378.724) (-1380.050) [-1379.958] -- 0:00:28
851000 -- (-1383.034) [-1378.130] (-1380.510) (-1377.971) * (-1383.738) [-1380.352] (-1380.811) (-1381.146) -- 0:00:28
851500 -- (-1385.117) [-1375.250] (-1383.193) (-1382.373) * (-1382.979) (-1380.075) [-1378.677] (-1377.557) -- 0:00:28
852000 -- (-1381.267) [-1376.190] (-1377.725) (-1383.590) * [-1378.017] (-1380.762) (-1375.703) (-1380.542) -- 0:00:28
852500 -- (-1381.362) (-1378.150) (-1375.675) [-1382.511] * [-1377.506] (-1379.836) (-1382.392) (-1377.794) -- 0:00:28
853000 -- [-1383.310] (-1383.232) (-1378.783) (-1387.991) * (-1379.700) (-1386.299) [-1381.292] (-1378.805) -- 0:00:28
853500 -- (-1377.230) (-1378.081) [-1380.857] (-1379.852) * [-1382.172] (-1385.346) (-1375.115) (-1379.143) -- 0:00:27
854000 -- [-1373.964] (-1380.005) (-1376.953) (-1389.800) * (-1379.255) (-1376.715) [-1374.711] (-1379.093) -- 0:00:27
854500 -- [-1378.270] (-1379.367) (-1377.902) (-1391.116) * (-1378.979) (-1385.663) [-1379.043] (-1377.164) -- 0:00:27
855000 -- (-1382.711) (-1379.937) [-1380.872] (-1377.689) * (-1379.673) (-1384.225) [-1383.306] (-1376.174) -- 0:00:27
Average standard deviation of split frequencies: 0.002203
855500 -- [-1378.467] (-1381.275) (-1383.969) (-1382.775) * (-1379.311) (-1379.732) (-1378.123) [-1379.938] -- 0:00:27
856000 -- (-1378.693) [-1384.337] (-1382.357) (-1377.007) * (-1381.687) (-1382.772) [-1376.516] (-1380.886) -- 0:00:27
856500 -- (-1376.441) (-1388.862) [-1382.592] (-1379.456) * (-1385.005) [-1384.343] (-1387.377) (-1378.611) -- 0:00:27
857000 -- (-1375.143) (-1386.445) [-1375.575] (-1386.903) * (-1385.610) [-1380.573] (-1376.689) (-1377.002) -- 0:00:27
857500 -- (-1374.705) (-1383.593) (-1380.304) [-1378.741] * (-1378.894) (-1377.287) [-1381.043] (-1379.750) -- 0:00:27
858000 -- (-1374.112) (-1381.438) [-1382.900] (-1386.963) * (-1378.961) (-1377.829) (-1381.942) [-1378.049] -- 0:00:27
858500 -- (-1378.783) [-1384.473] (-1381.030) (-1384.190) * (-1383.395) [-1377.639] (-1382.553) (-1388.338) -- 0:00:27
859000 -- [-1381.404] (-1378.491) (-1380.559) (-1383.861) * (-1383.413) (-1383.291) [-1375.889] (-1377.448) -- 0:00:26
859500 -- [-1376.611] (-1380.888) (-1379.666) (-1377.724) * (-1390.447) (-1379.185) (-1385.666) [-1380.727] -- 0:00:26
860000 -- [-1376.896] (-1379.379) (-1386.110) (-1381.366) * (-1383.655) (-1374.792) (-1380.295) [-1379.956] -- 0:00:26
Average standard deviation of split frequencies: 0.002191
860500 -- (-1379.542) [-1381.207] (-1380.453) (-1383.685) * [-1380.595] (-1382.799) (-1381.901) (-1378.388) -- 0:00:26
861000 -- (-1380.819) (-1379.265) [-1384.365] (-1387.094) * (-1381.471) (-1382.627) [-1374.552] (-1377.534) -- 0:00:26
861500 -- (-1380.156) [-1381.398] (-1378.078) (-1383.126) * (-1381.732) (-1385.666) (-1378.934) [-1381.412] -- 0:00:26
862000 -- (-1376.288) (-1377.436) [-1380.696] (-1381.619) * (-1383.634) (-1381.751) (-1380.117) [-1379.071] -- 0:00:26
862500 -- (-1379.333) (-1381.276) (-1379.526) [-1377.888] * [-1378.760] (-1384.901) (-1376.461) (-1380.474) -- 0:00:26
863000 -- (-1383.151) (-1378.325) [-1382.509] (-1379.653) * (-1383.839) [-1380.278] (-1380.620) (-1393.658) -- 0:00:26
863500 -- (-1381.185) (-1376.680) (-1384.546) [-1378.605] * (-1379.849) (-1384.846) [-1374.598] (-1381.728) -- 0:00:26
864000 -- (-1380.043) [-1376.679] (-1386.584) (-1382.231) * (-1381.458) (-1383.243) [-1378.335] (-1385.031) -- 0:00:25
864500 -- (-1380.072) (-1383.202) [-1383.664] (-1377.097) * (-1378.151) (-1384.325) (-1376.655) [-1373.380] -- 0:00:25
865000 -- (-1378.562) [-1381.038] (-1380.861) (-1390.358) * (-1377.904) [-1379.927] (-1381.482) (-1379.866) -- 0:00:25
Average standard deviation of split frequencies: 0.002177
865500 -- (-1378.748) (-1378.721) [-1380.763] (-1382.716) * (-1380.610) (-1378.260) [-1383.010] (-1379.435) -- 0:00:25
866000 -- [-1377.966] (-1374.939) (-1383.384) (-1378.717) * (-1379.064) (-1377.757) [-1383.666] (-1387.097) -- 0:00:25
866500 -- (-1379.934) (-1379.057) (-1381.317) [-1376.818] * (-1378.930) (-1378.876) (-1385.220) [-1382.924] -- 0:00:25
867000 -- [-1374.059] (-1383.888) (-1383.666) (-1382.382) * (-1384.720) [-1375.717] (-1382.358) (-1382.292) -- 0:00:25
867500 -- [-1375.469] (-1384.824) (-1388.008) (-1375.219) * (-1378.250) (-1377.601) [-1377.830] (-1384.310) -- 0:00:25
868000 -- (-1379.266) (-1381.829) [-1379.524] (-1379.154) * (-1378.260) [-1376.713] (-1375.961) (-1381.542) -- 0:00:25
868500 -- (-1380.102) [-1379.611] (-1386.009) (-1380.802) * (-1382.679) (-1381.437) [-1375.165] (-1385.131) -- 0:00:25
869000 -- (-1382.403) (-1379.831) (-1383.758) [-1379.045] * (-1380.060) (-1378.333) (-1382.520) [-1373.951] -- 0:00:25
869500 -- (-1388.888) (-1377.640) [-1383.282] (-1380.116) * (-1375.764) [-1380.829] (-1374.946) (-1383.286) -- 0:00:24
870000 -- (-1377.956) (-1377.238) (-1380.555) [-1377.608] * (-1381.140) [-1381.450] (-1380.848) (-1377.177) -- 0:00:24
Average standard deviation of split frequencies: 0.001895
870500 -- (-1379.445) (-1379.516) (-1378.724) [-1376.707] * (-1381.628) (-1379.452) [-1380.509] (-1379.280) -- 0:00:24
871000 -- [-1382.315] (-1380.535) (-1380.562) (-1379.200) * (-1376.933) (-1379.990) (-1387.594) [-1376.623] -- 0:00:24
871500 -- [-1376.813] (-1375.303) (-1374.457) (-1379.528) * (-1375.073) (-1382.754) [-1379.425] (-1377.888) -- 0:00:24
872000 -- (-1381.498) [-1380.648] (-1382.171) (-1379.971) * (-1382.308) [-1381.703] (-1382.349) (-1383.805) -- 0:00:24
872500 -- (-1382.773) [-1376.489] (-1379.222) (-1377.212) * [-1377.799] (-1380.130) (-1388.975) (-1383.313) -- 0:00:24
873000 -- (-1380.808) (-1381.273) (-1390.967) [-1379.223] * (-1382.103) (-1380.631) (-1386.861) [-1375.434] -- 0:00:24
873500 -- [-1377.079] (-1378.404) (-1383.753) (-1377.309) * (-1384.420) (-1382.524) [-1381.704] (-1383.866) -- 0:00:24
874000 -- (-1380.323) (-1377.212) [-1376.701] (-1382.330) * (-1376.990) [-1379.829] (-1379.625) (-1377.042) -- 0:00:24
874500 -- [-1380.865] (-1379.238) (-1382.992) (-1382.625) * (-1380.309) [-1379.999] (-1380.990) (-1379.018) -- 0:00:23
875000 -- (-1379.725) (-1379.428) [-1375.726] (-1381.739) * (-1380.577) [-1379.680] (-1384.580) (-1381.274) -- 0:00:23
Average standard deviation of split frequencies: 0.001883
875500 -- (-1378.212) (-1376.905) [-1375.829] (-1379.862) * (-1379.583) (-1385.203) (-1383.533) [-1377.950] -- 0:00:23
876000 -- (-1379.297) (-1379.319) (-1376.316) [-1374.884] * (-1374.478) (-1385.770) [-1379.727] (-1380.353) -- 0:00:23
876500 -- (-1377.199) (-1381.508) [-1375.287] (-1376.074) * (-1380.025) (-1386.960) [-1380.150] (-1379.702) -- 0:00:23
877000 -- (-1378.058) [-1382.388] (-1384.178) (-1374.973) * (-1384.026) [-1380.960] (-1385.717) (-1381.787) -- 0:00:23
877500 -- [-1376.386] (-1378.963) (-1378.769) (-1377.019) * (-1376.337) (-1381.568) (-1384.019) [-1375.125] -- 0:00:23
878000 -- (-1386.319) (-1381.363) (-1378.832) [-1377.785] * [-1378.004] (-1377.155) (-1377.739) (-1376.799) -- 0:00:23
878500 -- [-1378.218] (-1379.452) (-1380.072) (-1376.424) * (-1383.572) [-1378.507] (-1381.611) (-1375.499) -- 0:00:23
879000 -- (-1379.122) (-1380.714) (-1378.652) [-1377.903] * (-1381.885) (-1376.625) [-1380.629] (-1381.296) -- 0:00:23
879500 -- (-1377.829) (-1377.263) (-1379.971) [-1374.027] * (-1386.536) (-1377.618) (-1380.970) [-1377.681] -- 0:00:23
880000 -- (-1383.912) [-1376.466] (-1377.245) (-1386.596) * (-1381.714) [-1375.866] (-1379.885) (-1376.074) -- 0:00:22
Average standard deviation of split frequencies: 0.001873
880500 -- (-1379.474) (-1377.240) [-1381.934] (-1375.804) * (-1381.195) [-1375.427] (-1387.358) (-1387.199) -- 0:00:22
881000 -- (-1384.672) (-1388.306) (-1378.574) [-1381.273] * (-1376.765) [-1374.779] (-1379.750) (-1384.735) -- 0:00:22
881500 -- (-1383.435) (-1379.744) [-1380.628] (-1379.152) * [-1373.812] (-1379.842) (-1387.725) (-1384.122) -- 0:00:22
882000 -- (-1379.068) (-1381.587) [-1381.253] (-1374.603) * (-1378.876) [-1378.288] (-1389.826) (-1383.725) -- 0:00:22
882500 -- (-1383.305) (-1385.558) (-1378.601) [-1376.530] * (-1376.168) [-1378.581] (-1385.396) (-1383.274) -- 0:00:22
883000 -- (-1382.122) (-1381.682) (-1383.495) [-1377.937] * (-1381.371) [-1377.389] (-1383.947) (-1384.398) -- 0:00:22
883500 -- (-1386.762) [-1378.941] (-1378.231) (-1382.656) * [-1379.102] (-1377.414) (-1385.140) (-1386.170) -- 0:00:22
884000 -- (-1380.824) (-1384.880) [-1380.723] (-1376.469) * [-1379.567] (-1379.761) (-1387.713) (-1386.349) -- 0:00:22
884500 -- (-1383.702) (-1379.446) [-1377.411] (-1378.524) * [-1381.846] (-1378.237) (-1381.907) (-1381.210) -- 0:00:22
885000 -- [-1376.019] (-1379.109) (-1383.203) (-1375.722) * (-1375.452) (-1382.844) (-1380.022) [-1381.478] -- 0:00:21
Average standard deviation of split frequencies: 0.001862
885500 -- (-1380.055) (-1377.706) (-1376.154) [-1373.952] * (-1375.486) (-1377.564) [-1374.028] (-1383.458) -- 0:00:21
886000 -- [-1381.518] (-1384.008) (-1382.951) (-1383.966) * [-1377.407] (-1381.291) (-1383.593) (-1383.855) -- 0:00:21
886500 -- (-1378.511) [-1375.286] (-1379.523) (-1384.731) * [-1380.357] (-1378.860) (-1380.043) (-1386.691) -- 0:00:21
887000 -- [-1375.510] (-1382.425) (-1380.730) (-1386.100) * [-1376.274] (-1380.843) (-1381.130) (-1380.577) -- 0:00:21
887500 -- (-1373.583) (-1377.957) [-1379.377] (-1383.829) * (-1381.787) [-1377.777] (-1375.470) (-1384.424) -- 0:00:21
888000 -- [-1377.911] (-1381.606) (-1387.297) (-1379.363) * (-1380.979) (-1377.965) [-1376.819] (-1380.680) -- 0:00:21
888500 -- [-1379.319] (-1381.880) (-1379.649) (-1382.715) * (-1378.199) [-1383.203] (-1381.979) (-1385.236) -- 0:00:21
889000 -- [-1377.782] (-1388.965) (-1380.781) (-1379.562) * (-1375.349) [-1383.475] (-1383.944) (-1384.148) -- 0:00:21
889500 -- (-1377.949) [-1379.744] (-1379.781) (-1380.333) * (-1379.901) (-1379.001) [-1383.887] (-1379.054) -- 0:00:21
890000 -- [-1378.525] (-1378.308) (-1379.854) (-1383.068) * [-1383.000] (-1380.964) (-1378.854) (-1382.401) -- 0:00:21
Average standard deviation of split frequencies: 0.001852
890500 -- (-1378.167) [-1377.947] (-1380.717) (-1384.226) * [-1375.900] (-1376.980) (-1380.198) (-1389.370) -- 0:00:20
891000 -- (-1378.419) (-1377.592) (-1385.898) [-1377.768] * (-1385.756) [-1378.480] (-1382.698) (-1377.760) -- 0:00:20
891500 -- (-1387.121) (-1384.543) (-1379.458) [-1379.903] * [-1380.948] (-1377.702) (-1381.052) (-1376.939) -- 0:00:20
892000 -- (-1375.938) (-1384.631) (-1381.149) [-1376.904] * (-1385.859) (-1382.928) (-1383.938) [-1380.249] -- 0:00:20
892500 -- (-1382.286) (-1381.716) (-1380.607) [-1375.351] * (-1381.595) [-1380.528] (-1379.319) (-1383.360) -- 0:00:20
893000 -- (-1382.946) (-1375.555) [-1382.781] (-1377.113) * (-1389.093) (-1382.946) [-1377.538] (-1387.798) -- 0:00:20
893500 -- (-1389.366) (-1377.992) (-1382.618) [-1376.389] * [-1379.655] (-1387.021) (-1377.670) (-1385.261) -- 0:00:20
894000 -- (-1391.906) [-1380.919] (-1379.560) (-1384.726) * [-1382.188] (-1387.027) (-1375.476) (-1386.578) -- 0:00:20
894500 -- (-1381.662) (-1383.200) [-1377.423] (-1387.728) * [-1381.037] (-1383.140) (-1377.566) (-1381.740) -- 0:00:20
895000 -- [-1384.828] (-1379.667) (-1377.212) (-1386.441) * (-1380.595) (-1380.024) [-1377.089] (-1383.277) -- 0:00:20
Average standard deviation of split frequencies: 0.001841
895500 -- (-1385.739) [-1372.909] (-1381.458) (-1393.011) * (-1383.407) [-1378.618] (-1380.904) (-1381.000) -- 0:00:19
896000 -- (-1377.651) [-1381.721] (-1382.452) (-1381.390) * (-1377.405) [-1382.529] (-1377.152) (-1381.071) -- 0:00:19
896500 -- (-1386.303) (-1382.065) (-1378.438) [-1379.950] * [-1383.384] (-1385.918) (-1382.756) (-1384.216) -- 0:00:19
897000 -- (-1376.337) (-1382.424) [-1374.879] (-1381.270) * (-1378.524) (-1379.194) [-1381.389] (-1385.960) -- 0:00:19
897500 -- (-1379.336) [-1377.715] (-1379.251) (-1378.402) * (-1381.089) (-1384.502) [-1380.190] (-1386.639) -- 0:00:19
898000 -- (-1377.852) (-1380.823) [-1375.308] (-1385.761) * [-1377.986] (-1381.463) (-1381.801) (-1377.593) -- 0:00:19
