--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Tue Dec 06 23:24:49 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/382/schlank-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/382/schlank-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/382/schlank-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/382/schlank-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2535.22         -2545.69
2      -2535.35         -2545.02
--------------------------------------
TOTAL    -2535.28         -2545.41
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/382/schlank-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/382/schlank-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/382/schlank-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.387248    0.004047    0.275100    0.511989    0.382488   1364.33   1424.24    1.000
r(A<->C){all}   0.080466    0.000813    0.028795    0.137364    0.078280    941.42   1031.93    1.000
r(A<->G){all}   0.335122    0.003217    0.223130    0.443670    0.332225    705.71    748.18    1.005
r(A<->T){all}   0.060653    0.000960    0.003815    0.117282    0.057816    837.43    865.26    1.000
r(C<->G){all}   0.057069    0.000461    0.016279    0.100411    0.054853   1042.26   1054.33    1.001
r(C<->T){all}   0.404402    0.003547    0.284473    0.513822    0.403600    710.20    767.09    1.003
r(G<->T){all}   0.062288    0.000522    0.023056    0.109547    0.059750    953.07   1013.61    1.001
pi(A){all}      0.227901    0.000129    0.205252    0.249712    0.227708   1148.67   1189.33    1.000
pi(C){all}      0.265516    0.000151    0.239056    0.287095    0.265461   1258.12   1266.89    1.000
pi(G){all}      0.266807    0.000145    0.243452    0.289919    0.266751   1119.59   1217.26    1.000
pi(T){all}      0.239776    0.000142    0.215294    0.261893    0.239496    961.37   1034.61    1.001
alpha{1,2}      0.041028    0.000792    0.000152    0.089722    0.037291   1227.53   1364.27    1.000
alpha{3}        2.294618    0.658746    0.960641    3.969793    2.174566   1361.58   1391.92    1.000
pinvar{all}     0.555929    0.002168    0.462755    0.642564    0.559040   1184.04   1321.71    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2315.803937
Model 2: PositiveSelection	-2313.929858
Model 0: one-ratio	-2337.679051
Model 3: discrete	-2313.835665
Model 7: beta	-2315.881008
Model 8: beta&w>1	-2313.856965


Model 0 vs 1	43.75022799999988

Model 2 vs 1	3.7481580000003305

Model 8 vs 7	4.048085999999785
>C1
MDILNEFSNVFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
AVVMLVRYTLERFWISPVGKSLGIRSSRPKKAANVPILEKTYAKSTRLDK
KKLVPLSKQTDMSEREIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSGNARLTNGSARSKNKSISSAPSDKGSAGGAGSRAGARVATTERREE

>C2
MDILNEFSNVFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
AVVMLVRYTLERFWISPVGKSLGIRSSRPKKAANVPILEKTYGKSTRLDK
KKLVPLAKQTDMSEREIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSGNARLANGSARSKNKSNTSAPSDKVSVGGAGSRAGAKAATTERREE

>C3
MDILNEFSNVFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
AVVMLVRYTLERFWISPVGKSLGIRSSRPKKAANVPILEKTYGKSTRLDK
KKLVPLSKQTDMSEREIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSGNARLANGSARSKNKSNSSAPSDKGSVGGAGPRAGARAATTERREE

>C4
MNIVNQISNAFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
AVVMLARYTLERFWISPVGKSLGIRSSRPKKAANVPILEAAYAKSTRLNQ
KWLAPLSKQTDMSKRQIDRWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRIGSLVLVVHDCADIFLE
AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSENARLANGSARTKNKPSVAKSDGGAGAooooooooooooooooooo

>C5
MDLINKFSDAFWSTHIWLPPNTTWADIAPGSRQDVVHANYKDLIWPIPFA
AVVMLVRYTLERFWISPIGKSLGIRSSRPKKAANVPILETAYAKSTRLDN
KWLAPLSKQTDMSERQIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISSDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
AAKLTKYANYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSENARLANGSARSKNKSNSGAPSAGGSAGGAGTGooooooooooooo

CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=405 

C1              MDILNEFSNVFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
C2              MDILNEFSNVFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
C3              MDILNEFSNVFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
C4              MNIVNQISNAFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
C5              MDLINKFSDAFWSTHIWLPPNTTWADIAPGSRQDVVHANYKDLIWPIPFA
                *:::*::*:.********************** *****************

C1              AVVMLVRYTLERFWISPVGKSLGIRSSRPKKAANVPILEKTYAKSTRLDK
C2              AVVMLVRYTLERFWISPVGKSLGIRSSRPKKAANVPILEKTYGKSTRLDK
C3              AVVMLVRYTLERFWISPVGKSLGIRSSRPKKAANVPILEKTYGKSTRLDK
C4              AVVMLARYTLERFWISPVGKSLGIRSSRPKKAANVPILEAAYAKSTRLNQ
C5              AVVMLVRYTLERFWISPIGKSLGIRSSRPKKAANVPILETAYAKSTRLDN
                *****.***********:********************* :*.*****::

C1              KKLVPLSKQTDMSEREIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
C2              KKLVPLAKQTDMSEREIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
C3              KKLVPLSKQTDMSEREIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
C4              KWLAPLSKQTDMSKRQIDRWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
C5              KWLAPLSKQTDMSERQIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
                * *.**:******:*:*:********************************

C1              IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
C2              IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
C3              IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
C4              IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
C5              IFGVIVLWDKPWFWDVKSCWYGYPHQSISSDIWWYYMISMSFYWSLTGTQ
                *****************************.********************

C1              FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
C2              FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
C3              FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
C4              FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRIGSLVLVVHDCADIFLE
C5              FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
                *********************************:****************

C1              AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
C2              AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
C3              AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
C4              AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
C5              AAKLTKYANYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
                ********:*****************************************

C1              FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
C2              FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
C3              FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
C4              FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
C5              FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
                **************************************************

C1              TDSSGNARLTNGSARSKNKSISSAPSDKGSAGGAGSRAGARVATTERREE
C2              TDSSGNARLANGSARSKNKSNTSAPSDKVSVGGAGSRAGAKAATTERREE
C3              TDSSGNARLANGSARSKNKSNSSAPSDKGSVGGAGPRAGARAATTERREE
C4              TDSSENARLANGSARTKNK-----PSVAKSDGGAGAoooooooooooooo
C5              TDSSENARLANGSARSKNKSNSGAPSAGGSAGGAGTGooooooooooooo
                **** ****:*****:***     **   * ****.              