898500 -- [-1379.659] (-1382.406) (-1374.915) (-1384.101) * (-1379.520) [-1380.758] (-1380.517) (-1382.403) -- 0:00:19
899000 -- (-1378.582) (-1379.277) [-1376.219] (-1382.756) * (-1379.888) [-1378.144] (-1379.574) (-1379.806) -- 0:00:19
899500 -- [-1380.447] (-1383.995) (-1377.704) (-1379.643) * [-1373.943] (-1379.858) (-1380.284) (-1378.353) -- 0:00:19
900000 -- [-1384.417] (-1383.058) (-1384.335) (-1376.236) * (-1376.304) (-1379.313) (-1383.223) [-1380.713] -- 0:00:19
Average standard deviation of split frequencies: 0.001832
900500 -- (-1380.473) (-1380.895) (-1381.671) [-1377.219] * (-1382.383) (-1383.094) (-1377.000) [-1377.332] -- 0:00:19
901000 -- [-1376.338] (-1377.493) (-1379.523) (-1381.756) * (-1387.313) [-1379.566] (-1381.205) (-1380.146) -- 0:00:18
901500 -- [-1374.165] (-1389.285) (-1381.520) (-1380.340) * (-1379.212) (-1379.622) (-1382.955) [-1385.960] -- 0:00:18
902000 -- [-1377.331] (-1380.896) (-1381.219) (-1385.023) * (-1381.606) (-1380.183) (-1380.677) [-1377.459] -- 0:00:18
902500 -- (-1380.477) (-1380.317) [-1385.146] (-1376.828) * [-1377.450] (-1379.004) (-1388.831) (-1379.688) -- 0:00:18
903000 -- (-1378.356) (-1378.231) (-1378.097) [-1376.098] * (-1379.844) (-1383.696) [-1380.779] (-1378.306) -- 0:00:18
903500 -- (-1381.043) (-1379.046) (-1382.409) [-1375.658] * [-1377.628] (-1382.621) (-1381.375) (-1378.587) -- 0:00:18
904000 -- (-1385.160) (-1377.053) (-1375.990) [-1381.340] * (-1380.888) [-1376.714] (-1376.321) (-1378.197) -- 0:00:18
904500 -- (-1385.714) [-1377.753] (-1381.506) (-1379.848) * (-1382.869) [-1378.027] (-1381.121) (-1376.702) -- 0:00:18
905000 -- (-1378.543) (-1382.149) [-1381.673] (-1384.193) * [-1379.525] (-1376.155) (-1385.219) (-1379.706) -- 0:00:18
Average standard deviation of split frequencies: 0.001821
905500 -- (-1382.829) [-1378.813] (-1381.452) (-1381.598) * [-1378.102] (-1380.825) (-1385.544) (-1376.885) -- 0:00:18
906000 -- (-1378.811) [-1375.456] (-1381.727) (-1382.367) * (-1381.874) (-1376.934) (-1380.702) [-1378.338] -- 0:00:17
906500 -- (-1382.684) (-1383.925) (-1382.786) [-1382.051] * [-1377.388] (-1383.005) (-1382.553) (-1377.503) -- 0:00:17
907000 -- (-1376.861) (-1385.436) [-1382.580] (-1376.971) * [-1374.605] (-1385.643) (-1384.962) (-1381.195) -- 0:00:17
907500 -- (-1379.647) (-1375.716) [-1381.857] (-1389.068) * (-1377.262) (-1380.715) (-1385.344) [-1378.174] -- 0:00:17
908000 -- (-1386.218) (-1387.840) (-1378.511) [-1377.923] * (-1379.087) (-1379.553) (-1380.168) [-1383.822] -- 0:00:17
908500 -- (-1381.010) [-1384.494] (-1386.238) (-1390.519) * (-1379.384) [-1381.382] (-1380.371) (-1378.861) -- 0:00:17
909000 -- [-1380.463] (-1380.457) (-1381.343) (-1386.708) * (-1382.549) (-1383.819) [-1378.001] (-1378.586) -- 0:00:17
909500 -- (-1378.368) (-1383.403) [-1376.402] (-1383.088) * (-1389.941) (-1380.300) (-1382.581) [-1376.491] -- 0:00:17
910000 -- (-1378.359) (-1383.928) (-1380.990) [-1376.316] * (-1376.952) (-1377.853) (-1384.822) [-1376.748] -- 0:00:17
Average standard deviation of split frequencies: 0.002071
910500 -- (-1386.951) (-1383.666) [-1377.039] (-1385.203) * (-1383.797) [-1380.475] (-1380.582) (-1382.564) -- 0:00:17
911000 -- (-1381.682) (-1383.379) (-1384.214) [-1378.217] * (-1384.440) (-1377.637) (-1377.237) [-1378.861] -- 0:00:16
911500 -- (-1377.883) (-1378.457) [-1380.078] (-1380.596) * (-1377.272) (-1377.658) (-1379.983) [-1380.712] -- 0:00:16
912000 -- (-1383.247) [-1378.305] (-1380.621) (-1384.357) * [-1383.665] (-1379.655) (-1380.198) (-1380.031) -- 0:00:16
912500 -- (-1382.767) (-1377.734) [-1377.321] (-1381.581) * [-1379.472] (-1382.214) (-1378.945) (-1375.206) -- 0:00:16
913000 -- (-1382.146) [-1376.866] (-1377.708) (-1383.471) * (-1378.592) (-1387.332) (-1376.863) [-1380.375] -- 0:00:16
913500 -- (-1384.053) (-1381.107) (-1383.603) [-1382.799] * (-1378.586) (-1377.946) (-1375.178) [-1376.824] -- 0:00:16
914000 -- (-1389.446) [-1377.121] (-1376.557) (-1386.146) * (-1375.987) (-1378.922) (-1380.438) [-1378.383] -- 0:00:16
914500 -- (-1381.354) (-1379.940) [-1377.000] (-1377.108) * (-1383.192) [-1375.966] (-1380.406) (-1377.011) -- 0:00:16
915000 -- (-1378.213) (-1378.142) [-1379.978] (-1379.076) * [-1375.557] (-1377.114) (-1383.506) (-1377.942) -- 0:00:16
Average standard deviation of split frequencies: 0.002059
915500 -- (-1381.940) (-1384.870) [-1381.223] (-1384.443) * [-1380.152] (-1377.490) (-1383.667) (-1379.094) -- 0:00:16
916000 -- (-1377.578) (-1383.351) (-1380.395) [-1375.745] * (-1378.695) [-1375.581] (-1377.943) (-1378.410) -- 0:00:16
916500 -- (-1382.114) (-1374.501) [-1377.147] (-1376.169) * (-1381.366) [-1383.371] (-1374.343) (-1386.116) -- 0:00:15
917000 -- (-1385.620) [-1379.147] (-1378.115) (-1375.932) * [-1375.871] (-1375.078) (-1379.862) (-1379.426) -- 0:00:15
917500 -- [-1382.819] (-1379.052) (-1382.838) (-1374.063) * (-1383.213) (-1382.477) (-1377.684) [-1377.381] -- 0:00:15
918000 -- (-1377.498) (-1383.014) [-1378.220] (-1377.480) * (-1377.840) (-1384.018) [-1376.906] (-1381.008) -- 0:00:15
918500 -- (-1381.694) [-1378.669] (-1378.245) (-1379.173) * [-1380.246] (-1382.181) (-1377.400) (-1380.080) -- 0:00:15
919000 -- (-1382.902) (-1377.487) [-1381.655] (-1384.999) * (-1384.644) [-1385.954] (-1379.481) (-1377.276) -- 0:00:15
919500 -- [-1381.369] (-1389.561) (-1377.993) (-1379.691) * (-1381.686) (-1377.259) [-1375.644] (-1381.581) -- 0:00:15
920000 -- (-1379.414) (-1387.543) (-1386.098) [-1383.086] * (-1383.522) [-1378.591] (-1382.034) (-1383.638) -- 0:00:15
Average standard deviation of split frequencies: 0.002048
920500 -- (-1380.190) [-1379.819] (-1377.079) (-1379.640) * (-1385.384) (-1374.024) (-1377.421) [-1377.977] -- 0:00:15
921000 -- [-1377.769] (-1382.847) (-1383.814) (-1380.504) * (-1381.589) (-1378.168) [-1382.069] (-1380.878) -- 0:00:15
921500 -- (-1376.054) (-1387.458) (-1380.898) [-1376.583] * (-1388.838) (-1379.662) [-1385.051] (-1382.490) -- 0:00:14
922000 -- [-1377.023] (-1382.652) (-1386.858) (-1377.901) * (-1376.749) [-1377.892] (-1381.923) (-1388.036) -- 0:00:14
922500 -- (-1382.629) (-1378.387) (-1384.822) [-1379.537] * (-1378.264) (-1381.353) [-1374.943] (-1377.158) -- 0:00:14
923000 -- (-1376.051) (-1378.606) [-1374.516] (-1383.789) * (-1382.339) (-1377.959) (-1383.326) [-1379.563] -- 0:00:14
923500 -- (-1378.813) (-1379.863) [-1376.184] (-1376.807) * (-1381.252) [-1382.424] (-1379.043) (-1380.232) -- 0:00:14
924000 -- (-1388.323) (-1377.785) [-1375.898] (-1378.683) * (-1374.895) (-1377.515) [-1377.624] (-1379.091) -- 0:00:14
924500 -- (-1380.776) (-1380.109) (-1376.024) [-1379.449] * (-1381.949) [-1383.829] (-1381.515) (-1375.540) -- 0:00:14
925000 -- (-1376.903) (-1382.285) [-1379.234] (-1376.924) * (-1386.324) (-1381.577) (-1383.724) [-1377.420] -- 0:00:14
Average standard deviation of split frequencies: 0.002036
925500 -- (-1379.787) (-1385.167) [-1376.394] (-1376.760) * (-1390.947) (-1382.041) [-1383.782] (-1375.052) -- 0:00:14
926000 -- (-1375.410) [-1385.939] (-1378.355) (-1381.152) * (-1378.089) [-1383.394] (-1377.638) (-1382.133) -- 0:00:14
926500 -- (-1380.561) [-1385.912] (-1380.517) (-1384.011) * [-1383.793] (-1383.884) (-1377.173) (-1377.600) -- 0:00:14
927000 -- [-1375.667] (-1384.624) (-1380.001) (-1377.988) * (-1378.955) (-1379.467) [-1376.372] (-1377.369) -- 0:00:13
927500 -- [-1376.624] (-1386.057) (-1383.168) (-1379.900) * (-1381.037) (-1382.439) (-1380.753) [-1376.086] -- 0:00:13
928000 -- (-1380.583) (-1377.807) (-1379.544) [-1383.920] * (-1380.231) (-1384.145) (-1388.843) [-1383.054] -- 0:00:13
928500 -- [-1377.474] (-1381.542) (-1380.841) (-1386.235) * (-1378.567) (-1386.153) (-1382.176) [-1376.322] -- 0:00:13
929000 -- (-1375.673) (-1387.658) [-1374.685] (-1387.587) * (-1377.986) (-1377.701) [-1377.542] (-1386.535) -- 0:00:13
929500 -- [-1378.236] (-1382.995) (-1379.606) (-1383.887) * (-1376.942) (-1376.326) [-1379.626] (-1386.490) -- 0:00:13
930000 -- (-1375.219) (-1379.513) (-1377.949) [-1384.391] * [-1385.568] (-1383.243) (-1378.962) (-1381.037) -- 0:00:13
Average standard deviation of split frequencies: 0.001773
930500 -- (-1374.696) (-1385.453) (-1380.260) [-1378.536] * (-1381.116) (-1382.309) [-1378.084] (-1387.674) -- 0:00:13
931000 -- (-1376.022) [-1385.712] (-1381.498) (-1382.483) * (-1377.668) [-1381.643] (-1386.710) (-1385.520) -- 0:00:13
931500 -- [-1383.109] (-1378.992) (-1379.348) (-1377.599) * (-1380.319) (-1384.199) [-1377.377] (-1377.536) -- 0:00:13
932000 -- (-1381.612) (-1384.331) (-1380.388) [-1374.918] * (-1384.497) [-1383.033] (-1375.612) (-1381.160) -- 0:00:12
932500 -- [-1379.814] (-1378.307) (-1378.855) (-1373.740) * (-1385.022) (-1380.154) [-1375.334] (-1380.199) -- 0:00:12
933000 -- [-1380.621] (-1378.519) (-1375.909) (-1380.441) * [-1381.649] (-1375.718) (-1377.847) (-1377.897) -- 0:00:12
933500 -- (-1383.521) [-1377.862] (-1376.438) (-1373.717) * (-1384.258) [-1378.597] (-1374.644) (-1379.576) -- 0:00:12
934000 -- (-1390.220) (-1377.549) [-1375.361] (-1376.133) * (-1380.081) (-1386.817) [-1377.006] (-1382.813) -- 0:00:12
934500 -- (-1373.457) [-1377.783] (-1381.195) (-1381.245) * (-1377.873) (-1383.831) [-1375.969] (-1378.638) -- 0:00:12
935000 -- (-1384.395) (-1383.652) [-1377.496] (-1375.541) * (-1385.975) (-1398.914) [-1379.066] (-1375.287) -- 0:00:12
Average standard deviation of split frequencies: 0.001763
935500 -- [-1383.956] (-1385.631) (-1378.332) (-1375.966) * [-1386.808] (-1379.469) (-1383.917) (-1374.536) -- 0:00:12
936000 -- (-1381.716) (-1381.186) [-1378.916] (-1377.901) * [-1378.501] (-1383.291) (-1383.724) (-1378.811) -- 0:00:12
936500 -- [-1381.581] (-1381.290) (-1378.794) (-1383.506) * [-1381.711] (-1386.591) (-1384.503) (-1381.338) -- 0:00:12
937000 -- (-1375.670) [-1378.698] (-1374.449) (-1376.687) * (-1378.157) (-1376.538) (-1379.589) [-1380.064] -- 0:00:12
937500 -- (-1377.268) (-1380.802) (-1375.235) [-1379.255] * [-1384.283] (-1383.227) (-1379.785) (-1384.021) -- 0:00:11
938000 -- (-1379.367) (-1377.682) (-1378.514) [-1374.768] * (-1376.121) (-1378.746) (-1377.468) [-1379.825] -- 0:00:11
938500 -- [-1377.578] (-1382.285) (-1378.771) (-1376.286) * (-1381.821) (-1376.746) (-1375.717) [-1377.150] -- 0:00:11
939000 -- (-1378.567) [-1378.908] (-1375.051) (-1383.723) * (-1380.298) [-1378.057] (-1384.565) (-1383.926) -- 0:00:11
939500 -- (-1383.047) (-1384.678) [-1383.671] (-1374.585) * (-1381.362) (-1377.841) [-1375.856] (-1380.708) -- 0:00:11
940000 -- (-1379.567) (-1383.658) [-1376.151] (-1379.166) * (-1380.229) (-1377.505) [-1375.446] (-1378.289) -- 0:00:11
Average standard deviation of split frequencies: 0.001754
940500 -- (-1377.279) (-1375.958) [-1381.611] (-1384.168) * (-1378.179) (-1378.938) [-1374.492] (-1382.522) -- 0:00:11
941000 -- [-1379.656] (-1377.087) (-1378.152) (-1377.580) * [-1379.716] (-1383.537) (-1380.173) (-1383.777) -- 0:00:11
941500 -- (-1383.659) [-1380.489] (-1373.822) (-1380.362) * (-1381.835) (-1385.105) (-1381.627) [-1378.980] -- 0:00:11
942000 -- [-1379.516] (-1379.551) (-1381.198) (-1380.396) * (-1377.419) (-1377.330) (-1383.066) [-1379.100] -- 0:00:11
942500 -- (-1376.723) [-1379.529] (-1380.744) (-1378.836) * (-1377.120) [-1382.682] (-1382.225) (-1379.349) -- 0:00:10
943000 -- (-1384.321) [-1375.571] (-1379.596) (-1377.825) * (-1376.568) [-1377.614] (-1377.199) (-1380.087) -- 0:00:10
943500 -- (-1388.607) (-1380.140) (-1382.698) [-1379.156] * (-1382.873) (-1382.386) [-1382.751] (-1379.094) -- 0:00:10
944000 -- (-1384.796) (-1380.246) [-1378.593] (-1379.850) * (-1383.033) (-1378.444) [-1379.595] (-1376.353) -- 0:00:10
944500 -- (-1384.232) (-1374.518) [-1377.268] (-1379.834) * (-1381.246) (-1381.142) [-1376.681] (-1377.506) -- 0:00:10
945000 -- (-1384.638) (-1381.475) [-1381.923] (-1379.465) * (-1376.387) [-1385.061] (-1379.916) (-1378.341) -- 0:00:10
Average standard deviation of split frequencies: 0.001495
945500 -- (-1383.229) [-1382.043] (-1381.640) (-1378.374) * (-1383.784) (-1383.518) [-1375.928] (-1381.628) -- 0:00:10
946000 -- (-1377.804) (-1374.225) (-1379.063) [-1380.866] * (-1389.428) (-1385.804) (-1384.739) [-1378.533] -- 0:00:10
946500 -- (-1380.398) [-1383.292] (-1382.974) (-1380.266) * (-1383.265) (-1382.363) [-1377.220] (-1383.339) -- 0:00:10
947000 -- (-1386.583) [-1389.039] (-1384.702) (-1381.582) * (-1381.863) [-1381.796] (-1377.170) (-1379.857) -- 0:00:10
947500 -- (-1382.140) [-1380.971] (-1378.618) (-1377.862) * (-1377.948) [-1379.567] (-1381.689) (-1376.370) -- 0:00:10
948000 -- (-1386.384) (-1384.379) [-1382.400] (-1377.997) * (-1379.306) [-1377.178] (-1379.804) (-1375.981) -- 0:00:09
948500 -- (-1377.966) (-1382.369) (-1379.738) [-1375.629] * (-1377.261) (-1384.632) [-1379.738] (-1382.755) -- 0:00:09
949000 -- [-1381.081] (-1376.523) (-1378.638) (-1383.814) * (-1379.255) (-1387.206) [-1378.182] (-1382.327) -- 0:00:09
949500 -- (-1385.380) (-1381.057) (-1374.064) [-1379.798] * (-1375.233) (-1382.825) (-1378.370) [-1379.383] -- 0:00:09
950000 -- (-1379.792) [-1380.425] (-1379.659) (-1380.332) * [-1377.743] (-1380.471) (-1385.881) (-1380.008) -- 0:00:09
Average standard deviation of split frequencies: 0.001488
950500 -- (-1380.791) [-1378.656] (-1376.837) (-1378.252) * [-1377.588] (-1379.688) (-1381.580) (-1380.918) -- 0:00:09
951000 -- (-1374.032) [-1382.337] (-1382.250) (-1380.003) * (-1375.388) [-1377.704] (-1383.184) (-1378.446) -- 0:00:09
951500 -- (-1374.546) (-1377.600) [-1377.995] (-1377.907) * (-1376.843) (-1380.105) [-1374.203] (-1376.966) -- 0:00:09
952000 -- (-1382.900) [-1383.916] (-1380.372) (-1379.195) * (-1378.802) (-1377.686) (-1385.346) [-1384.859] -- 0:00:09
952500 -- (-1377.436) [-1375.572] (-1377.938) (-1373.360) * (-1375.895) (-1379.661) [-1378.007] (-1375.985) -- 0:00:09
953000 -- (-1377.368) (-1381.074) (-1382.856) [-1374.799] * (-1382.776) (-1386.323) [-1376.216] (-1377.947) -- 0:00:08
953500 -- (-1383.456) (-1380.449) (-1380.421) [-1378.832] * (-1384.247) [-1381.486] (-1378.438) (-1381.928) -- 0:00:08
954000 -- (-1375.508) [-1383.878] (-1384.212) (-1384.132) * (-1376.047) (-1385.921) (-1388.211) [-1380.639] -- 0:00:08
954500 -- [-1378.700] (-1381.962) (-1380.085) (-1389.475) * (-1386.967) (-1384.088) (-1394.107) [-1378.756] -- 0:00:08
955000 -- [-1376.841] (-1377.990) (-1379.457) (-1390.377) * (-1377.817) [-1386.164] (-1386.155) (-1388.119) -- 0:00:08
Average standard deviation of split frequencies: 0.001479
955500 -- (-1378.939) (-1385.327) [-1376.057] (-1386.294) * (-1379.016) (-1386.561) (-1387.038) [-1384.682] -- 0:00:08
956000 -- (-1378.651) [-1383.247] (-1379.163) (-1382.501) * [-1377.354] (-1388.861) (-1389.639) (-1376.164) -- 0:00:08
956500 -- [-1374.810] (-1378.276) (-1380.120) (-1382.045) * (-1386.182) (-1380.440) [-1381.204] (-1378.496) -- 0:00:08
957000 -- [-1384.033] (-1378.430) (-1377.689) (-1378.468) * (-1381.230) (-1388.973) (-1379.697) [-1376.606] -- 0:00:08
957500 -- [-1380.887] (-1384.235) (-1380.962) (-1381.761) * (-1390.292) (-1385.905) [-1377.344] (-1374.374) -- 0:00:08
958000 -- (-1377.469) (-1383.275) (-1383.814) [-1382.125] * (-1385.839) (-1389.056) [-1382.822] (-1377.367) -- 0:00:08
958500 -- [-1375.999] (-1378.795) (-1384.289) (-1381.673) * [-1379.051] (-1388.707) (-1380.939) (-1381.721) -- 0:00:07
959000 -- [-1383.623] (-1376.137) (-1379.850) (-1386.244) * (-1378.718) (-1381.715) [-1377.700] (-1377.362) -- 0:00:07
959500 -- [-1379.135] (-1387.969) (-1380.948) (-1377.837) * (-1381.716) (-1382.264) [-1378.023] (-1377.009) -- 0:00:07
960000 -- (-1379.524) (-1381.323) (-1384.549) [-1375.991] * [-1377.445] (-1383.930) (-1383.072) (-1380.605) -- 0:00:07
Average standard deviation of split frequencies: 0.001472
960500 -- (-1385.657) (-1383.050) [-1378.962] (-1377.835) * (-1381.618) (-1382.797) (-1377.612) [-1380.467] -- 0:00:07
961000 -- [-1381.825] (-1381.690) (-1375.761) (-1376.036) * (-1383.216) [-1382.096] (-1375.519) (-1375.322) -- 0:00:07
961500 -- [-1380.055] (-1387.386) (-1378.761) (-1375.484) * (-1381.059) (-1379.246) [-1378.400] (-1380.125) -- 0:00:07
962000 -- (-1379.880) (-1382.759) (-1380.285) [-1376.572] * (-1383.207) (-1375.574) [-1375.056] (-1378.249) -- 0:00:07
962500 -- [-1377.841] (-1378.422) (-1380.257) (-1377.519) * (-1375.050) (-1375.646) [-1374.766] (-1377.418) -- 0:00:07
963000 -- (-1376.575) (-1382.661) [-1380.077] (-1376.084) * (-1378.619) (-1379.411) [-1383.365] (-1378.755) -- 0:00:07
963500 -- (-1377.788) (-1377.199) [-1376.954] (-1381.276) * (-1384.938) [-1376.103] (-1378.058) (-1378.449) -- 0:00:06
964000 -- (-1380.311) (-1375.046) [-1377.734] (-1381.833) * (-1383.036) [-1375.117] (-1383.605) (-1381.477) -- 0:00:06
964500 -- (-1376.950) (-1381.827) (-1380.321) [-1375.381] * [-1377.317] (-1379.141) (-1379.982) (-1378.115) -- 0:00:06
965000 -- (-1379.709) (-1380.568) (-1384.563) [-1383.166] * (-1389.808) (-1384.613) (-1377.782) [-1376.308] -- 0:00:06
Average standard deviation of split frequencies: 0.001464
965500 -- (-1381.569) (-1381.669) (-1390.971) [-1382.734] * (-1381.635) [-1377.876] (-1379.444) (-1380.864) -- 0:00:06
966000 -- [-1378.678] (-1385.066) (-1383.974) (-1382.149) * (-1379.868) (-1380.930) [-1373.862] (-1379.491) -- 0:00:06
966500 -- (-1385.376) (-1384.019) (-1384.618) [-1381.001] * (-1382.071) [-1382.981] (-1380.089) (-1378.136) -- 0:00:06
967000 -- (-1386.567) [-1374.420] (-1388.516) (-1376.642) * (-1377.871) (-1376.981) (-1376.438) [-1380.223] -- 0:00:06
967500 -- (-1391.477) (-1376.353) (-1384.688) [-1374.566] * [-1380.366] (-1375.682) (-1378.986) (-1379.060) -- 0:00:06
968000 -- (-1385.680) (-1377.077) (-1378.692) [-1382.246] * [-1374.956] (-1380.901) (-1385.021) (-1380.413) -- 0:00:06
968500 -- (-1387.023) (-1377.906) [-1382.337] (-1387.423) * (-1376.062) (-1378.412) [-1381.300] (-1383.933) -- 0:00:06
969000 -- (-1389.399) [-1377.683] (-1377.506) (-1375.350) * (-1379.154) [-1380.646] (-1391.230) (-1381.846) -- 0:00:05
969500 -- (-1386.491) (-1387.510) (-1378.087) [-1377.757] * [-1377.453] (-1376.167) (-1381.431) (-1381.254) -- 0:00:05
970000 -- (-1379.232) (-1379.118) (-1381.505) [-1376.493] * (-1383.169) (-1375.132) (-1386.991) [-1379.635] -- 0:00:05
Average standard deviation of split frequencies: 0.001214
970500 -- (-1381.423) (-1384.957) (-1386.491) [-1374.139] * (-1379.403) [-1377.852] (-1382.898) (-1379.124) -- 0:00:05
971000 -- (-1380.668) (-1380.915) (-1375.430) [-1372.965] * (-1383.776) (-1384.356) (-1382.589) [-1377.297] -- 0:00:05
971500 -- (-1385.060) (-1392.284) [-1374.897] (-1376.636) * (-1378.538) (-1376.838) (-1382.536) [-1377.208] -- 0:00:05
972000 -- (-1380.537) [-1382.795] (-1373.841) (-1381.236) * [-1377.645] (-1379.381) (-1378.125) (-1392.458) -- 0:00:05
972500 -- (-1382.310) (-1388.225) [-1374.288] (-1378.240) * (-1379.212) (-1377.660) [-1378.617] (-1383.115) -- 0:00:05
973000 -- (-1378.882) (-1381.332) [-1377.693] (-1376.952) * (-1375.224) (-1381.214) [-1380.448] (-1381.248) -- 0:00:05
973500 -- [-1376.132] (-1381.161) (-1379.250) (-1384.616) * (-1376.465) (-1381.576) [-1381.593] (-1381.980) -- 0:00:05
974000 -- [-1375.173] (-1381.459) (-1386.146) (-1379.238) * [-1381.097] (-1378.014) (-1381.456) (-1380.114) -- 0:00:04
974500 -- (-1381.834) [-1376.766] (-1380.527) (-1378.262) * [-1380.410] (-1384.137) (-1374.295) (-1384.764) -- 0:00:04
975000 -- (-1381.947) (-1379.288) (-1381.258) [-1378.563] * (-1380.310) [-1378.144] (-1381.068) (-1384.913) -- 0:00:04
Average standard deviation of split frequencies: 0.001207
975500 -- (-1380.833) [-1379.645] (-1382.966) (-1377.879) * (-1380.375) [-1378.789] (-1381.674) (-1376.902) -- 0:00:04
976000 -- (-1382.355) (-1379.685) [-1380.788] (-1380.369) * [-1375.893] (-1379.407) (-1379.715) (-1384.929) -- 0:00:04
976500 -- [-1378.470] (-1381.230) (-1379.429) (-1377.912) * (-1376.340) [-1380.336] (-1382.559) (-1387.479) -- 0:00:04
977000 -- (-1380.883) [-1378.182] (-1384.103) (-1385.405) * (-1378.736) (-1379.370) [-1379.404] (-1385.848) -- 0:00:04
977500 -- [-1375.451] (-1380.884) (-1382.205) (-1379.606) * (-1383.882) (-1375.377) [-1379.582] (-1380.319) -- 0:00:04
978000 -- [-1374.308] (-1379.684) (-1384.005) (-1382.117) * (-1381.067) (-1377.906) (-1378.073) [-1378.647] -- 0:00:04
978500 -- (-1377.980) (-1377.084) [-1378.242] (-1379.688) * [-1380.367] (-1384.293) (-1385.025) (-1377.928) -- 0:00:04
979000 -- (-1378.514) (-1377.514) [-1374.707] (-1379.931) * (-1380.200) (-1379.610) (-1380.680) [-1380.945] -- 0:00:04
979500 -- [-1377.046] (-1382.347) (-1377.641) (-1380.900) * [-1378.845] (-1382.039) (-1377.673) (-1384.283) -- 0:00:03
980000 -- (-1375.574) (-1377.600) (-1378.547) [-1378.488] * (-1382.637) [-1378.689] (-1380.523) (-1379.697) -- 0:00:03
Average standard deviation of split frequencies: 0.000961
980500 -- (-1379.421) [-1379.988] (-1386.023) (-1378.929) * (-1377.790) (-1386.083) [-1381.954] (-1387.578) -- 0:00:03
981000 -- (-1384.373) [-1381.390] (-1380.907) (-1381.944) * (-1380.190) (-1383.792) [-1379.834] (-1382.585) -- 0:00:03
981500 -- (-1379.499) (-1378.307) (-1383.982) [-1380.799] * (-1380.163) (-1381.574) [-1375.456] (-1377.691) -- 0:00:03
982000 -- [-1378.725] (-1380.043) (-1383.168) (-1391.698) * (-1376.356) (-1383.861) (-1378.656) [-1381.425] -- 0:00:03
982500 -- (-1380.510) (-1379.548) [-1379.359] (-1383.644) * (-1381.527) (-1376.866) [-1377.752] (-1379.194) -- 0:00:03
983000 -- (-1378.061) [-1382.436] (-1377.388) (-1384.555) * (-1379.232) (-1375.533) (-1383.973) [-1384.433] -- 0:00:03
983500 -- (-1375.865) (-1383.967) [-1375.151] (-1382.523) * (-1382.140) (-1378.403) (-1378.336) [-1385.768] -- 0:00:03
984000 -- [-1380.466] (-1379.001) (-1381.812) (-1379.482) * (-1377.207) (-1376.740) [-1381.656] (-1381.305) -- 0:00:03
984500 -- [-1379.033] (-1379.181) (-1376.617) (-1376.625) * (-1378.811) [-1375.529] (-1384.388) (-1376.686) -- 0:00:02
985000 -- (-1382.628) (-1387.158) (-1382.652) [-1379.170] * (-1379.470) (-1374.432) [-1378.629] (-1380.140) -- 0:00:02
Average standard deviation of split frequencies: 0.000956
985500 -- (-1382.177) (-1379.231) (-1376.479) [-1382.281] * [-1380.040] (-1384.536) (-1382.942) (-1381.772) -- 0:00:02
986000 -- (-1386.539) [-1381.438] (-1379.150) (-1379.994) * (-1377.839) [-1376.648] (-1377.198) (-1383.778) -- 0:00:02
986500 -- (-1379.381) (-1378.950) (-1380.985) [-1380.772] * (-1382.010) [-1375.536] (-1384.304) (-1383.723) -- 0:00:02
987000 -- (-1374.940) (-1375.839) [-1380.292] (-1380.561) * (-1376.742) (-1381.556) (-1380.277) [-1379.905] -- 0:00:02
987500 -- (-1376.065) (-1379.242) (-1377.016) [-1376.201] * (-1378.707) [-1382.423] (-1375.752) (-1383.065) -- 0:00:02
988000 -- (-1378.891) (-1381.100) [-1381.301] (-1374.910) * (-1379.826) (-1380.454) (-1375.335) [-1380.543] -- 0:00:02
988500 -- (-1387.716) [-1382.860] (-1387.303) (-1375.851) * [-1378.619] (-1385.670) (-1379.001) (-1377.916) -- 0:00:02
989000 -- [-1378.695] (-1382.008) (-1380.303) (-1378.421) * [-1378.878] (-1376.800) (-1382.930) (-1378.280) -- 0:00:02
989500 -- [-1379.433] (-1392.040) (-1381.595) (-1387.252) * (-1382.003) [-1380.362] (-1381.145) (-1378.396) -- 0:00:02
990000 -- (-1378.528) (-1387.870) [-1379.164] (-1380.763) * (-1378.373) (-1376.008) (-1386.037) [-1378.988] -- 0:00:01
Average standard deviation of split frequencies: 0.000952
990500 -- [-1380.727] (-1386.475) (-1380.404) (-1380.203) * (-1377.515) (-1377.609) [-1377.713] (-1384.502) -- 0:00:01
991000 -- (-1384.410) [-1384.737] (-1377.353) (-1379.282) * (-1379.953) (-1376.560) [-1383.694] (-1382.505) -- 0:00:01
991500 -- [-1376.858] (-1382.348) (-1381.776) (-1376.549) * (-1377.676) [-1378.855] (-1389.384) (-1378.807) -- 0:00:01
992000 -- (-1384.318) [-1380.387] (-1380.511) (-1378.349) * (-1381.769) (-1376.879) (-1379.531) [-1376.157] -- 0:00:01
992500 -- (-1379.423) (-1377.435) [-1379.328] (-1382.558) * (-1376.695) (-1377.947) (-1390.013) [-1379.380] -- 0:00:01
993000 -- (-1383.611) (-1382.019) (-1380.441) [-1383.984] * (-1382.239) [-1383.253] (-1382.353) (-1380.679) -- 0:00:01
993500 -- (-1379.947) (-1382.181) (-1379.340) [-1379.879] * [-1382.529] (-1379.827) (-1383.718) (-1376.501) -- 0:00:01