C1              -----
C2              -----
C3              -----
C4              ooooo
C5              -----
                     




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  400 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  400 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8480]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [8480]--->[8317]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/382/schlank-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.317 Mb, Max= 30.701 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MDILNEFSNVFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
AVVMLVRYTLERFWISPVGKSLGIRSSRPKKAANVPILEKTYAKSTRLDK
KKLVPLSKQTDMSEREIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSGNARLTNGSARSKNKSISSAPSDKGSAGGAGSRAGARVATTERREE
-----
>C2
MDILNEFSNVFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
AVVMLVRYTLERFWISPVGKSLGIRSSRPKKAANVPILEKTYGKSTRLDK
KKLVPLAKQTDMSEREIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSGNARLANGSARSKNKSNTSAPSDKVSVGGAGSRAGAKAATTERREE
-----
>C3
MDILNEFSNVFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
AVVMLVRYTLERFWISPVGKSLGIRSSRPKKAANVPILEKTYGKSTRLDK
KKLVPLSKQTDMSEREIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSGNARLANGSARSKNKSNSSAPSDKGSVGGAGPRAGARAATTERREE
-----
>C4
MNIVNQISNAFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
AVVMLARYTLERFWISPVGKSLGIRSSRPKKAANVPILEAAYAKSTRLNQ
KWLAPLSKQTDMSKRQIDRWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRIGSLVLVVHDCADIFLE
AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSENARLANGSARTKNK-----PSVAKSDGGAGAoooooooooooooo
ooooo
>C5
MDLINKFSDAFWSTHIWLPPNTTWADIAPGSRQDVVHANYKDLIWPIPFA
AVVMLVRYTLERFWISPIGKSLGIRSSRPKKAANVPILETAYAKSTRLDN
KWLAPLSKQTDMSERQIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISSDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
AAKLTKYANYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSENARLANGSARSKNKSNSGAPSAGGSAGGAGTGooooooooooooo
-----

FORMAT of file /tmp/tmp6379013736922993564aln Not Supported[FATAL:T-COFFEE]
>C1
MDILNEFSNVFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
AVVMLVRYTLERFWISPVGKSLGIRSSRPKKAANVPILEKTYAKSTRLDK
KKLVPLSKQTDMSEREIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSGNARLTNGSARSKNKSISSAPSDKGSAGGAGSRAGARVATTERREE
-----
>C2
MDILNEFSNVFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
AVVMLVRYTLERFWISPVGKSLGIRSSRPKKAANVPILEKTYGKSTRLDK
KKLVPLAKQTDMSEREIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSGNARLANGSARSKNKSNTSAPSDKVSVGGAGSRAGAKAATTERREE
-----
>C3
MDILNEFSNVFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
AVVMLVRYTLERFWISPVGKSLGIRSSRPKKAANVPILEKTYGKSTRLDK
KKLVPLSKQTDMSEREIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSGNARLANGSARSKNKSNSSAPSDKGSVGGAGPRAGARAATTERREE
-----
>C4
MNIVNQISNAFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
AVVMLARYTLERFWISPVGKSLGIRSSRPKKAANVPILEAAYAKSTRLNQ
KWLAPLSKQTDMSKRQIDRWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRIGSLVLVVHDCADIFLE
AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSENARLANGSARTKNK-----PSVAKSDGGAGAoooooooooooooo
ooooo
>C5
MDLINKFSDAFWSTHIWLPPNTTWADIAPGSRQDVVHANYKDLIWPIPFA
AVVMLVRYTLERFWISPIGKSLGIRSSRPKKAANVPILETAYAKSTRLDN
KWLAPLSKQTDMSERQIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISSDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
AAKLTKYANYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSENARLANGSARSKNKSNSGAPSAGGSAGGAGTGooooooooooooo
-----
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:405 S:96 BS:405
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 97.75 C1	 C2	 97.75
TOP	    1    0	 97.75 C2	 C1	 97.75
BOT	    0    2	 98.50 C1	 C3	 98.50
TOP	    2    0	 98.50 C3	 C1	 98.50
BOT	    0    3	 90.38 C1	 C4	 90.38
TOP	    3    0	 90.38 C4	 C1	 90.38
BOT	    0    4	 91.00 C1	 C5	 91.00
TOP	    4    0	 91.00 C5	 C1	 91.00
BOT	    1    2	 98.75 C2	 C3	 98.75
TOP	    2    1	 98.75 C3	 C2	 98.75
BOT	    1    3	 90.13 C2	 C4	 90.13
TOP	    3    1	 90.13 C4	 C2	 90.13
BOT	    1    4	 90.25 C2	 C5	 90.25
TOP	    4    1	 90.25 C5	 C2	 90.25
BOT	    2    3	 90.38 C3	 C4	 90.38
TOP	    3    2	 90.38 C4	 C3	 90.38
BOT	    2    4	 91.00 C3	 C5	 91.00
TOP	    4    2	 91.00 C5	 C3	 91.00
BOT	    3    4	 93.92 C4	 C5	 93.92
TOP	    4    3	 93.92 C5	 C4	 93.92
AVG	 0	 C1	  *	 94.41
AVG	 1	 C2	  *	 94.22
AVG	 2	 C3	  *	 94.66
AVG	 3	 C4	  *	 91.20
AVG	 4	 C5	  *	 91.54
TOT	 TOT	  *	 93.21
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGACATATTGAATGAGTTCAGCAATGTATTCTGGAGTACGCACATTTG
C2              ATGGACATATTGAATGAGTTCAGCAATGTATTCTGGAGTACGCACATCTG
C3              ATGGACATATTGAATGAGTTCAGCAATGTATTCTGGAGTACGCACATCTG
C4              ATGAACATAGTCAATCAGATCAGCAATGCATTCTGGAGTACGCACATCTG
C5              ATGGATCTAATCAATAAGTTCAGCGATGCATTCTGGAGTACGCATATTTG
                ***.* .** * *** **:*****.*** *************** ** **