994000 -- (-1379.402) [-1381.848] (-1382.405) (-1384.550) * (-1382.357) (-1377.885) (-1379.601) [-1380.653] -- 0:00:01
994500 -- (-1384.547) (-1388.828) (-1382.671) [-1379.178] * [-1376.439] (-1387.532) (-1379.768) (-1380.383) -- 0:00:01
995000 -- (-1385.960) (-1386.515) (-1376.930) [-1380.425] * [-1376.484] (-1377.041) (-1379.935) (-1380.890) -- 0:00:00
Average standard deviation of split frequencies: 0.000947
995500 -- (-1381.537) (-1386.476) (-1381.665) [-1379.302] * (-1383.722) [-1377.131] (-1383.295) (-1377.605) -- 0:00:00
996000 -- (-1381.015) (-1381.196) (-1381.332) [-1375.566] * (-1382.837) (-1380.221) (-1378.208) [-1385.346] -- 0:00:00
996500 -- [-1380.736] (-1380.291) (-1378.423) (-1381.853) * [-1375.290] (-1383.472) (-1378.298) (-1375.146) -- 0:00:00
997000 -- (-1385.808) [-1376.787] (-1378.825) (-1380.864) * (-1380.903) (-1379.735) (-1383.217) [-1380.311] -- 0:00:00
997500 -- (-1386.725) (-1377.727) (-1377.703) [-1375.342] * (-1377.677) (-1380.164) (-1384.642) [-1378.596] -- 0:00:00
998000 -- (-1385.754) (-1379.384) (-1378.297) [-1379.640] * (-1387.558) (-1381.474) (-1375.353) [-1375.819] -- 0:00:00
998500 -- (-1382.137) [-1382.967] (-1383.897) (-1377.360) * [-1379.575] (-1376.276) (-1377.399) (-1374.376) -- 0:00:00
999000 -- (-1381.434) [-1376.918] (-1383.801) (-1379.204) * (-1375.338) (-1375.980) [-1378.829] (-1380.519) -- 0:00:00
999500 -- (-1389.152) (-1382.285) (-1380.108) [-1379.748] * (-1379.042) (-1379.840) (-1382.843) [-1380.048] -- 0:00:00
1000000 -- [-1380.615] (-1381.357) (-1386.039) (-1380.212) * [-1383.675] (-1377.273) (-1386.743) (-1374.507) -- 0:00:00
Average standard deviation of split frequencies: 0.000942
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1380.614622 -- 12.836338
Chain 1 -- -1380.614622 -- 12.836338
Chain 2 -- -1381.356611 -- 14.222574
Chain 2 -- -1381.356611 -- 14.222574
Chain 3 -- -1386.038632 -- 16.344027
Chain 3 -- -1386.038633 -- 16.344027
Chain 4 -- -1380.212476 -- 16.627618
Chain 4 -- -1380.212476 -- 16.627618
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1383.674688 -- 16.789889
Chain 1 -- -1383.674688 -- 16.789889
Chain 2 -- -1377.272861 -- 14.866916
Chain 2 -- -1377.272862 -- 14.866916
Chain 3 -- -1386.743219 -- 17.772981
Chain 3 -- -1386.743219 -- 17.772981
Chain 4 -- -1374.506602 -- 13.648251
Chain 4 -- -1374.506602 -- 13.648251
Analysis completed in 3 mins 11 seconds
Analysis used 191.03 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1371.50
Likelihood of best state for "cold" chain of run 2 was -1371.42
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
61.8 % ( 50 %) Dirichlet(Revmat{all})
76.1 % ( 65 %) Slider(Revmat{all})
27.4 % ( 23 %) Dirichlet(Pi{all})
27.8 % ( 22 %) Slider(Pi{all})
62.7 % ( 35 %) Multiplier(Alpha{1,2})
55.5 % ( 25 %) Multiplier(Alpha{3})
64.9 % ( 30 %) Slider(Pinvar{all})
1.1 % ( 1 %) ExtSPR(Tau{all},V{all})
1.1 % ( 0 %) ExtTBR(Tau{all},V{all})
1.1 % ( 4 %) NNI(Tau{all},V{all})
1.3 % ( 3 %) ParsSPR(Tau{all},V{all})
26.4 % ( 32 %) Multiplier(V{all})
34.2 % ( 28 %) Nodeslider(V{all})
26.0 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
61.6 % ( 45 %) Dirichlet(Revmat{all})
76.4 % ( 66 %) Slider(Revmat{all})
27.4 % ( 23 %) Dirichlet(Pi{all})
29.2 % ( 26 %) Slider(Pi{all})
63.0 % ( 35 %) Multiplier(Alpha{1,2})
55.1 % ( 36 %) Multiplier(Alpha{3})
64.8 % ( 40 %) Slider(Pinvar{all})
1.1 % ( 0 %) ExtSPR(Tau{all},V{all})
1.1 % ( 4 %) ExtTBR(Tau{all},V{all})
1.1 % ( 2 %) NNI(Tau{all},V{all})
1.4 % ( 2 %) ParsSPR(Tau{all},V{all})
26.5 % ( 35 %) Multiplier(V{all})
34.3 % ( 40 %) Nodeslider(V{all})
26.0 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.83 0.68 0.55
2 | 166572 0.84 0.70
3 | 167180 166128 0.85
4 | 167077 166039 167004
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.82 0.67 0.54
2 | 166920 0.84 0.69
3 | 166214 166262 0.85
4 | 167198 166460 166946
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1377.75
| 1 1 1 |
| 1 2 2 |
| 1 1 2 * 2 2 |
| 2 11 2 1 22 1 22 1 22 1 |
| 2 1 2 2 2 1 2 1 2 |
| 2 1 2 2 2 *1 1 2 111 * 1 |
| 1 2 1 2 1 * |
|1 2 * 1 * 2 2 11 12 2 1 |
| 1 11 1 12 1 1 1 2 2 |
| 2 2 1 2 2 2 2 1 2 1 2 |
| 1 1 2|
| 1 2 1 2 2 1 2 1 1 1|
| 2 2 2 21 |
| 1 |
|2 1 2 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1380.30
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1376.43 -1386.23
2 -1376.33 -1385.10
--------------------------------------
TOTAL -1376.38 -1385.82
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.245947 0.003421 0.143919 0.356169 0.237742 919.75 972.01 1.000
r(A<->C){all} 0.121452 0.001667 0.045269 0.200004 0.118120 677.66 761.03 1.004
r(A<->G){all} 0.200509 0.002966 0.096745 0.305449 0.195137 538.05 560.51 1.000
r(A<->T){all} 0.064904 0.002136 0.000031 0.155143 0.056065 473.08 511.44 1.002
r(C<->G){all} 0.055005 0.000722 0.007483 0.105874 0.051649 821.65 838.37 1.001
r(C<->T){all} 0.461794 0.007688 0.300553 0.637470 0.458618 509.84 542.51 1.000
r(G<->T){all} 0.096337 0.002009 0.024136 0.195141 0.091447 690.87 724.05 1.001
pi(A){all} 0.292734 0.000275 0.263970 0.328779 0.292694 975.36 1183.48 1.000
pi(C){all} 0.252308 0.000256 0.224027 0.287139 0.252021 660.18 907.27 1.002
pi(G){all} 0.324905 0.000292 0.290451 0.356492 0.324760 1215.40 1244.71 1.000
pi(T){all} 0.130053 0.000154 0.106488 0.154858 0.129895 1094.80 1138.73 1.000
alpha{1,2} 0.131087 0.013099 0.000107 0.321803 0.110951 1147.56 1232.66 1.000
alpha{3} 1.168827 0.423586 0.189351 2.509427 1.025760 1351.59 1394.81 1.000
pinvar{all} 0.471747 0.019497 0.186225 0.711103 0.485187 871.46 940.02 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ...**
7 -- .**..
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 3002 1.000000 0.000000 1.000000 1.000000 2
7 2970 0.989340 0.001884 0.988008 0.990673 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.031880 0.000148 0.011753 0.058219 0.030306 1.000 2
length{all}[2] 0.008110 0.000022 0.000226 0.017029 0.007231 1.000 2
length{all}[3] 0.007121 0.000019 0.000533 0.015909 0.006364 1.000 2
length{all}[4] 0.019395 0.000155 0.000021 0.041551 0.017264 1.000 2
length{all}[5] 0.061312 0.000399 0.026951 0.101335 0.058660 1.000 2
length{all}[6] 0.097960 0.001401 0.043815 0.173554 0.090613 1.000 2
length{all}[7] 0.020334 0.000105 0.001769 0.039123 0.018778 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.000942
Maximum standard deviation of split frequencies = 0.001884
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.000
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------ C4 (4)
|----------------100----------------+
+ \------------------------------------ C5 (5)
|
| /------------------------------------ C2 (2)
\-----------------99----------------+
\------------------------------------ C3 (3)
Phylogram (based on average branch lengths):
/--------------- C1 (1)
|
| /-------- C4 (4)
|-------------------------------------------+
+ \---------------------------- C5 (5)
|
| /---- C2 (2)
\--------+
\--- C3 (3)
|--------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
99 % credible set contains 2 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 696
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sites with gaps or missing data are removed.
48 ambiguity characters in seq. 1
42 ambiguity characters in seq. 2
39 ambiguity characters in seq. 3
30 ambiguity characters in seq. 4
30 ambiguity characters in seq. 5
19 sites are removed. 137 138 139 140 141 142 158 169 170 184 202 203 204 227 228 229 230 231 232
Sequences read..
Counting site patterns.. 0:00
99 patterns at 213 / 213 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
96624 bytes for conP
13464 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (4, 5), (2, 3)); MP score: 68
144936 bytes for conP, adjusted
0.061532 0.117537 0.034445 0.099368 0.038130 0.004704 0.004711 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -1277.604066
Iterating by ming2
Initial: fx= 1277.604066
x= 0.06153 0.11754 0.03445 0.09937 0.03813 0.00470 0.00471 0.30000 1.30000
1 h-m-p 0.0000 0.0139 112.8016 ++++YYCCCC 1257.497953 5 0.0044 26 | 0/9
2 h-m-p 0.0000 0.0001 653.0803 +YYYCYCCC 1253.274741 7 0.0001 49 | 0/9
3 h-m-p 0.0000 0.0000 1095.3773 +YYCYCC 1252.274267 5 0.0000 69 | 0/9
4 h-m-p 0.0000 0.0003 857.5084 +YCYCCC 1241.955852 5 0.0002 91 | 0/9
5 h-m-p 0.0002 0.0012 137.1497 CYCCC 1239.741038 4 0.0004 110 | 0/9
6 h-m-p 0.0005 0.0025 75.2947 YCC 1239.170718 2 0.0004 125 | 0/9
7 h-m-p 0.0006 0.0163 43.3141 ++YCYCCC 1234.568226 5 0.0070 147 | 0/9
8 h-m-p 0.0001 0.0005 1459.5006 +YYYCCCC 1222.169125 6 0.0004 169 | 0/9
9 h-m-p 0.0000 0.0001 2466.6948 CCCCC 1221.180962 4 0.0000 189 | 0/9
10 h-m-p 0.5407 8.0000 0.1183 +CYCCC 1206.578094 4 1.8151 209 | 0/9
11 h-m-p 0.7617 3.8085 0.0951 CCCCC 1205.712309 4 0.9688 238 | 0/9
12 h-m-p 1.5104 7.5522 0.0579 CCCC 1205.357432 3 1.5876 265 | 0/9
13 h-m-p 1.0066 8.0000 0.0914 +YCCC 1204.744337 3 2.6714 292 | 0/9
14 h-m-p 1.1160 5.5801 0.1105 CCCC 1204.463000 3 1.5224 319 | 0/9
15 h-m-p 1.6000 8.0000 0.0873 CCC 1204.256410 2 1.8549 344 | 0/9
16 h-m-p 1.6000 8.0000 0.0377 CCC 1204.209828 2 1.9099 369 | 0/9
17 h-m-p 1.6000 8.0000 0.0084 CC 1204.192892 1 1.7008 392 | 0/9
18 h-m-p 1.1920 8.0000 0.0120 C 1204.191797 0 1.2583 413 | 0/9
19 h-m-p 1.6000 8.0000 0.0029 C 1204.191743 0 1.3281 434 | 0/9
20 h-m-p 1.6000 8.0000 0.0001 Y 1204.191742 0 0.8919 455 | 0/9
21 h-m-p 1.4358 8.0000 0.0000 C 1204.191742 0 1.4358 476 | 0/9
22 h-m-p 1.6000 8.0000 0.0000 Y 1204.191742 0 1.1697 497 | 0/9
23 h-m-p 1.6000 8.0000 0.0000 C 1204.191742 0 1.6000 518 | 0/9
24 h-m-p 1.6000 8.0000 0.0000 Y 1204.191742 0 0.4000 539 | 0/9
25 h-m-p 0.6099 8.0000 0.0000 ---C 1204.191742 0 0.0029 563
Out..
lnL = -1204.191742
564 lfun, 564 eigenQcodon, 3948 P(t)
Time used: 0:02
Model 1: NearlyNeutral
TREE # 1
(1, (4, 5), (2, 3)); MP score: 68
0.061532 0.117537 0.034445 0.099368 0.038130 0.004704 0.004711 2.095026 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 4.521780
np = 10
lnL0 = -1217.851000
Iterating by ming2
Initial: fx= 1217.851000
x= 0.06153 0.11754 0.03445 0.09937 0.03813 0.00470 0.00471 2.09503 0.57321 0.49224
1 h-m-p 0.0000 0.0033 36.8837 +++CCC 1217.442446 2 0.0006 22 | 0/10
2 h-m-p 0.0000 0.0002 249.1308 YCYCCC 1217.047956 5 0.0001 43 | 0/10
3 h-m-p 0.0001 0.0034 182.6618 ++YCYYYCCCCC 1210.793830 10 0.0026 73 | 0/10
4 h-m-p 0.0000 0.0002 625.2081 CYCCC 1210.205476 4 0.0001 93 | 0/10
5 h-m-p 0.0000 0.0001 243.0693 CYCCC 1210.057878 4 0.0000 113 | 0/10
6 h-m-p 0.0011 0.0152 8.2369 +YCC 1209.933025 2 0.0032 130 | 0/10
7 h-m-p 0.0021 0.0104 9.9510 YCC 1209.886307 2 0.0013 146 | 0/10
8 h-m-p 0.0010 0.0087 12.8745 YCC 1209.862120 2 0.0006 162 | 0/10
9 h-m-p 0.0011 0.1146 6.3403 ++CCC 1209.506518 2 0.0160 181 | 0/10
10 h-m-p 0.0023 0.0536 45.0524 ++CCCC 1202.492694 3 0.0365 202 | 0/10
11 h-m-p 0.2825 1.4126 0.5008 CCCCC 1200.536642 4 0.4857 223 | 0/10
12 h-m-p 0.1209 1.4500 2.0119 +CYCCCC 1197.687165 5 0.6752 256 | 0/10
13 h-m-p 0.2571 1.2856 1.0634 CCCC 1197.234136 3 0.3715 275 | 0/10
14 h-m-p 0.3652 1.8261 0.2765 +YC 1196.809217 1 0.9646 290 | 0/10
15 h-m-p 0.1633 0.8163 0.0304 ++ 1196.683188 m 0.8163 313 | 1/10
16 h-m-p 0.1478 1.1874 0.1333 CC 1196.669739 1 0.0534 338 | 1/10
17 h-m-p 0.7139 8.0000 0.0100 CC 1196.660429 1 0.6862 362 | 1/10
18 h-m-p 0.5212 8.0000 0.0131 YC 1196.659960 1 1.1600 385 | 1/10
19 h-m-p 1.6000 8.0000 0.0006 YC 1196.659892 1 1.0340 408 | 1/10
20 h-m-p 1.6000 8.0000 0.0002 Y 1196.659867 0 1.1278 430 | 1/10
21 h-m-p 0.5946 8.0000 0.0003 C 1196.659866 0 0.8417 452 | 1/10
22 h-m-p 1.6000 8.0000 0.0000 Y 1196.659866 0 1.1686 474 | 1/10
23 h-m-p 1.6000 8.0000 0.0000 C 1196.659866 0 1.4395 496 | 1/10
24 h-m-p 1.6000 8.0000 0.0000 C 1196.659866 0 2.5058 518 | 1/10
25 h-m-p 1.6000 8.0000 0.0000 -------C 1196.659866 0 0.0000 547
Out..
lnL = -1196.659866
548 lfun, 1644 eigenQcodon, 7672 P(t)
Time used: 0:05
Model 2: PositiveSelection
TREE # 1
(1, (4, 5), (2, 3)); MP score: 68
initial w for M2:NSpselection reset.
0.061532 0.117537 0.034445 0.099368 0.038130 0.004704 0.004711 2.166264 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.443914
np = 12
lnL0 = -1221.919072
Iterating by ming2
Initial: fx= 1221.919072
x= 0.06153 0.11754 0.03445 0.09937 0.03813 0.00470 0.00471 2.16626 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0208 51.0929 ++CYC 1221.699677 2 0.0002 22 | 0/12
2 h-m-p 0.0001 0.0003 180.1247 YCCC 1221.158532 3 0.0001 42 | 0/12
3 h-m-p 0.0000 0.0002 98.3067 CCC 1221.081222 2 0.0000 61 | 0/12
4 h-m-p 0.0000 0.0017 97.5512 ++YYYC 1220.043328 3 0.0007 81 | 0/12
5 h-m-p 0.0005 0.0032 132.4611 ++ 1209.507731 m 0.0032 96 | 1/12
6 h-m-p 0.0025 0.0201 66.2628 CCC 1209.181162 2 0.0021 115 | 1/12
7 h-m-p 0.0008 0.0040 106.2862 YYC 1208.979016 2 0.0007 132 | 1/12
8 h-m-p 0.0044 0.0287 16.5239 YC 1208.726727 1 0.0035 148 | 1/12
9 h-m-p 0.0035 0.0772 16.2548 +YCCCCC 1203.763103 5 0.0294 173 | 1/12
10 h-m-p 0.1237 1.0699 3.8591 +YCCCC 1199.247503 4 0.3185 196 | 1/12
11 h-m-p 0.7117 3.5584 1.2614 YCC 1198.326376 2 0.3089 214 | 0/12
12 h-m-p 0.0052 0.0552 74.4107 CCC 1198.184457 2 0.0017 233 | 0/12
13 h-m-p 0.0751 1.9491 1.6989 +CYCCC 1197.016167 4 0.6001 256 | 0/12
14 h-m-p 0.4586 2.2929 0.1617 +YC 1196.725565 1 1.4919 273 | 0/12
15 h-m-p 1.5039 8.0000 0.1604 CCC 1196.593371 2 1.3040 304 | 0/12
16 h-m-p 1.6000 8.0000 0.0629 YC 1196.579425 1 0.8689 332 | 0/12
17 h-m-p 1.6000 8.0000 0.0165 YC 1196.578540 1 0.9442 360 | 0/12
18 h-m-p 1.6000 8.0000 0.0044 YC 1196.578484 1 0.9198 388 | 0/12
19 h-m-p 1.6000 8.0000 0.0021 Y 1196.578472 0 2.8424 415 | 0/12
20 h-m-p 1.5483 8.0000 0.0039 C 1196.578463 0 1.7749 442 | 0/12
21 h-m-p 1.6000 8.0000 0.0006 Y 1196.578462 0 1.1958 469 | 0/12
22 h-m-p 1.6000 8.0000 0.0001 C 1196.578462 0 1.3171 496 | 0/12
23 h-m-p 1.6000 8.0000 0.0000 +C 1196.578462 0 6.0773 524 | 0/12
24 h-m-p 1.5318 8.0000 0.0001 ++ 1196.578462 m 8.0000 551 | 0/12
25 h-m-p 0.5351 8.0000 0.0018 ++ 1196.578462 m 8.0000 578 | 0/12
26 h-m-p 1.6000 8.0000 0.0078 C 1196.578461 0 2.4252 605 | 0/12
27 h-m-p 1.6000 8.0000 0.0001 Y 1196.578461 0 1.0857 632 | 0/12
28 h-m-p 0.0941 8.0000 0.0009 +C 1196.578461 0 0.3962 660 | 0/12
29 h-m-p 0.5691 8.0000 0.0006 ------------C 1196.578461 0 0.0000 699
Out..
lnL = -1196.578461
700 lfun, 2800 eigenQcodon, 14700 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1203.534283 S = -1127.778679 -68.948847
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 99 patterns 0:10
did 20 / 99 patterns 0:10
did 30 / 99 patterns 0:10
did 40 / 99 patterns 0:10
did 50 / 99 patterns 0:10
did 60 / 99 patterns 0:10
did 70 / 99 patterns 0:10
did 80 / 99 patterns 0:10
did 90 / 99 patterns 0:10
did 99 / 99 patterns 0:10
Time used: 0:10
Model 3: discrete
TREE # 1
(1, (4, 5), (2, 3)); MP score: 68
0.061532 0.117537 0.034445 0.099368 0.038130 0.004704 0.004711 2.220301 0.331355 0.382499 0.095126 0.237474 0.397622
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 8.561277
np = 13
lnL0 = -1203.239656
Iterating by ming2
Initial: fx= 1203.239656
x= 0.06153 0.11754 0.03445 0.09937 0.03813 0.00470 0.00471 2.22030 0.33136 0.38250 0.09513 0.23747 0.39762
1 h-m-p 0.0000 0.0026 36.9894 +++YYC 1202.864433 2 0.0006 23 | 0/13
2 h-m-p 0.0000 0.0002 173.9330 CYC 1202.771166 2 0.0000 42 | 0/13
3 h-m-p 0.0001 0.0003 70.0244 CCCC 1202.693546 3 0.0001 64 | 0/13
4 h-m-p 0.0000 0.0006 201.3788 +CYC 1202.398426 2 0.0001 84 | 0/13
5 h-m-p 0.0002 0.0011 59.1738 ++ 1201.139020 m 0.0011 100 | 1/13
6 h-m-p 0.0005 0.0045 53.3153 +CYCCC 1200.678332 4 0.0029 124 | 1/13
7 h-m-p 0.0000 0.0002 374.8116 +YCCC 1200.516867 3 0.0001 146 | 1/13
8 h-m-p 0.0010 0.0048 10.7575 CCC 1200.475862 2 0.0014 166 | 1/13
9 h-m-p 0.0009 0.0045 16.2261 +CY 1200.298910 1 0.0035 185 | 1/13
10 h-m-p 0.0029 0.0145 1.8495 ++ 1200.076065 m 0.0145 201 | 0/13
11 h-m-p 0.0000 0.0000 8.7492
h-m-p: 8.19894771e-20 4.09947386e-19 8.74923522e+00 1200.076065
.. | 0/13
12 h-m-p 0.0000 0.0002 80.1189 +CYC 1199.809992 2 0.0001 234 | 0/13
13 h-m-p 0.0000 0.0004 241.3437 +CCCCC 1198.761960 4 0.0001 259 | 0/13
14 h-m-p 0.0002 0.0009 42.8897 YCCC 1198.704730 3 0.0001 280 | 0/13
15 h-m-p 0.0000 0.0015 95.3204 +YCCC 1198.345943 3 0.0003 302 | 0/13
16 h-m-p 0.0009 0.0046 28.6591 YCCC 1198.229856 3 0.0005 323 | 0/13
17 h-m-p 0.0007 0.0188 17.6922 +YCC 1198.047085 2 0.0019 343 | 0/13
18 h-m-p 0.0006 0.0032 42.4680 ++ 1197.458632 m 0.0032 359 | 1/13
19 h-m-p 0.0000 0.0000 160.2363 ++ 1197.434254 m 0.0000 375 | 2/13
20 h-m-p 0.0018 0.6680 1.4578 ++CC 1197.357865 1 0.0400 395 | 2/13
21 h-m-p 0.0372 1.1735 1.5693 +CCCC 1196.925065 3 0.2456 418 | 1/13
22 h-m-p 0.0127 0.0634 23.0657 YC 1196.864864 1 0.0059 435 | 1/13
23 h-m-p 0.4820 8.0000 0.2806 CYCC 1196.648946 3 0.6490 456 | 1/13
24 h-m-p 0.4236 2.1180 0.1342 +YC 1196.600217 1 1.0900 486 | 0/13
25 h-m-p 0.0341 0.1707 1.0527 -YC 1196.599007 1 0.0039 516 | 0/13
26 h-m-p 0.0283 2.9427 0.1433 ++CC 1196.588745 1 0.4856 536 | 0/13
27 h-m-p 1.1030 8.0000 0.0631 CC 1196.583876 1 1.7274 567 | 0/13
28 h-m-p 1.6000 8.0000 0.0630 YC 1196.579991 1 2.9692 597 | 0/13
29 h-m-p 1.6000 8.0000 0.0106 YC 1196.579720 1 1.0744 627 | 0/13
30 h-m-p 1.0884 8.0000 0.0105 C 1196.579703 0 1.0310 656 | 0/13
31 h-m-p 1.6000 8.0000 0.0004 C 1196.579701 0 1.9485 685 | 0/13
32 h-m-p 1.6000 8.0000 0.0003 ++ 1196.579688 m 8.0000 714 | 0/13
33 h-m-p 0.0138 0.1022 0.1893 ++ 1196.579587 m 0.1022 743 | 1/13
34 h-m-p 1.3210 8.0000 0.0139 --C 1196.579585 0 0.0252 774 | 1/13
35 h-m-p 0.1695 8.0000 0.0021 ++C 1196.579564 0 2.3936 804 | 1/13
36 h-m-p 1.6000 8.0000 0.0027 C 1196.579561 0 1.2902 832 | 1/13
37 h-m-p 1.6000 8.0000 0.0004 ++ 1196.579560 m 8.0000 860 | 1/13
38 h-m-p 0.4055 8.0000 0.0073 +Y 1196.579555 0 3.5880 889 | 1/13
39 h-m-p 1.1201 8.0000 0.0235 C 1196.579548 0 1.1201 917 | 1/13
40 h-m-p 0.4543 8.0000 0.0578 C 1196.579539 0 0.4543 945 | 1/13
41 h-m-p 1.1321 8.0000 0.0232 C 1196.579521 0 1.2191 973 | 0/13
42 h-m-p 0.1166 3.9919 0.2426 --Y 1196.579520 0 0.0031 1003 | 0/13
43 h-m-p 0.0253 8.0000 0.0294 +++Y 1196.579512 0 1.0471 1035 | 0/13
44 h-m-p 1.0441 8.0000 0.0294 Y 1196.579503 0 1.0441 1064 | 0/13
45 h-m-p 1.6000 8.0000 0.0144 C 1196.579492 0 1.3796 1093 | 0/13
46 h-m-p 0.4461 8.0000 0.0446 C 1196.579482 0 0.5729 1122 | 0/13
47 h-m-p 0.4673 8.0000 0.0547 Y 1196.579474 0 0.4673 1151 | 0/13
48 h-m-p 0.6771 3.3853 0.0065 Y 1196.579459 0 1.5612 1180 | 0/13
49 h-m-p 0.2133 1.0665 0.0246 ++ 1196.579440 m 1.0665 1209 | 1/13
50 h-m-p 0.0160 8.0000 6.7102 C 1196.579415 0 0.0057 1238 | 1/13
51 h-m-p 1.3496 8.0000 0.0283 Y 1196.579393 0 1.3496 1254 | 0/13
52 h-m-p 0.0221 8.0000 1.7315 Y 1196.579387 0 0.0028 1282 | 0/13
53 h-m-p 0.1618 8.0000 0.0303 +C 1196.579377 0 0.8941 1299 | 0/13
54 h-m-p 0.9728 8.0000 0.0278 C 1196.579358 0 1.5145 1328 | 0/13
55 h-m-p 1.6000 8.0000 0.0045 Y 1196.579353 0 0.8190 1357 | 0/13
56 h-m-p 0.0977 8.0000 0.0374 ++Y 1196.579342 0 0.9881 1388 | 0/13
57 h-m-p 1.2918 8.0000 0.0286 Y 1196.579334 0 1.2918 1417 | 0/13
58 h-m-p 1.6000 8.0000 0.0131 C 1196.579317 0 1.6000 1446 | 0/13
59 h-m-p 0.3726 8.0000 0.0562 C 1196.579306 0 0.5165 1475 | 0/13
60 h-m-p 0.4158 8.0000 0.0698 Y 1196.579299 0 0.4158 1504 | 0/13
61 h-m-p 1.6000 8.0000 0.0103 C 1196.579283 0 1.9877 1533 | 0/13
62 h-m-p 0.7836 8.0000 0.0261 Y 1196.579264 0 1.4803 1562 | 0/13
63 h-m-p 1.1025 8.0000 0.0351 C 1196.579219 0 1.2452 1591 | 0/13
64 h-m-p 0.8765 4.3825 0.0400 Y 1196.579179 0 0.8765 1620 | 0/13
65 h-m-p 0.0946 0.4732 0.0871 ++ 1196.579058 m 0.4732 1649 | 1/13
66 h-m-p 0.1814 8.0000 0.2270 C 1196.579006 0 0.0454 1678 | 1/13
67 h-m-p 0.0715 8.0000 0.1441 +C 1196.578908 0 0.3214 1707 | 1/13
68 h-m-p 0.3637 8.0000 0.1273 Y 1196.578876 0 0.2079 1735 | 1/13
69 h-m-p 0.8784 8.0000 0.0301 C 1196.578839 0 0.9594 1763 | 0/13
70 h-m-p 0.0160 8.0000 2.7277 -C 1196.578827 0 0.0016 1792 | 0/13
71 h-m-p 0.1595 8.0000 0.0273 +Y 1196.578791 0 1.1800 1809 | 0/13
72 h-m-p 1.3418 8.0000 0.0240 C 1196.578746 0 1.3418 1838 | 0/13
73 h-m-p 0.2156 1.0781 0.0221 ++ 1196.578643 m 1.0781 1867 | 1/13
74 h-m-p 0.4854 8.0000 0.0491 +C 1196.578428 0 1.9417 1897 | 1/13
75 h-m-p 0.1150 8.0000 0.8292 CY 1196.578360 1 0.0526 1927 | 1/13
76 h-m-p 0.8705 8.0000 0.0501 C 1196.578298 0 0.8705 1955 | 0/13
77 h-m-p 0.0024 1.1828 22.2940 C 1196.578201 0 0.0024 1983 | 0/13
78 h-m-p 0.6047 8.0000 0.0872 Y 1196.578152 0 0.6047 1999 | 0/13
79 h-m-p 1.6000 8.0000 0.0128 C 1196.578078 0 2.0955 2028 | 0/13
80 h-m-p 0.6961 8.0000 0.0387 C 1196.578042 0 0.7424 2057 | 0/13
81 h-m-p 0.6140 8.0000 0.0467 CY 1196.577975 1 1.1004 2088 | 0/13
82 h-m-p 1.6000 8.0000 0.0199 +YC 1196.577749 1 4.3407 2119 | 0/13
83 h-m-p 0.6088 8.0000 0.1416 YC 1196.577621 1 0.2856 2149 | 0/13
84 h-m-p 0.6234 5.2732 0.0649 CC 1196.577311 1 0.8579 2180 | 0/13
85 h-m-p 0.4346 2.1732 0.0642 C 1196.577198 0 0.5028 2209 | 0/13
86 h-m-p 0.4071 2.0357 0.0229 ++ 1196.576901 m 2.0357 2238 | 1/13
87 h-m-p 0.0763 8.0000 0.6109 C 1196.576842 0 0.0184 2267 | 1/13
88 h-m-p 0.3403 8.0000 0.0331 +C 1196.576613 0 1.3612 2296 | 0/13
89 h-m-p 0.0103 2.0325 4.3655 Y 1196.576601 0 0.0015 2324 | 0/13
90 h-m-p 0.1500 8.0000 0.0434 +YC 1196.576478 1 1.1537 2342 | 0/13
91 h-m-p 0.8961 8.0000 0.0558 YC 1196.576308 1 1.7326 2372 | 0/13
92 h-m-p 1.6000 8.0000 0.0355 YC 1196.576234 1 0.7564 2402 | 0/13
93 h-m-p 0.7635 8.0000 0.0352 +C 1196.576051 0 2.7217 2432 | 0/13
94 h-m-p 1.6000 8.0000 0.0453 Y 1196.575982 0 1.6000 2461 | 0/13
95 h-m-p 1.6000 8.0000 0.0143 C 1196.575935 0 2.1695 2490 | 0/13
96 h-m-p 0.9071 7.3155 0.0342 +YC 1196.575751 1 2.8326 2521 | 0/13
97 h-m-p 0.2374 1.1872 0.0977 ++ 1196.575528 m 1.1872 2550 | 1/13
98 h-m-p 0.5842 8.0000 0.1986 Y 1196.575341 0 0.1119 2579 | 1/13
99 h-m-p 0.3273 8.0000 0.0679 C 1196.575326 0 0.4352 2607 | 1/13
100 h-m-p 1.6000 8.0000 0.0143 Y 1196.575291 0 3.2191 2635 | 1/13
101 h-m-p 1.2487 8.0000 0.0368 YC 1196.575222 1 2.2334 2664 | 1/13
102 h-m-p 1.6000 8.0000 0.0343 Y 1196.575182 0 1.1438 2692 | 1/13
103 h-m-p 0.9570 8.0000 0.0410 C 1196.575163 0 1.2514 2720 | 1/13
104 h-m-p 1.6000 8.0000 0.0119 Y 1196.575155 0 0.6965 2748 | 1/13
105 h-m-p 0.3158 8.0000 0.0264 +Y 1196.575153 0 0.9056 2777 | 1/13
106 h-m-p 1.6000 8.0000 0.0068 C 1196.575152 0 1.7470 2805 | 1/13
107 h-m-p 1.6000 8.0000 0.0008 Y 1196.575152 0 3.0766 2833 | 1/13
108 h-m-p 0.6943 8.0000 0.0037 C 1196.575152 0 1.0862 2861 | 1/13
109 h-m-p 1.6000 8.0000 0.0002 Y 1196.575152 0 1.0115 2889 | 1/13
110 h-m-p 1.6000 8.0000 0.0000 Y 1196.575152 0 1.0994 2917 | 1/13
111 h-m-p 1.0321 8.0000 0.0000 ++ 1196.575152 m 8.0000 2945 | 1/13
112 h-m-p 1.1662 8.0000 0.0000 -Y 1196.575152 0 0.1199 2974 | 1/13
113 h-m-p 0.1871 8.0000 0.0000 ---------------.. | 1/13
114 h-m-p 0.0160 8.0000 0.0003 ------------- | 1/13
115 h-m-p 0.0160 8.0000 0.0003 -------------
Out..