C1              GCTGCCGCCGAACACAACCTGGGCGGACATTGCGCCCGGCTCGCGTCCAG
C2              GCTGCCGCCGAACACAACCTGGGCGGACATTGCGCCCGGCTCGCGTCCAG
C3              GCTGCCGCCGAACACAACCTGGGCGGACATTGCGCCCGGCTCGCGTCCAG
C4              GCTGCCACCGAACACAACCTGGGCGGACATTGCGCCCGGCTCGCGACCAG
C5              GCTGCCGCCGAACACAACTTGGGCGGATATAGCGCCAGGTTCGCGACAGG
                ******.*********** ******** **:*****.** *****:*..*

C1              ATGTGGTGCACGCCAACTACAAGGACCTCATATGGCCCATTCCATTCGCC
C2              ATGTGGTGCACGCAAACTACAAGGACCTCATCTGGCCCATTCCATTCGCC
C3              ATGTGGTGCACGCAAACTACAAGGACCTCATCTGGCCCATTCCATTCGCC
C4              ATGTGGTACACGCCAATTACAAGGACCTCATCTGGCCCATTCCATTCGCC
C5              ATGTGGTGCACGCCAACTACAAGGACCTTATCTGGCCCATTCCATTCGCC
                *******.*****.** *********** **.******************

C1              GCTGTTGTCATGCTGGTCCGCTACACGCTGGAGCGTTTCTGGATATCGCC
C2              GCTGTCGTCATGCTGGTCCGCTACACGCTGGAGCGTTTCTGGATATCGCC
C3              GCTGTCGTCATGCTGGTCCGCTACACGCTGGAGCGTTTCTGGATATCGCC
C4              GCTGTCGTCATGCTGGCTCGCTACACGCTGGAGCGTTTCTGGATATCGCC
C5              GCTGTCGTCATGCTGGTCCGTTACACGCTGGAGCGTTTCTGGATATCGCC
                ***** **********  ** *****************************

C1              CGTAGGCAAATCACTTGGCATACGTAGTTCTAGGCCTAAGAAAGCGGCAA
C2              CGTAGGCAAATCACTGGGCATACGTAGTTCTAGGCCTAAGAAAGCGGCAA
C3              CGTAGGCAAATCACTGGGCATACGTAGTTCTAGGCCTAAGAAAGCGGCAA
C4              CGTAGGCAAATCACTGGGCATACGTAGTTCTAGACCTAAGAAAGCGGCAA
C5              AATAGGCAAATCACTGGGCATACGTAGTTCTAGACCTAAGAAAGCAGCAA
                ..************* *****************.***********.****

C1              ATGTTCCTATTCTGGAGAAGACCTATGCCAAATCGACGCGATTGGACAAG
C2              ATGTTCCTATTCTGGAGAAGACCTATGGCAAATCGACGCGATTGGACAAG
C3              ATGTTCCTATTCTGGAGAAGACCTATGGCAAATCGACGCGATTGGACAAG
C4              ATGTTCCTATTTTGGAGGCGGCCTATGCCAAATCGACTCGATTGAACCAA
C5              ATGTTCCTATTTTGGAGACGGCCTATGCGAAATCAACGCGATTGGACAAC
                *********** *****..*.******  *****.** ******.**.* 

C1              AAAAAGCTGGTTCCGCTGTCCAAGCAGACGGATATGAGCGAGCGCGAAAT
C2              AAAAAGTTGGTTCCGCTGGCCAAGCAGACGGATATGAGCGAGCGCGAAAT
C3              AAGAAGCTGGTTCCGCTGTCCAAGCAGACTGATATGAGCGAGCGCGAAAT
C4              AAATGGCTGGCTCCGCTGTCCAAGCAGACGGATATGAGCAAGCGCCAAAT
C5              AAATGGCTGGCTCCGCTGTCCAAACAAACGGATATGAGCGAGCGCCAAAT
                **.:.* *** ******* ****.**.** *********.***** ****

C1              CGAGCGCTGGTGGCGTCTACGCAGGGCCCAGGATAAACCGTCAACGCTGG
C2              CGAGCGCTGGTGGCGTTTACGCAGGGCCCAGGATAAACCGTCGACGCTGG
C3              CGAGCGCTGGTGGCGTTTACGCAGGGCCCAGGATAAACCGTCGACGCTGG
C4              CGACCGCTGGTGGCGTCTACGAAGGGCCCAGGATAAGCCGTCGACACTGG
C5              TGAGCGGTGGTGGCGTTTGCGAAGGGCCCAGGACAAGCCGTCAACCTTGG
                 ** ** ********* *.**.*********** **.*****.**  ***

C1              TGAAGTTCTGCGAGAACACGTGGCGTTGCATCTACTATCTGTACAGCTTC
C2              TGAAGTTCTGCGAGAACACGTGGCGCTGCATTTACTATCTGTACAGCTTC
C3              TGAAGTTCTGCGAGAACACGTGGCGCTGCATCTACTATCTGTACAGCTTC
C4              TTAAGTTCTGCGAGAACACCTGGCGCTGCATCTACTATCTGTACAGCTTC
C5              TGAAGTTCTGTGAGAATACCTGGCGCTGTATCTACTACCTGTACAGCTTC
                * ******** ***** ** ***** ** ** ***** ************