lnL = -1196.575152
3094 lfun, 12376 eigenQcodon, 64974 P(t)
Time used: 0:32
Model 7: beta
TREE # 1
(1, (4, 5), (2, 3)); MP score: 68
0.061532 0.117537 0.034445 0.099368 0.038130 0.004704 0.004711 2.220175 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 7.503032
np = 10
lnL0 = -1202.446332
Iterating by ming2
Initial: fx= 1202.446332
x= 0.06153 0.11754 0.03445 0.09937 0.03813 0.00470 0.00471 2.22017 0.66567 1.54913
1 h-m-p 0.0000 0.0051 38.0049 ++YCCC 1202.212788 3 0.0003 32 | 0/10
2 h-m-p 0.0000 0.0002 152.5561 CYCCC 1202.046747 4 0.0001 62 | 0/10
3 h-m-p 0.0002 0.0008 37.3787 YCC 1202.019865 2 0.0001 88 | 0/10
4 h-m-p 0.0000 0.0013 70.2614 +CCC 1201.907956 2 0.0002 116 | 0/10
5 h-m-p 0.0006 0.0181 20.8298 +CCCC 1201.517997 3 0.0029 146 | 0/10
6 h-m-p 0.0003 0.0027 224.8347 +YYCCC 1200.105829 4 0.0009 176 | 0/10
7 h-m-p 0.0004 0.0021 198.7093 YYCC 1199.737420 3 0.0003 203 | 0/10
8 h-m-p 0.0026 0.0131 16.4149 YC 1199.704826 1 0.0005 227 | 0/10
9 h-m-p 0.0186 5.5834 0.4338 +++YYCC 1199.242397 3 0.9394 257 | 0/10
10 h-m-p 0.1825 0.9123 1.5480 +YYCYCCC 1198.108034 6 0.6214 290 | 0/10
11 h-m-p 0.0074 0.0369 15.1549 +YYYYCYYYYY 1197.103917 10 0.0352 325 | 0/10
12 h-m-p 0.5680 7.4569 0.9381 ----------------.. | 0/10
13 h-m-p 0.0000 0.0015 83.9226 CYY 1197.023484 2 0.0000 388 | 0/10
14 h-m-p 0.0000 0.0036 20.0257 +CC 1196.972976 1 0.0003 414 | 0/10
15 h-m-p 0.0001 0.0003 42.9573 YCC 1196.960317 2 0.0000 440 | 0/10
16 h-m-p 0.0001 0.0128 11.0259 +YCC 1196.941967 2 0.0004 467 | 0/10
17 h-m-p 0.0001 0.0007 12.8804 YC 1196.940849 1 0.0000 491 | 0/10
18 h-m-p 0.0001 0.0355 3.2992 +C 1196.938979 0 0.0004 515 | 0/10
19 h-m-p 0.0006 0.2605 2.4967 +YC 1196.935237 1 0.0018 540 | 0/10
20 h-m-p 0.0012 0.1489 3.7084 +CCC 1196.924844 2 0.0045 568 | 0/10
21 h-m-p 0.0007 0.1281 25.2119 +CCC 1196.887955 2 0.0023 596 | 0/10
22 h-m-p 0.0025 0.0256 23.7810 +YCYC 1196.771320 3 0.0076 624 | 0/10
23 h-m-p 1.6000 8.0000 0.0356 YYC 1196.768329 2 0.5864 649 | 0/10
24 h-m-p 1.1342 8.0000 0.0184 Y 1196.767448 0 0.8645 672 | 0/10
25 h-m-p 1.6000 8.0000 0.0030 C 1196.767408 0 0.4158 695 | 0/10
26 h-m-p 0.4603 8.0000 0.0027 C 1196.767406 0 0.1151 718 | 0/10
27 h-m-p 0.0613 4.8700 0.0051 Y 1196.767406 0 0.0105 741 | 0/10
28 h-m-p 0.0044 2.0069 0.0122 C 1196.767406 0 0.0013 764 | 0/10
29 h-m-p 0.0013 0.6351 0.0382 ----------C 1196.767406 0 0.0000 797 | 0/10
30 h-m-p 0.0160 8.0000 0.0009 +++C 1196.767391 0 1.2063 823 | 0/10
31 h-m-p 1.6000 8.0000 0.0000 Y 1196.767391 0 0.7864 846 | 0/10
32 h-m-p 0.0914 8.0000 0.0003 ----Y 1196.767391 0 0.0002 873 | 0/10
33 h-m-p 0.0160 8.0000 0.0008 C 1196.767391 0 0.0034 896 | 0/10
34 h-m-p 0.0160 8.0000 0.0012 -------------.. | 0/10
35 h-m-p 0.0000 0.0074 0.8731 -Y 1196.767391 0 0.0000 954 | 0/10
36 h-m-p 0.0003 0.1700 0.1499 Y 1196.767391 0 0.0001 977 | 0/10
37 h-m-p 0.0000 0.0104 2.3553 C 1196.767390 0 0.0000 1000 | 0/10
38 h-m-p 0.0000 0.0052 4.6319 C 1196.767390 0 0.0000 1023 | 0/10
39 h-m-p 0.0000 0.0020 11.5161 Y 1196.767390 0 0.0000 1046 | 0/10
40 h-m-p 0.0000 0.0004 54.3563 --------.. | 0/10
41 h-m-p 0.0000 0.0118 0.5343 --------
Out..
lnL = -1196.767390
1105 lfun, 12155 eigenQcodon, 77350 P(t)
Time used: 0:58
Model 8: beta&w>1
TREE # 1
(1, (4, 5), (2, 3)); MP score: 68
initial w for M8:NSbetaw>1 reset.
0.061532 0.117537 0.034445 0.099368 0.038130 0.004704 0.004711 2.122388 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.545060
np = 12
lnL0 = -1201.306049
Iterating by ming2
Initial: fx= 1201.306049
x= 0.06153 0.11754 0.03445 0.09937 0.03813 0.00470 0.00471 2.12239 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0024 74.0101 ++YCCC 1200.479019 3 0.0004 36 | 0/12
2 h-m-p 0.0000 0.0002 270.6714 +YCYCCC 1199.508195 5 0.0001 72 | 0/12
3 h-m-p 0.0000 0.0001 166.0794 CCCC 1199.363713 3 0.0000 105 | 0/12
4 h-m-p 0.0001 0.0014 71.7318 +CCCCC 1198.662658 4 0.0005 141 | 0/12
5 h-m-p 0.0006 0.0030 29.1860 CCCC 1198.362477 3 0.0010 174 | 0/12
6 h-m-p 0.0009 0.0046 32.9119 CCCC 1198.130257 3 0.0009 207 | 0/12
7 h-m-p 0.0005 0.0059 56.7301 YC 1197.622846 1 0.0013 235 | 0/12
8 h-m-p 0.0005 0.0027 98.2258 CCCCC 1197.133179 4 0.0008 270 | 0/12
9 h-m-p 0.0054 0.0268 7.3161 YC 1197.111722 1 0.0010 298 | 0/12
10 h-m-p 0.0112 5.6173 1.3155 ++YCCC 1196.723648 3 0.2976 332 | 0/12
11 h-m-p 1.6000 8.0000 0.1165 YCC 1196.656664 2 0.8745 362 | 0/12
12 h-m-p 0.5750 8.0000 0.1773 CC 1196.640200 1 0.5958 391 | 0/12
13 h-m-p 0.9759 8.0000 0.1082 YCCC 1196.622600 3 1.7869 423 | 0/12
14 h-m-p 1.6000 8.0000 0.1088 CCCC 1196.597906 3 2.1508 456 | 0/12
15 h-m-p 1.6000 8.0000 0.0682 YC 1196.588711 1 1.0283 484 | 0/12
16 h-m-p 0.4262 4.4087 0.1646 YCCC 1196.582801 3 0.8672 516 | 0/12
17 h-m-p 1.6000 8.0000 0.0416 CC 1196.579384 1 1.4444 545 | 0/12
18 h-m-p 1.0510 8.0000 0.0571 CC 1196.578178 1 1.2525 574 | 0/12
19 h-m-p 1.6000 8.0000 0.0085 YC 1196.578024 1 0.8218 602 | 0/12
20 h-m-p 0.3469 8.0000 0.0201 YC 1196.577968 1 0.8292 630 | 0/12
21 h-m-p 1.6000 8.0000 0.0034 Y 1196.577964 0 0.9248 657 | 0/12
22 h-m-p 1.6000 8.0000 0.0002 Y 1196.577964 0 0.7385 684 | 0/12
23 h-m-p 1.6000 8.0000 0.0001 +Y 1196.577963 0 5.3946 712 | 0/12
24 h-m-p 0.7390 8.0000 0.0006 ++ 1196.577961 m 8.0000 739 | 0/12
25 h-m-p 0.0183 8.0000 0.2515 +++YY 1196.577856 1 1.1726 770 | 0/12
26 h-m-p 1.1932 7.3793 0.2472 YY 1196.577770 1 1.1932 798 | 0/12
27 h-m-p 0.8087 4.0437 0.3201 C 1196.577715 0 0.2846 825 | 0/12
28 h-m-p 0.3835 6.0528 0.2375 CYC 1196.577596 2 0.6915 855 | 0/12
29 h-m-p 1.5490 8.0000 0.1060 CC 1196.577511 1 0.6181 884 | 0/12
30 h-m-p 0.6490 8.0000 0.1010 C 1196.577447 0 0.7417 911 | 0/12
31 h-m-p 0.4723 8.0000 0.1586 YC 1196.577360 1 0.4807 939 | 0/12
32 h-m-p 1.6000 8.0000 0.0335 YC 1196.577238 1 0.7594 967 | 0/12
33 h-m-p 0.1542 7.2673 0.1652 +Y 1196.577186 0 0.3948 995 | 0/12
34 h-m-p 0.9507 8.0000 0.0686 C 1196.577123 0 0.9507 1022 | 0/12
35 h-m-p 1.0396 8.0000 0.0627 C 1196.577043 0 1.1282 1049 | 0/12
36 h-m-p 0.4187 5.9043 0.1690 Y 1196.576986 0 0.4187 1076 | 0/12
37 h-m-p 1.6000 8.0000 0.0273 C 1196.576880 0 1.6000 1103 | 0/12
38 h-m-p 1.6000 8.0000 0.0072 YC 1196.576844 1 0.9651 1131 | 0/12
39 h-m-p 0.0559 7.0245 0.1249 +YC 1196.576798 1 0.4766 1160 | 0/12
40 h-m-p 1.1867 8.0000 0.0502 YC 1196.576772 1 0.6170 1188 | 0/12
41 h-m-p 1.6000 8.0000 0.0171 Y 1196.576722 0 1.0936 1215 | 0/12
42 h-m-p 0.5374 8.0000 0.0348 C 1196.576706 0 0.7820 1242 | 0/12
43 h-m-p 0.9927 8.0000 0.0274 C 1196.576686 0 1.2375 1269 | 0/12
44 h-m-p 1.6000 8.0000 0.0130 Y 1196.576677 0 1.0792 1296 | 0/12
45 h-m-p 1.6000 8.0000 0.0039 C 1196.576674 0 0.5240 1323 | 0/12
46 h-m-p 0.0854 8.0000 0.0237 +Y 1196.576671 0 0.7290 1351 | 0/12
47 h-m-p 1.6000 8.0000 0.0044 C 1196.576670 0 1.4763 1378 | 0/12
48 h-m-p 1.6000 8.0000 0.0005 C 1196.576670 0 1.4149 1405 | 0/12
49 h-m-p 0.6714 8.0000 0.0010 Y 1196.576670 0 1.1007 1432 | 0/12
50 h-m-p 1.6000 8.0000 0.0000 Y 1196.576670 0 0.8676 1459 | 0/12
51 h-m-p 1.6000 8.0000 0.0000 C 1196.576670 0 1.6000 1486 | 0/12
52 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/12
53 h-m-p 0.0160 8.0000 0.0002 -------------
Out..