C1              ATCTTTGGCGTGATCGTGCTGTGGGACAAGCCCTGGTTTTGGGATGTGAA
C2              ATCTTTGGCGTGATCGTGCTGTGGGACAAGCCCTGGTTCTGGGATGTAAA
C3              ATCTTTGGCGTGATCGTGCTGTGGGACAAGCCCTGGTTCTGGGATGTGAA
C4              ATCTTTGGCGTGATCGTGCTATGGGACAAGCCGTGGTTCTGGGATGTGAA
C5              ATCTTTGGCGTGATTGTACTGTGGGACAAGCCCTGGTTCTGGGATGTGAA
                ************** **.**.*********** ***** ********.**

C1              GAGCTGCTGGTACGGCTACCCGCATCAGTCGATCAGCAATGATATCTGGT
C2              GAGCTGCTGGTACGGCTACCCGCATCAGTCGATCAGCAATGATATCTGGT
C3              GAGCTGCTGGTACGGCTACCCGCATCAGTCGATCAGCAATGATATCTGGT
C4              GAGCTGCTGGTACGGCTACCCGCATCAGTCGATCAGCAATGATATCTGGT
C5              GAGCTGCTGGTACGGCTACCCGCATCAGTCGATTAGCAGTGATATCTGGT
                ********************************* ****.***********

C1              GGTACTACATGATTTCGATGTCCTTCTACTGGTCACTCACTGGCACCCAG
C2              GGTACTACATGATTTCGATGTCCTTCTACTGGTCACTCACTGGCACCCAG
C3              GGTACTACATGATTTCGATGTCCTTCTACTGGTCACTCACTGGCACCCAG
C4              GGTACTACATGATTTCGATGTCATTCTACTGGTCACTCACTGGCACCCAG
C5              GGTACTACATGATTTCGATGTCTTTCTATTGGTCGCTCACTGGCACCCAG
                ********************** ***** *****.***************

C1              TTCTTCGATGTGAAACGCAAGGACTTCTGGCAGATGTTCATCCATCACAT
C2              TTCTTCGATGTGAAACGCAAGGACTTCTGGCAGATGTTCATCCATCACAT
C3              TTCTTCGATGTGAAACGCAAGGACTTCTGGCAGATGTTCATCCATCACAT
C4              TTCTTCGATGTGAAACGCAAGGACTTCTGGCAGATGTTCATCCATCACAT
C5              TTCTTCGATGTGAAACGCAAGGACTTTTGGCAGATGTTCATCCATCATAT
                ************************** ******************** **

C1              GGTCACCCTGCTCCTAATGTCGCTCAGCTGGGTGTGCAATCTGCATCGCG
C2              GGTCACCCTGCTCCTAATGTCGCTCAGCTGGGTATGCAATCTGCATCGCG
C3              GGTCACCCTGCTCCTAATGTCGCTCAGCTGGGTATGCAATCTGCATCGCG
C4              GGTCACCCTGCTGCTGATGTCACTCAGCTGGGTGTGCAATTTGCATCGCA
C5              GGTTACCCTGCTGCTGATGTCGCTCAGCTGGGTGTGCAACCTGCATCGCG
                *** ******** **.*****.***********.*****  ********.

C1              TCGGTTCGCTCGTCCTAGTCGTTCACGATTGTGCTGACATCTTCTTGGAG
C2              TCGGTTCGCTCGTCCTGGTCGTTCACGATTGCGCCGACATCTTCTTGGAG
C3              TCGGTTCGCTCGTCCTGGTCGTTCACGATTGCGCCGACATCTTCTTGGAG
C4              TCGGTTCGCTCGTCCTGGTCGTTCACGATTGTGCGGACATCTTTTTGGAG
C5              TTGGTTCCCTAGTCCTTGTTGTACACGATTGTGCCGATATCTTTTTGGAG
                * ***** **.***** ** **:******** ** ** ***** ******

C1              GCCGCCAAACTCACCAAATATGCCAAATATCAGAAGCTCTGCGATGCAAT
C2              GCCGCCAAACTCACCAAATATGCCAAATATCAGAAGCTCTGCGATGCGAT
C3              GCCGCCAAACTCACCAAATATGCCAAATATCAGAAGCTCTGCGATGCTAT
C4              GCCGCCAAGCTCACCAAATATGCCAAGTATCAGAAGCTGTGCGATGCGAT
C5              GCAGCTAAGCTCACCAAATATGCCAACTATCAGAAGCTCTGCGATGCCAT
                **.** **.***************** *********** ******** **

C1              CTTTGCCATCTTCACAGTGGTGTGGATTGTTACGCGTCTGGGCTTCTATC
C2              CTTTGCCATCTTCACAGTGGTGTGGATTGTTACGCGTCTGGGCTTCTATC
C3              CTTTGCCATCTTCACAGTGGTGTGGATTGTTACGCGTCTGGGCTTCTATC
C4              CTTTGCCATCTTCACAGTGGTCTGGATTGTGACCCGTCTGGGCTTCTATC
C5              CTTTGCCATCTTCACAGTGGTTTGGATTGTTACGCGTCTTGGCTTTTATC
                ********************* ******** ** ***** ***** ****

C1              CACGCATCATTTATAGCTCATCCGTGGAAGCACCGCGCATTCTGCCCATG
C2              CACGCATCATTTATAGCTCATCTGTGGAAGCACCGCGCATTCTGCCCATG
C3              CACGCATCATTTACAGCTCATCTGTGGAAGCACCGCGCATTCTGCCCATG
C4              CACGCATCATTTACAGCTCATCTGTGGAAGCACCGCGCATTCTGCCCATG
C5              CACGCATCATATACAGCTCATCTGTGGAAGCACCGCGCATTCTGCCCATG
                **********:** ******** ***************************

C1              TTCCCAGCCTACTACATCTTCAACTCACTGCTTCTGATGCTGCTCGTCCT
C2              TTCCCAGCCTACTACATCTTCAACTCACTGCTTCTGATGCTGCTCGTCCT
C3              TTCCCAGCCTACTACATCTTCAACTCACTGCTTCTGATGCTGCTCGTCCT
C4              TTCCCAGCCTACTACATCTTCAACTCATTGCTTCTGATGCTGCTCGTCCT
C5              TTCCCAGCCTACTACATCTTCAACTCATTGCTTCTGATGCTGCTCGTCCT
                *************************** **********************