lnL = -1196.576670
1566 lfun, 18792 eigenQcodon, 120582 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1202.748614 S = -1127.792916 -69.121462
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 99 patterns 1:38
did 20 / 99 patterns 1:38
did 30 / 99 patterns 1:38
did 40 / 99 patterns 1:39
did 50 / 99 patterns 1:39
did 60 / 99 patterns 1:39
did 70 / 99 patterns 1:39
did 80 / 99 patterns 1:39
did 90 / 99 patterns 1:40
did 99 / 99 patterns 1:40
Time used: 1:40
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=232
D_melanogaster_Sh3beta-PD MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
D_sechellia_Sh3beta-PD MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
D_simulans_Sh3beta-PD MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
D_yakuba_Sh3beta-PD MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
D_erecta_Sh3beta-PD MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL
**************************************************
D_melanogaster_Sh3beta-PD MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF
D_sechellia_Sh3beta-PD MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF
D_simulans_Sh3beta-PD MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF
D_yakuba_Sh3beta-PD MQNKSTSNGGTVSDPEPRHPLPPQLFNDEEYCGDYDAFDMANEIDTLEVF
D_erecta_Sh3beta-PD MQNKSTSSGGTVSDPEPRHPLPPQLFNDEEYCGDYDAFDMANEIDTLEVF
*******.********************:*********************
D_melanogaster_Sh3beta-PD LKLAPADTTAVSTAQIELKQENGDAKKEEAETEAED------KKTEAGDG
D_sechellia_Sh3beta-PD LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAED------KKPESGDG
D_simulans_Sh3beta-PD LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAED------KKPESGDG
D_yakuba_Sh3beta-PD LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAAT--DAEEKKPEAGDG
D_erecta_Sh3beta-PD LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAVTDADAEAKKPEAGDG
*******************************:** **.*:***
D_melanogaster_Sh3beta-PD DVDVKEE-AAEKAENEDG--KDKENSKGEDEDADEENAEQKKLPATTTTT
D_sechellia_Sh3beta-PD DVDVKEE-AAEKAENEDADDKDKENSKGEDEDADEENAEQKKLPATTTTT
D_simulans_Sh3beta-PD DVDVKEE-AAEKAENEDADGKDKENSKGEDEDADEEKAEQKKLPATTTTT
D_yakuba_Sh3beta-PD GVKEEEE-AAEKAENEDADGEDKENSKGEAEDA-EDSAEQKKLPATTTAA
D_erecta_Sh3beta-PD GAKEEEEVAAEKAENEDDAGADKENSKGEDEDA-EDSTEQKKSSTTTTAA
... :** ********* ******** *** *:.:**** .:***::
D_melanogaster_Sh3beta-PD AAS-AKKTSDSQSDLLLDSERAAAAQoooooo
D_sechellia_Sh3beta-PD TAP-ARKTSDSQSDLLLDSERAAAAQoooo--
D_simulans_Sh3beta-PD TAVPAKKTSDSQSDLLLDSERAAAAQooo---
D_yakuba_Sh3beta-PD APAAAKKTSDSQSDLLLDSERAAAAQ------
D_erecta_Sh3beta-PD A---AKKTSDSQSDLLLHSERAAAAQ------
: *:***********.********
>D_melanogaster_Sh3beta-PD ATGGTCTTGAAAGTCTACGTCAGCGGCATGTCCGGCAATAAGGAGGTGAA GAAGCGCCAGCAGCGCGTTCTGATGATCCTGGACAGCAAGAACATCAAGT ACGACACGGTGGACATCACGGAGCCCGGCAAGGAATCCGAGAAGGAGCTG ATGCAAAACAAATCGACAAGCAACGGTGGAACGGTCAGCGATCCAGAGCC CCGTCATCCGCTTCCTCCGCAGCTGTTCAACGACGACGAGTACTGCGGTG ATTACGACGCCTTTGACATGGCCAACGAGATCGATACCCTGGAGGTGTTC CTCAAGCTGGCTCCAGCCGACACCACGGCAGTTAGTACCGCCCAAATCGA ACTGAAGCAGGAGAACGGCGATGCCAAGAAGGAGGAGGCGGAAACGGAGG CGGAGGAT------------------AAGAAAACGGAGGCCGGCGATGGC GATGTGGATGTCAAGGAGGAG---GCTGCTGAGAAGGCCGAGAACGAAGA CGGC------AAGGACAAGGAGAATTCAAAGGGCGAGGATGAAGACGCAG ATGAAGAGAATGCCGAGCAAAAGAAGTTACCAGCGACCACAACAACAACA GCAGCATCA---GCTAAGAAGACTTCAGATTCCCAATCGGATCTCTTATT GGACAGCGAGCGGGCAGCGGCTGCGCAG------------------ >D_sechellia_Sh3beta-PD ATGGTCTTGAAAGTCTACGTCAGCGGCATGTCCGGCAATAAGGAGGTGAA GAAGCGCCAGCAGCGCGTTCTCATGATCCTGGACAGCAAGAACATCAAGT ACGACACCGTGGACATCACGGAGCCCGGCAAGGAATCCGAGAAGGAGCTA ATGCAGAACAAATCGACGAGCAACGGCGGAACGGTCAGCGATCCAGAGCC CCGTCATCCGCTTCCTCCGCAGCTGTTCAACGATGACGAGTACTGCGGTG ACTACGACGCCTTCGACATGGCCAACGAGATCGATACCCTGGAGGTGTTC CTCAAGCTGGCCCCAGCCGACACCACGGCGGTTAGTACCGCCCAAATCGA ACTGAAACAGGAGAACGGCGATGCCAAGAAGGAGGAGGCGGAAGCGGAGG CGGAGGAT------------------AAGAAACCGGAGTCCGGCGATGGC GATGTGGATGTCAAGGAGGAG---GCTGCGGAGAAGGCCGAGAACGAAGA CGCTGACGACAAGGACAAGGAGAATTCAAAGGGCGAGGATGAAGACGCAG ATGAAGAAAATGCCGAGCAAAAGAAGTTACCAGCGACCACAACAACAACA ACAGCGCCA---GCTAGGAAGACTTCAGATTCCCAATCGGATCTCTTATT GGACAGCGAGCGGGCAGCGGCTGCGCAG------------------ >D_simulans_Sh3beta-PD ATGGTCTTGAAAGTCTACGTCAGCGGCATGTCCGGCAATAAGGAGGTGAA GAAGCGCCAGCAGCGCGTTCTCATGATCCTGGACAGCAAGAACATCAAGT ACGACACCGTGGACATCACGGAGCCCGGCAAGGAATCCGAGAAGGAGCTA ATGCAGAACAAATCGACGAGCAACGGCGGAACGGTCAGCGATCCAGAGCC CCGTCATCCGCTTCCTCCGCAGCTGTTCAACGATGACGAGTACTGCGGTG ACTACGACGCCTTCGACATGGCCAACGAGATCGATACCCTGGAGGTGTTC CTCAAGCTGGCCCCAGCCGACACCACGGCGGTTAGTACCGCCCAAATCGA ACTGAAACAGGAGAACGGCGATGCCAAGAAGGAGGAGGCGGAAGCGGAGG CGGAGGAT------------------AAGAAACCGGAGTCCGGCGATGGC GATGTGGATGTCAAGGAGGAG---GCTGCGGAGAAGGCCGAGAACGAAGA CGCTGACGGCAAGGACAAGGAGAATTCAAAGGGCGAGGATGAAGACGCAG ATGAAGAAAAGGCCGAGCAAAAGAAGTTACCAGCGACCACAACAACAACA ACAGCAGTACCCGCTAAGAAGACTTCAGATTCCCAATCGGATCTCTTATT GGACAGCGAGCGGGCAGCGGCTGCGCAG------------------ >D_yakuba_Sh3beta-PD ATGGTCTTGAAAGTCTACGTCAGCGGCATGTCCGGCAATAAGGAGGTGAA GAAGCGCCAGCAGCGCGTTCTGATGATCCTGGACAGCAAGAACATCAAGT ACGACACGGTGGACATCACGGAGCCCGGCAAGGAATCCGAGAAGGAGCTG ATGCAGAACAAATCGACGAGCAACGGCGGCACGGTCAGCGATCCAGAGCC CCGTCATCCGCTTCCTCCGCAGCTCTTCAACGACGAAGAGTACTGCGGCG ACTACGACGCCTTCGACATGGCCAACGAGATCGACACCCTGGAGGTGTTC CTCAAACTGGCACCCGCCGACACCACGGCGGTTAGCACCGCCCAAATCGA ACTGAAGCAGGAGAACGGCGATGCCAAGAAGGAGGAGGCAGAAGCGGAGG CGGCTACA------GATGCGGAGGAGAAGAAACCGGAGGCCGGCGATGGC GGTGTCAAGGAGGAGGAGGAG---GCTGCGGAGAAGGCCGAGAACGAAGA CGCTGACGGCGAGGACAAGGAGAATTCAAAGGGCGAGGCTGAAGACGCC- --GAAGATAGTGCCGAGCAAAAGAAGTTACCAGCGACAACAACAGCAGCA GCACCAGCAGCAGCTAAGAAGACTTCAGATTCCCAATCGGATCTCTTATT GGACAGCGAGCGAGCAGCGGCTGCGCAG------------------ >D_erecta_Sh3beta-PD ATGGTCTTGAAAGTCTACGTCAGCGGCATGTCCGGCAATAAGGAGGTGAA GAAGCGCCAGCAGCGCGTTCTGATGATCCTGGACAGCAAGAACATCAAGT ACGACACGGTAGACATCACGGAGCCCGGCAAGGAATCCGAAAAGGAGCTG ATGCAGAACAAATCGACGAGCAGCGGCGGCACGGTCAGCGATCCAGAGCC CCGCCATCCGCTTCCTCCGCAGCTCTTCAACGACGAAGAGTACTGCGGCG ACTACGACGCCTTCGACATGGCCAACGAGATCGACACCCTGGAGGTGTTC CTCAAACTGGCCCCAGCCGACACCACGGCGGTTAGTACCGCCCAAATCGA ACTGAAGCAGGAGAACGGCGATGCCAAGAAGGAGGAGGCTGAAGCGGAGG CGGTAACGGATGCGGATGCGGAGGCAAAGAAACCGGAGGCCGGTGATGGC GGTGCCAAGGAGGAGGAGGAGGTGGCTGCGGAGAAGGCCGAGAATGAAGA CGATGCCGGCGCGGACAAGGAGAATTCGAAGGGCGAGGATGAGGACGCT- --GAAGATAGTACCGAGCAAAAGAAGTCATCAACGACAACAACAGCAGCA GCA---------GCTAAGAAGACTTCAGATTCCCAATCGGATCTTTTATT GCACAGCGAGCGGGCAGCGGCTGCGCAG------------------
>D_melanogaster_Sh3beta-PD MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF LKLAPADTTAVSTAQIELKQENGDAKKEEAETEAED------KKTEAGDG DVDVKEE-AAEKAENEDG--KDKENSKGEDEDADEENAEQKKLPATTTTT AAS-AKKTSDSQSDLLLDSERAAAAQ >D_sechellia_Sh3beta-PD MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAED------KKPESGDG DVDVKEE-AAEKAENEDADDKDKENSKGEDEDADEENAEQKKLPATTTTT TAP-ARKTSDSQSDLLLDSERAAAAQ >D_simulans_Sh3beta-PD MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL MQNKSTSNGGTVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVF LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAED------KKPESGDG DVDVKEE-AAEKAENEDADGKDKENSKGEDEDADEEKAEQKKLPATTTTT TAVPAKKTSDSQSDLLLDSERAAAAQ >D_yakuba_Sh3beta-PD MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL MQNKSTSNGGTVSDPEPRHPLPPQLFNDEEYCGDYDAFDMANEIDTLEVF LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAAT--DAEEKKPEAGDG GVKEEEE-AAEKAENEDADGEDKENSKGEAEDA-EDSAEQKKLPATTTAA APAAAKKTSDSQSDLLLDSERAAAAQ >D_erecta_Sh3beta-PD MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKEL MQNKSTSSGGTVSDPEPRHPLPPQLFNDEEYCGDYDAFDMANEIDTLEVF LKLAPADTTAVSTAQIELKQENGDAKKEEAEAEAVTDADAEAKKPEAGDG GAKEEEEVAAEKAENEDDAGADKENSKGEDEDA-EDSTEQKKSSTTTTAA A---AKKTSDSQSDLLLHSERAAAAQ
#NEXUS
[ID: 1335194559]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_Sh3beta-PD
D_sechellia_Sh3beta-PD
D_simulans_Sh3beta-PD
D_yakuba_Sh3beta-PD
D_erecta_Sh3beta-PD
;
end;
begin trees;
translate
1 D_melanogaster_Sh3beta-PD,
2 D_sechellia_Sh3beta-PD,
3 D_simulans_Sh3beta-PD,
4 D_yakuba_Sh3beta-PD,
5 D_erecta_Sh3beta-PD
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.03030583,(4:0.01726355,5:0.05866009)1.000:0.09061313,(2:0.007230705,3:0.006363976)0.989:0.01877805);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.03030583,(4:0.01726355,5:0.05866009):0.09061313,(2:0.007230705,3:0.006363976):0.01877805);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1376.43 -1386.23
2 -1376.33 -1385.10
--------------------------------------
TOTAL -1376.38 -1385.82
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/388/Sh3beta-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.245947 0.003421 0.143919 0.356169 0.237742 919.75 972.01 1.000
r(A<->C){all} 0.121452 0.001667 0.045269 0.200004 0.118120 677.66 761.03 1.004
r(A<->G){all} 0.200509 0.002966 0.096745 0.305449 0.195137 538.05 560.51 1.000
r(A<->T){all} 0.064904 0.002136 0.000031 0.155143 0.056065 473.08 511.44 1.002
r(C<->G){all} 0.055005 0.000722 0.007483 0.105874 0.051649 821.65 838.37 1.001
r(C<->T){all} 0.461794 0.007688 0.300553 0.637470 0.458618 509.84 542.51 1.000
r(G<->T){all} 0.096337 0.002009 0.024136 0.195141 0.091447 690.87 724.05 1.001
pi(A){all} 0.292734 0.000275 0.263970 0.328779 0.292694 975.36 1183.48 1.000
pi(C){all} 0.252308 0.000256 0.224027 0.287139 0.252021 660.18 907.27 1.002
pi(G){all} 0.324905 0.000292 0.290451 0.356492 0.324760 1215.40 1244.71 1.000
pi(T){all} 0.130053 0.000154 0.106488 0.154858 0.129895 1094.80 1138.73 1.000
alpha{1,2} 0.131087 0.013099 0.000107 0.321803 0.110951 1147.56 1232.66 1.000
alpha{3} 1.168827 0.423586 0.189351 2.509427 1.025760 1351.59 1394.81 1.000
pinvar{all} 0.471747 0.019497 0.186225 0.711103 0.485187 871.46 940.02 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/388/Sh3beta-PD/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 213
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 1 0 0 0 0 | Ser TCT 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 | Cys TGT 0 0 0 0 0
TTC 2 3 3 3 3 | TCC 3 4 4 3 3 | TAC 4 4 4 4 4 | TGC 1 1 1 1 1
Leu TTA 2 2 2 2 1 | TCA 2 2 2 2 3 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 2 2 2 2 2 | TCG 2 2 2 2 3 | TAG 0 0 0 0 0 | Trp TGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 2 | Pro CCT 1 1 1 1 1 | His CAT 1 1 1 1 1 | Arg CGT 1 1 1 1 0
CTC 2 3 3 3 2 | CCC 2 2 2 3 2 | CAC 0 0 0 0 1 | CGC 2 2 2 2 3
CTA 0 1 1 0 0 | CCA 3 3 3 2 2 | Gln CAA 4 3 3 3 3 | CGA 0 0 0 1 0
CTG 7 5 5 6 6 | CCG 2 3 3 3 3 | CAG 5 6 6 6 6 | CGG 1 1 1 0 1
----------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 | Thr ACT 1 1 1 1 1 | Asn AAT 3 3 2 2 3 | Ser AGT 1 1 1 1 2
ATC 5 5 5 5 5 | ACC 4 5 5 3 4 | AAC 7 7 7 7 5 | AGC 5 5 5 6 6
ATA 0 0 0 0 0 | ACA 5 5 5 4 3 | Lys AAA 3 4 4 4 4 | Arg AGA 0 0 0 0 0
Met ATG 5 5 5 5 5 | ACG 6 4 4 5 7 | AAG 21 19 21 19 19 | AGG 0 1 0 0 0
----------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 | Ala GCT 5 4 4 6 5 | Asp GAT 11 11 11 6 8 | Gly GGT 2 1 1 1 2
GTC 5 5 5 5 4 | GCC 8 8 8 9 9 | GAC 12 12 12 13 12 | GGC 8 8 8 10 9
GTA 0 0 0 0 2 | GCA 4 2 2 6 4 | Glu GAA 6 7 7 7 7 | GGA 1 1 1 0 0
GTG 4 4 4 3 2 | GCG 5 8 8 7 7 | GAG 23 22 22 24 23 | GGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Sh3beta-PD
position 1: T:0.08920 C:0.15023 A:0.30986 G:0.45070
position 2: T:0.17840 C:0.24883 A:0.46948 G:0.10329
position 3: T:0.14085 C:0.32864 A:0.14085 G:0.38967
Average T:0.13615 C:0.24257 A:0.30673 G:0.31455
#2: D_sechellia_Sh3beta-PD
position 1: T:0.09390 C:0.15493 A:0.30516 G:0.44601
position 2: T:0.17840 C:0.25352 A:0.46479 G:0.10329
position 3: T:0.12676 C:0.34742 A:0.14085 G:0.38498
Average T:0.13302 C:0.25196 A:0.30360 G:0.31142
#3: D_simulans_Sh3beta-PD
position 1: T:0.09390 C:0.15493 A:0.30516 G:0.44601
position 2: T:0.17840 C:0.25352 A:0.46948 G:0.09859
position 3: T:0.12207 C:0.34742 A:0.14085 G:0.38967
Average T:0.13146 C:0.25196 A:0.30516 G:0.31142
#4: D_yakuba_Sh3beta-PD
position 1: T:0.08920 C:0.15493 A:0.29108 G:0.46479