C1              GCACGTCATCTGGACATACATGATCCTCAAGATTGTTGTCGACTCTCTGC
C2              GCACGTCATCTGGACATACATGATCCTCAAGATCGTTGTCGACTCTCTGC
C3              GCACGTCATCTGGACATACATGATCCTCAAGATCGTTGTCGACTCTCTGC
C4              ACACGTGATCTGGACATACATGATCCTCAAGATCGTTGTCGACTCTCTGC
C5              GCACGTCATCTGGACATATATGATTCTCAAGATCGTTGTCGACTCTCTGC
                .***** *********** ***** ******** ****************

C1              AGAAGGGTCTGATGTCCGGTGACATACGTTCCAGTGATAGTGAGGATCTC
C2              AGAAGGGTCTGATGTCCGGTGACATACGTTCCAGTGATAGTGAGGATCTC
C3              AGAAGGGTCTGATGTCCGGTGACATACGTTCCAGTGATAGTGAGGATCTC
C4              AGAAGGGTCTGATGTCCGGTGACATACGTTCCAGTGATAGTGAGGATCTC
C5              AAAAGGGTCTGATGTCCGGTGACATACGTTCCAGTGATAGTGAGGATCTC
                *.************************************************

C1              ACAGACAGTTCGGGGAATGCACGTCTGACCAATGGCTCGGCGCGCTCCAA
C2              ACAGACAGTTCGGGGAATGCACGTCTGGCCAATGGCTCGGCGCGCTCCAA
C3              ACAGACAGTTCGGGGAATGCACGTCTGGCCAATGGCTCGGCGCGCTCCAA
C4              ACAGACAGTTCGGAGAATGCACGTCTGGCCAATGGCTCGGCGCGCACCAA
C5              ACAGACAGTTCGGAGAATGCACGTCTGGCCAACGGATCGGCACGCTCTAA
                *************.*************.**** **.*****.***:* **

C1              GAACAAGTCGATCAGCAGTGCGCCATCGGATAAAGGATCTGCCGGAGGAG
C2              GAACAAGTCGAACACCAGTGCGCCATCGGATAAGGTATCTGTCGGAGGAG
C3              GAACAAGTCGAACAGCAGTGCGCCATCGGATAAGGGATCTGTCGGAGGAG
C4              GAACAAG---------------CCTTCGGTTGCAAAATCTGACGGAGGAG
C5              GAACAAGTCGAACAGCGGTGCGCCGTCAGCCGGAGGATCTGCAGGAGGAG
                *******               ** **.*  . .. ***** .*******

C1              CAGGATCAAGAGCAGGAGCAAGAGTTGCGACAACGGAACGGAGAGAGGAG
C2              CAGGATCAAGAGCAGGAGCAAAAGCTGCGACAACGGAACGGAGAGAGGAG
C3              CAGGACCAAGAGCCGGAGCAAGAGCTGCGACAACGGAACGGAGAGAGGAG
C4              CAGGAGCA------------------------------------------
C5              CAGGAACAGGA---------------------------------------
                ***** **                                          

C1              ---------------
C2              ---------------
C3              ---------------
C4              ---------------
C5              ---------------
                               