position 2: T:0.17371 C:0.26761 A:0.45070 G:0.10798
position 3: T:0.10798 C:0.36150 A:0.14554 G:0.38498
Average T:0.12363 C:0.26135 A:0.29577 G:0.31925
#5: D_erecta_Sh3beta-PD
position 1: T:0.09390 C:0.15493 A:0.30047 G:0.45070
position 2: T:0.16901 C:0.26761 A:0.45070 G:0.11268
position 3: T:0.12676 C:0.34272 A:0.13615 G:0.39437
Average T:0.12989 C:0.25509 A:0.29577 G:0.31925
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 1 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 14 | TCC 17 | TAC 20 | TGC 5
Leu L TTA 9 | TCA 11 | *** * TAA 0 | *** * TGA 0
TTG 10 | TCG 11 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 5 | His H CAT 5 | Arg R CGT 4
CTC 13 | CCC 11 | CAC 1 | CGC 11
CTA 2 | CCA 13 | Gln Q CAA 16 | CGA 1
CTG 29 | CCG 14 | CAG 29 | CGG 4
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 5 | Asn N AAT 13 | Ser S AGT 6
ATC 25 | ACC 21 | AAC 33 | AGC 27
ATA 0 | ACA 22 | Lys K AAA 19 | Arg R AGA 0
Met M ATG 25 | ACG 26 | AAG 99 | AGG 1
------------------------------------------------------------------------------
Val V GTT 10 | Ala A GCT 24 | Asp D GAT 47 | Gly G GGT 7
GTC 24 | GCC 42 | GAC 61 | GGC 43
GTA 2 | GCA 18 | Glu E GAA 34 | GGA 3
GTG 17 | GCG 35 | GAG 114 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.09202 C:0.15399 A:0.30235 G:0.45164
position 2: T:0.17559 C:0.25822 A:0.46103 G:0.10516
position 3: T:0.12488 C:0.34554 A:0.14085 G:0.38873
Average T:0.13083 C:0.25258 A:0.30141 G:0.31518
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Sh3beta-PD
D_sechellia_Sh3beta-PD 0.1053 (0.0121 0.1152)
D_simulans_Sh3beta-PD 0.1052 (0.0121 0.1153)-1.0000 (0.0040 0.0000)
D_yakuba_Sh3beta-PD 0.2250 (0.0402 0.1788) 0.2640 (0.0402 0.1524) 0.2638 (0.0402 0.1526)
D_erecta_Sh3beta-PD 0.2350 (0.0541 0.2303) 0.2919 (0.0563 0.1928) 0.2916 (0.0563 0.1930) 0.1842 (0.0225 0.1220)
Model 0: one-ratio
TREE # 1: (1, (4, 5), (2, 3)); MP score: 68
lnL(ntime: 7 np: 9): -1204.191742 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.061879 0.137033 0.034394 0.104396 0.035214 0.004657 0.004734 2.095026 0.190251
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.38231
(1: 0.061879, (4: 0.034394, 5: 0.104396): 0.137033, (2: 0.004657, 3: 0.004734): 0.035214);
(D_melanogaster_Sh3beta-PD: 0.061879, (D_yakuba_Sh3beta-PD: 0.034394, D_erecta_Sh3beta-PD: 0.104396): 0.137033, (D_sechellia_Sh3beta-PD: 0.004657, D_simulans_Sh3beta-PD: 0.004734): 0.035214);
Detailed output identifying parameters
kappa (ts/tv) = 2.09503
omega (dN/dS) = 0.19025
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.062 502.0 137.0 0.1903 0.0108 0.0567 5.4 7.8
6..7 0.137 502.0 137.0 0.1903 0.0239 0.1255 12.0 17.2
7..4 0.034 502.0 137.0 0.1903 0.0060 0.0315 3.0 4.3
7..5 0.104 502.0 137.0 0.1903 0.0182 0.0956 9.1 13.1
6..8 0.035 502.0 137.0 0.1903 0.0061 0.0323 3.1 4.4
8..2 0.005 502.0 137.0 0.1903 0.0008 0.0043 0.4 0.6
8..3 0.005 502.0 137.0 0.1903 0.0008 0.0043 0.4 0.6
tree length for dN: 0.0666
tree length for dS: 0.3503
Time used: 0:02
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 68
lnL(ntime: 7 np: 10): -1196.659866 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.066008 0.148774 0.038431 0.112838 0.037031 0.004635 0.005108 2.166264 0.769524 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.41282
(1: 0.066008, (4: 0.038431, 5: 0.112838): 0.148774, (2: 0.004635, 3: 0.005108): 0.037031);
(D_melanogaster_Sh3beta-PD: 0.066008, (D_yakuba_Sh3beta-PD: 0.038431, D_erecta_Sh3beta-PD: 0.112838): 0.148774, (D_sechellia_Sh3beta-PD: 0.004635, D_simulans_Sh3beta-PD: 0.005108): 0.037031);
Detailed output identifying parameters
kappa (ts/tv) = 2.16626
dN/dS (w) for site classes (K=2)
p: 0.76952 0.23048
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.066 501.1 137.9 0.2305 0.0128 0.0555 6.4 7.7
6..7 0.149 501.1 137.9 0.2305 0.0288 0.1251 14.4 17.2
7..4 0.038 501.1 137.9 0.2305 0.0074 0.0323 3.7 4.5
7..5 0.113 501.1 137.9 0.2305 0.0219 0.0948 11.0 13.1
6..8 0.037 501.1 137.9 0.2305 0.0072 0.0311 3.6 4.3
8..2 0.005 501.1 137.9 0.2305 0.0009 0.0039 0.4 0.5
8..3 0.005 501.1 137.9 0.2305 0.0010 0.0043 0.5 0.6
Time used: 0:05
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 68
lnL(ntime: 7 np: 12): -1196.578461 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.067036 0.150913 0.039221 0.114830 0.037449 0.004661 0.005151 2.220301 0.802384 0.137117 0.013707 1.748410
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.41926
(1: 0.067036, (4: 0.039221, 5: 0.114830): 0.150913, (2: 0.004661, 3: 0.005151): 0.037449);
(D_melanogaster_Sh3beta-PD: 0.067036, (D_yakuba_Sh3beta-PD: 0.039221, D_erecta_Sh3beta-PD: 0.114830): 0.150913, (D_sechellia_Sh3beta-PD: 0.004661, D_simulans_Sh3beta-PD: 0.005151): 0.037449);
Detailed output identifying parameters
kappa (ts/tv) = 2.22030
dN/dS (w) for site classes (K=3)
p: 0.80238 0.13712 0.06050
w: 0.01371 1.00000 1.74841
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.067 500.4 138.6 0.2539 0.0136 0.0537 6.8 7.5
6..7 0.151 500.4 138.6 0.2539 0.0307 0.1210 15.4 16.8
7..4 0.039 500.4 138.6 0.2539 0.0080 0.0314 4.0 4.4
7..5 0.115 500.4 138.6 0.2539 0.0234 0.0921 11.7 12.8
6..8 0.037 500.4 138.6 0.2539 0.0076 0.0300 3.8 4.2
8..2 0.005 500.4 138.6 0.2539 0.0009 0.0037 0.5 0.5
8..3 0.005 500.4 138.6 0.2539 0.0010 0.0041 0.5 0.6
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Sh3beta-PD)
Pr(w>1) post mean +- SE for w
136 D 0.575 1.430
161 G 0.516 1.386
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Sh3beta-PD)
Pr(w>1) post mean +- SE for w
135 E 0.621 2.572 +- 2.087
136 D 0.728 2.899 +- 2.129
161 G 0.666 2.725 +- 2.124
177 N 0.608 2.464 +- 1.967
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.917 0.083 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.277 0.242 0.169 0.111 0.073 0.048 0.032 0.022 0.015 0.011
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.044
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005 0.054 0.434
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.013 0.102 0.245 0.100
sum of density on p0-p1 = 1.000000
Time used: 0:10
Model 3: discrete (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 68
check convergence..
lnL(ntime: 7 np: 13): -1196.575152 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.067111 0.151081 0.039245 0.115030 0.037487 0.004668 0.005149 2.220175 0.754304 0.146577 0.000001 0.614023 1.659870
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.41977
(1: 0.067111, (4: 0.039245, 5: 0.115030): 0.151081, (2: 0.004668, 3: 0.005149): 0.037487);
(D_melanogaster_Sh3beta-PD: 0.067111, (D_yakuba_Sh3beta-PD: 0.039245, D_erecta_Sh3beta-PD: 0.115030): 0.151081, (D_sechellia_Sh3beta-PD: 0.004668, D_simulans_Sh3beta-PD: 0.005149): 0.037487);
Detailed output identifying parameters
kappa (ts/tv) = 2.22017
dN/dS (w) for site classes (K=3)
p: 0.75430 0.14658 0.09912
w: 0.00000 0.61402 1.65987
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.067 500.4 138.6 0.2545 0.0137 0.0537 6.8 7.4
6..7 0.151 500.4 138.6 0.2545 0.0308 0.1210 15.4 16.8
7..4 0.039 500.4 138.6 0.2545 0.0080 0.0314 4.0 4.4
7..5 0.115 500.4 138.6 0.2545 0.0234 0.0921 11.7 12.8
6..8 0.037 500.4 138.6 0.2545 0.0076 0.0300 3.8 4.2
8..2 0.005 500.4 138.6 0.2545 0.0010 0.0037 0.5 0.5
8..3 0.005 500.4 138.6 0.2545 0.0010 0.0041 0.5 0.6
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Sh3beta-PD)
Pr(w>1) post mean +- SE for w
135 E 0.751 1.399
136 D 0.850 1.503
139 T 0.519 1.157
145 D 0.529 1.168
147 D 0.664 1.308
148 V 0.597 1.238
161 G 0.781 1.431
162 K 0.643 1.286
171 D 0.515 1.152
177 N 0.762 1.411
183 L 0.617 1.259
184 P 0.603 1.245
189 T 0.573 1.214
190 T 0.573 1.214
191 A 0.588 1.229
Time used: 0:32
Model 7: beta (10 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 68
check convergence..
lnL(ntime: 7 np: 10): -1196.767390 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.065439 0.147588 0.037906 0.111907 0.036705 0.004631 0.005031 2.122388 0.011297 0.036938
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.40921
(1: 0.065439, (4: 0.037906, 5: 0.111907): 0.147588, (2: 0.004631, 3: 0.005031): 0.036705);
(D_melanogaster_Sh3beta-PD: 0.065439, (D_yakuba_Sh3beta-PD: 0.037906, D_erecta_Sh3beta-PD: 0.111907): 0.147588, (D_sechellia_Sh3beta-PD: 0.004631, D_simulans_Sh3beta-PD: 0.005031): 0.036705);
Detailed output identifying parameters
kappa (ts/tv) = 2.12239
Parameters in M7 (beta):
p = 0.01130 q = 0.03694
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.13057 0.99999 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.065 501.7 137.3 0.2131 0.0122 0.0571 6.1 7.8
6..7 0.148 501.7 137.3 0.2131 0.0274 0.1287 13.8 17.7
7..4 0.038 501.7 137.3 0.2131 0.0070 0.0331 3.5 4.5
7..5 0.112 501.7 137.3 0.2131 0.0208 0.0976 10.4 13.4
6..8 0.037 501.7 137.3 0.2131 0.0068 0.0320 3.4 4.4
8..2 0.005 501.7 137.3 0.2131 0.0009 0.0040 0.4 0.6
8..3 0.005 501.7 137.3 0.2131 0.0009 0.0044 0.5 0.6
Time used: 0:58
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 68
check convergence..
lnL(ntime: 7 np: 12): -1196.576670 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.067054 0.150946 0.039223 0.114857 0.037451 0.004664 0.005149 2.219974 0.872326 0.054454 0.681718 1.507942
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.41934
(1: 0.067054, (4: 0.039223, 5: 0.114857): 0.150946, (2: 0.004664, 3: 0.005149): 0.037451);
(D_melanogaster_Sh3beta-PD: 0.067054, (D_yakuba_Sh3beta-PD: 0.039223, D_erecta_Sh3beta-PD: 0.114857): 0.150946, (D_sechellia_Sh3beta-PD: 0.004664, D_simulans_Sh3beta-PD: 0.005149): 0.037451);
Detailed output identifying parameters
kappa (ts/tv) = 2.21997
Parameters in M8 (beta&w>1):
p0 = 0.87233 p = 0.05445 q = 0.68172
(p1 = 0.12767) w = 1.50794
dN/dS (w) for site classes (K=11)
p: 0.08723 0.08723 0.08723 0.08723 0.08723 0.08723 0.08723 0.08723 0.08723 0.08723 0.12767
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 0.00071 0.00981 0.09517 0.59799 1.50794
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.067 500.4 138.6 0.2539 0.0137 0.0538 6.8 7.5
6..7 0.151 500.4 138.6 0.2539 0.0307 0.1210 15.4 16.8
7..4 0.039 500.4 138.6 0.2539 0.0080 0.0314 4.0 4.4
7..5 0.115 500.4 138.6 0.2539 0.0234 0.0921 11.7 12.8
6..8 0.037 500.4 138.6 0.2539 0.0076 0.0300 3.8 4.2
8..2 0.005 500.4 138.6 0.2539 0.0009 0.0037 0.5 0.5
8..3 0.005 500.4 138.6 0.2539 0.0010 0.0041 0.5 0.6
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Sh3beta-PD)
Pr(w>1) post mean +- SE for w
58 N 0.537 1.031
79 D 0.567 1.066
132 T 0.593 1.094
135 E 0.853 1.372
136 D 0.914 1.429
139 T 0.655 1.161
141 A 0.635 1.139
145 D 0.663 1.170
146 V 0.593 1.094
147 D 0.800 1.322
148 V 0.734 1.249
149 K 0.513 1.005
161 G 0.872 1.389
162 K 0.786 1.309
171 D 0.650 1.155
176 E 0.617 1.120
177 N 0.861 1.379
178 A 0.607 1.109
183 L 0.736 1.246
184 P 0.725 1.235
185 A 0.587 1.087
189 T 0.701 1.209
190 T 0.701 1.209
191 A 0.713 1.222
193 K 0.522 1.014
205 D 0.543 1.037
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Sh3beta-PD)
Pr(w>1) post mean +- SE for w
135 E 0.769 2.857 +- 1.968
136 D 0.880 3.180 +- 1.865
147 D 0.541 1.972 +- 1.704
161 G 0.813 2.995 +- 1.940
162 K 0.507 1.868 +- 1.683
177 N 0.769 2.825 +- 1.925
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.096 0.904
p : 0.777 0.209 0.013 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.003 0.053 0.109 0.127 0.127 0.128 0.137 0.150 0.165
ws: 0.203 0.270 0.229 0.139 0.075 0.040 0.022 0.012 0.007 0.004
Time used: 1:40
Model 1: NearlyNeutral -1196.659866 Model 2: PositiveSelection -1196.578461 Model 0: one-ratio -1204.191742 Model 3: discrete -1196.575152 Model 7: beta -1196.76739 Model 8: beta&w>1 -1196.57667 Model 0 vs 1 15.063752000000022 Model 2 vs 1 0.1628099999998085 Model 8 vs 7 0.38144000000011147
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