>C1
ATGGACATATTGAATGAGTTCAGCAATGTATTCTGGAGTACGCACATTTG
GCTGCCGCCGAACACAACCTGGGCGGACATTGCGCCCGGCTCGCGTCCAG
ATGTGGTGCACGCCAACTACAAGGACCTCATATGGCCCATTCCATTCGCC
GCTGTTGTCATGCTGGTCCGCTACACGCTGGAGCGTTTCTGGATATCGCC
CGTAGGCAAATCACTTGGCATACGTAGTTCTAGGCCTAAGAAAGCGGCAA
ATGTTCCTATTCTGGAGAAGACCTATGCCAAATCGACGCGATTGGACAAG
AAAAAGCTGGTTCCGCTGTCCAAGCAGACGGATATGAGCGAGCGCGAAAT
CGAGCGCTGGTGGCGTCTACGCAGGGCCCAGGATAAACCGTCAACGCTGG
TGAAGTTCTGCGAGAACACGTGGCGTTGCATCTACTATCTGTACAGCTTC
ATCTTTGGCGTGATCGTGCTGTGGGACAAGCCCTGGTTTTGGGATGTGAA
GAGCTGCTGGTACGGCTACCCGCATCAGTCGATCAGCAATGATATCTGGT
GGTACTACATGATTTCGATGTCCTTCTACTGGTCACTCACTGGCACCCAG
TTCTTCGATGTGAAACGCAAGGACTTCTGGCAGATGTTCATCCATCACAT
GGTCACCCTGCTCCTAATGTCGCTCAGCTGGGTGTGCAATCTGCATCGCG
TCGGTTCGCTCGTCCTAGTCGTTCACGATTGTGCTGACATCTTCTTGGAG
GCCGCCAAACTCACCAAATATGCCAAATATCAGAAGCTCTGCGATGCAAT
CTTTGCCATCTTCACAGTGGTGTGGATTGTTACGCGTCTGGGCTTCTATC
CACGCATCATTTATAGCTCATCCGTGGAAGCACCGCGCATTCTGCCCATG
TTCCCAGCCTACTACATCTTCAACTCACTGCTTCTGATGCTGCTCGTCCT
GCACGTCATCTGGACATACATGATCCTCAAGATTGTTGTCGACTCTCTGC
AGAAGGGTCTGATGTCCGGTGACATACGTTCCAGTGATAGTGAGGATCTC
ACAGACAGTTCGGGGAATGCACGTCTGACCAATGGCTCGGCGCGCTCCAA
GAACAAGTCGATCAGCAGTGCGCCATCGGATAAAGGATCTGCCGGAGGAG
CAGGATCAAGAGCAGGAGCAAGAGTTGCGACAACGGAACGGAGAGAGGAG
---------------
>C2
ATGGACATATTGAATGAGTTCAGCAATGTATTCTGGAGTACGCACATCTG
GCTGCCGCCGAACACAACCTGGGCGGACATTGCGCCCGGCTCGCGTCCAG
ATGTGGTGCACGCAAACTACAAGGACCTCATCTGGCCCATTCCATTCGCC
GCTGTCGTCATGCTGGTCCGCTACACGCTGGAGCGTTTCTGGATATCGCC
CGTAGGCAAATCACTGGGCATACGTAGTTCTAGGCCTAAGAAAGCGGCAA
ATGTTCCTATTCTGGAGAAGACCTATGGCAAATCGACGCGATTGGACAAG
AAAAAGTTGGTTCCGCTGGCCAAGCAGACGGATATGAGCGAGCGCGAAAT
CGAGCGCTGGTGGCGTTTACGCAGGGCCCAGGATAAACCGTCGACGCTGG
TGAAGTTCTGCGAGAACACGTGGCGCTGCATTTACTATCTGTACAGCTTC
ATCTTTGGCGTGATCGTGCTGTGGGACAAGCCCTGGTTCTGGGATGTAAA
GAGCTGCTGGTACGGCTACCCGCATCAGTCGATCAGCAATGATATCTGGT
GGTACTACATGATTTCGATGTCCTTCTACTGGTCACTCACTGGCACCCAG
TTCTTCGATGTGAAACGCAAGGACTTCTGGCAGATGTTCATCCATCACAT
GGTCACCCTGCTCCTAATGTCGCTCAGCTGGGTATGCAATCTGCATCGCG
TCGGTTCGCTCGTCCTGGTCGTTCACGATTGCGCCGACATCTTCTTGGAG
GCCGCCAAACTCACCAAATATGCCAAATATCAGAAGCTCTGCGATGCGAT
CTTTGCCATCTTCACAGTGGTGTGGATTGTTACGCGTCTGGGCTTCTATC
CACGCATCATTTATAGCTCATCTGTGGAAGCACCGCGCATTCTGCCCATG
TTCCCAGCCTACTACATCTTCAACTCACTGCTTCTGATGCTGCTCGTCCT
GCACGTCATCTGGACATACATGATCCTCAAGATCGTTGTCGACTCTCTGC
AGAAGGGTCTGATGTCCGGTGACATACGTTCCAGTGATAGTGAGGATCTC
ACAGACAGTTCGGGGAATGCACGTCTGGCCAATGGCTCGGCGCGCTCCAA
GAACAAGTCGAACACCAGTGCGCCATCGGATAAGGTATCTGTCGGAGGAG
CAGGATCAAGAGCAGGAGCAAAAGCTGCGACAACGGAACGGAGAGAGGAG
---------------
>C3
ATGGACATATTGAATGAGTTCAGCAATGTATTCTGGAGTACGCACATCTG
GCTGCCGCCGAACACAACCTGGGCGGACATTGCGCCCGGCTCGCGTCCAG
ATGTGGTGCACGCAAACTACAAGGACCTCATCTGGCCCATTCCATTCGCC
GCTGTCGTCATGCTGGTCCGCTACACGCTGGAGCGTTTCTGGATATCGCC
CGTAGGCAAATCACTGGGCATACGTAGTTCTAGGCCTAAGAAAGCGGCAA
ATGTTCCTATTCTGGAGAAGACCTATGGCAAATCGACGCGATTGGACAAG
AAGAAGCTGGTTCCGCTGTCCAAGCAGACTGATATGAGCGAGCGCGAAAT
CGAGCGCTGGTGGCGTTTACGCAGGGCCCAGGATAAACCGTCGACGCTGG
TGAAGTTCTGCGAGAACACGTGGCGCTGCATCTACTATCTGTACAGCTTC
ATCTTTGGCGTGATCGTGCTGTGGGACAAGCCCTGGTTCTGGGATGTGAA
GAGCTGCTGGTACGGCTACCCGCATCAGTCGATCAGCAATGATATCTGGT
GGTACTACATGATTTCGATGTCCTTCTACTGGTCACTCACTGGCACCCAG
TTCTTCGATGTGAAACGCAAGGACTTCTGGCAGATGTTCATCCATCACAT
GGTCACCCTGCTCCTAATGTCGCTCAGCTGGGTATGCAATCTGCATCGCG
TCGGTTCGCTCGTCCTGGTCGTTCACGATTGCGCCGACATCTTCTTGGAG
GCCGCCAAACTCACCAAATATGCCAAATATCAGAAGCTCTGCGATGCTAT
CTTTGCCATCTTCACAGTGGTGTGGATTGTTACGCGTCTGGGCTTCTATC
CACGCATCATTTACAGCTCATCTGTGGAAGCACCGCGCATTCTGCCCATG
TTCCCAGCCTACTACATCTTCAACTCACTGCTTCTGATGCTGCTCGTCCT
GCACGTCATCTGGACATACATGATCCTCAAGATCGTTGTCGACTCTCTGC
AGAAGGGTCTGATGTCCGGTGACATACGTTCCAGTGATAGTGAGGATCTC
ACAGACAGTTCGGGGAATGCACGTCTGGCCAATGGCTCGGCGCGCTCCAA
GAACAAGTCGAACAGCAGTGCGCCATCGGATAAGGGATCTGTCGGAGGAG
CAGGACCAAGAGCCGGAGCAAGAGCTGCGACAACGGAACGGAGAGAGGAG
---------------
>C4
ATGAACATAGTCAATCAGATCAGCAATGCATTCTGGAGTACGCACATCTG
GCTGCCACCGAACACAACCTGGGCGGACATTGCGCCCGGCTCGCGACCAG
ATGTGGTACACGCCAATTACAAGGACCTCATCTGGCCCATTCCATTCGCC
GCTGTCGTCATGCTGGCTCGCTACACGCTGGAGCGTTTCTGGATATCGCC
CGTAGGCAAATCACTGGGCATACGTAGTTCTAGACCTAAGAAAGCGGCAA
ATGTTCCTATTTTGGAGGCGGCCTATGCCAAATCGACTCGATTGAACCAA
AAATGGCTGGCTCCGCTGTCCAAGCAGACGGATATGAGCAAGCGCCAAAT
CGACCGCTGGTGGCGTCTACGAAGGGCCCAGGATAAGCCGTCGACACTGG
TTAAGTTCTGCGAGAACACCTGGCGCTGCATCTACTATCTGTACAGCTTC
ATCTTTGGCGTGATCGTGCTATGGGACAAGCCGTGGTTCTGGGATGTGAA
GAGCTGCTGGTACGGCTACCCGCATCAGTCGATCAGCAATGATATCTGGT
GGTACTACATGATTTCGATGTCATTCTACTGGTCACTCACTGGCACCCAG
TTCTTCGATGTGAAACGCAAGGACTTCTGGCAGATGTTCATCCATCACAT
GGTCACCCTGCTGCTGATGTCACTCAGCTGGGTGTGCAATTTGCATCGCA
TCGGTTCGCTCGTCCTGGTCGTTCACGATTGTGCGGACATCTTTTTGGAG
GCCGCCAAGCTCACCAAATATGCCAAGTATCAGAAGCTGTGCGATGCGAT
CTTTGCCATCTTCACAGTGGTCTGGATTGTGACCCGTCTGGGCTTCTATC
CACGCATCATTTACAGCTCATCTGTGGAAGCACCGCGCATTCTGCCCATG
TTCCCAGCCTACTACATCTTCAACTCATTGCTTCTGATGCTGCTCGTCCT
ACACGTGATCTGGACATACATGATCCTCAAGATCGTTGTCGACTCTCTGC
AGAAGGGTCTGATGTCCGGTGACATACGTTCCAGTGATAGTGAGGATCTC
ACAGACAGTTCGGAGAATGCACGTCTGGCCAATGGCTCGGCGCGCACCAA
GAACAAG---------------CCTTCGGTTGCAAAATCTGACGGAGGAG
CAGGAGCA------------------------------------------
---------------
>C5
ATGGATCTAATCAATAAGTTCAGCGATGCATTCTGGAGTACGCATATTTG
GCTGCCGCCGAACACAACTTGGGCGGATATAGCGCCAGGTTCGCGACAGG
ATGTGGTGCACGCCAACTACAAGGACCTTATCTGGCCCATTCCATTCGCC
GCTGTCGTCATGCTGGTCCGTTACACGCTGGAGCGTTTCTGGATATCGCC
AATAGGCAAATCACTGGGCATACGTAGTTCTAGACCTAAGAAAGCAGCAA
ATGTTCCTATTTTGGAGACGGCCTATGCGAAATCAACGCGATTGGACAAC
AAATGGCTGGCTCCGCTGTCCAAACAAACGGATATGAGCGAGCGCCAAAT
TGAGCGGTGGTGGCGTTTGCGAAGGGCCCAGGACAAGCCGTCAACCTTGG
TGAAGTTCTGTGAGAATACCTGGCGCTGTATCTACTACCTGTACAGCTTC
ATCTTTGGCGTGATTGTACTGTGGGACAAGCCCTGGTTCTGGGATGTGAA
GAGCTGCTGGTACGGCTACCCGCATCAGTCGATTAGCAGTGATATCTGGT
GGTACTACATGATTTCGATGTCTTTCTATTGGTCGCTCACTGGCACCCAG
TTCTTCGATGTGAAACGCAAGGACTTTTGGCAGATGTTCATCCATCATAT
GGTTACCCTGCTGCTGATGTCGCTCAGCTGGGTGTGCAACCTGCATCGCG
TTGGTTCCCTAGTCCTTGTTGTACACGATTGTGCCGATATCTTTTTGGAG
GCAGCTAAGCTCACCAAATATGCCAACTATCAGAAGCTCTGCGATGCCAT
CTTTGCCATCTTCACAGTGGTTTGGATTGTTACGCGTCTTGGCTTTTATC
CACGCATCATATACAGCTCATCTGTGGAAGCACCGCGCATTCTGCCCATG
TTCCCAGCCTACTACATCTTCAACTCATTGCTTCTGATGCTGCTCGTCCT
GCACGTCATCTGGACATATATGATTCTCAAGATCGTTGTCGACTCTCTGC
AAAAGGGTCTGATGTCCGGTGACATACGTTCCAGTGATAGTGAGGATCTC
ACAGACAGTTCGGAGAATGCACGTCTGGCCAACGGATCGGCACGCTCTAA
GAACAAGTCGAACAGCGGTGCGCCGTCAGCCGGAGGATCTGCAGGAGGAG
CAGGAACAGGA---------------------------------------
---------------
>C1
MDILNEFSNVFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
AVVMLVRYTLERFWISPVGKSLGIRSSRPKKAANVPILEKTYAKSTRLDK
KKLVPLSKQTDMSEREIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSGNARLTNGSARSKNKSISSAPSDKGSAGGAGSRAGARVATTERREE

>C2
MDILNEFSNVFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
AVVMLVRYTLERFWISPVGKSLGIRSSRPKKAANVPILEKTYGKSTRLDK
KKLVPLAKQTDMSEREIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSGNARLANGSARSKNKSNTSAPSDKVSVGGAGSRAGAKAATTERREE

>C3
MDILNEFSNVFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
AVVMLVRYTLERFWISPVGKSLGIRSSRPKKAANVPILEKTYGKSTRLDK
KKLVPLSKQTDMSEREIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSGNARLANGSARSKNKSNSSAPSDKGSVGGAGPRAGARAATTERREE

>C4
MNIVNQISNAFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFA
AVVMLARYTLERFWISPVGKSLGIRSSRPKKAANVPILEAAYAKSTRLNQ
KWLAPLSKQTDMSKRQIDRWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRIGSLVLVVHDCADIFLE
AAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSENARLANGSARTKNKoooooPSVAKSDGGAGAoooooooooooooo

>C5
MDLINKFSDAFWSTHIWLPPNTTWADIAPGSRQDVVHANYKDLIWPIPFA
AVVMLVRYTLERFWISPIGKSLGIRSSRPKKAANVPILETAYAKSTRLDN
KWLAPLSKQTDMSERQIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSF
IFGVIVLWDKPWFWDVKSCWYGYPHQSISSDIWWYYMISMSFYWSLTGTQ
FFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLE
AAKLTKYANYQKLCDAIFAIFTVVWIVTRLGFYPRIIYSSSVEAPRILPM
FPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDL
TDSSENARLANGSARSKNKSNSGAPSAGGSAGGAGTGooooooooooooo



                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/382/schlank-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 1215 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1481066331
      Setting output file names to "/opt/ADOPS/382/schlank-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1874538206
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 3221571440
      Seed = 1363960235
      Swapseed = 1481066331
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 32 unique site patterns
      Division 2 has 26 unique site patterns
      Division 3 has 58 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3118.954665 -- -25.624409
         Chain 2 -- -3109.055651 -- -25.624409
         Chain 3 -- -3122.559684 -- -25.624409
         Chain 4 -- -3023.686295 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3108.723744 -- -25.624409
         Chain 2 -- -3122.559684 -- -25.624409
         Chain 3 -- -3113.270009 -- -25.624409
         Chain 4 -- -3113.270009 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3118.955] (-3109.056) (-3122.560) (-3023.686) * [-3108.724] (-3122.560) (-3113.270) (-3113.270) 
        500 -- (-2619.069) (-2619.692) [-2598.522] (-2607.523) * (-2597.700) (-2614.201) (-2613.694) [-2609.637] -- 0:33:19
       1000 -- (-2608.104) (-2598.473) [-2576.819] (-2604.436) * [-2596.129] (-2618.734) (-2606.644) (-2610.604) -- 0:16:39
       1500 -- (-2600.544) (-2583.221) [-2561.092] (-2583.184) * [-2573.213] (-2615.780) (-2601.836) (-2587.468) -- 0:11:05
       2000 -- (-2578.579) (-2582.289) [-2562.566] (-2552.773) * [-2565.715] (-2590.658) (-2584.086) (-2580.479) -- 0:08:19
       2500 -- (-2550.622) (-2584.411) [-2546.636] (-2550.919) * [-2549.308] (-2575.543) (-2570.301) (-2572.179) -- 0:06:39
       3000 -- (-2549.609) (-2561.809) (-2538.209) [-2549.021] * (-2544.276) (-2554.695) [-2562.187] (-2561.792) -- 0:05:32
       3500 -- (-2542.315) [-2546.092] (-2540.363) (-2545.482) * (-2548.891) (-2554.773) [-2544.217] (-2548.167) -- 0:04:44
       4000 -- [-2537.536] (-2543.711) (-2538.022) (-2544.675) * (-2547.317) (-2536.562) (-2540.831) [-2536.580] -- 0:04:09
       4500 -- (-2543.776) (-2542.425) (-2541.874) [-2537.366] * (-2544.678) (-2548.160) [-2540.437] (-2537.575) -- 0:07:22
       5000 -- (-2534.895) (-2535.716) [-2537.995] (-2540.112) * [-2535.319] (-2537.774) (-2543.627) (-2541.446) -- 0:06:38

      Average standard deviation of split frequencies: 0.000000

       5500 -- (-2541.963) (-2535.518) (-2539.891) [-2538.937] * (-2533.768) [-2541.177] (-2541.760) (-2540.515) -- 0:06:01
       6000 -- (-2541.136) (-2535.649) [-2541.131] (-2532.118) * (-2544.203) (-2541.559) (-2537.084) [-2537.526] -- 0:05:31
       6500 -- [-2544.280] (-2539.748) (-2539.089) (-2537.993) * (-2537.464) (-2540.982) (-2540.647) [-2541.654] -- 0:05:05
       7000 -- [-2540.331] (-2540.043) (-2541.070) (-2547.941) * (-2543.887) (-2536.706) (-2537.327) [-2536.164] -- 0:04:43
       7500 -- (-2539.601) (-2534.749) (-2546.777) [-2541.678] * [-2535.092] (-2538.380) (-2537.083) (-2535.581) -- 0:04:24
       8000 -- (-2538.959) [-2538.793] (-2546.158) (-2542.105) * [-2540.176] (-2534.187) (-2538.422) (-2535.374) -- 0:04:08
       8500 -- [-2543.018] (-2537.912) (-2548.819) (-2536.756) * (-2540.820) [-2548.949] (-2552.871) (-2540.375) -- 0:03:53
       9000 -- [-2536.764] (-2545.471) (-2537.861) (-2544.716) * (-2547.424) (-2542.886) (-2543.208) [-2540.622] -- 0:05:30
       9500 -- [-2535.646] (-2538.350) (-2542.826) (-2538.348) * (-2544.495) (-2533.355) (-2539.891) [-2536.076] -- 0:05:12
      10000 -- (-2544.516) [-2539.756] (-2537.567) (-2536.044) * [-2535.872] (-2540.924) (-2543.571) (-2536.062) -- 0:04:57

      Average standard deviation of split frequencies: 0.022097

      10500 -- (-2541.977) (-2537.228) [-2543.124] (-2538.351) * (-2541.520) (-2538.382) [-2547.552] (-2537.363) -- 0:04:42
      11000 -- (-2543.992) (-2536.517) (-2538.837) [-2538.905] * (-2546.236) [-2535.985] (-2541.014) (-2539.051) -- 0:04:29
      11500 -- [-2535.618] (-2541.075) (-2543.984) (-2540.288) * (-2535.987) (-2539.807) [-2537.594] (-2537.080) -- 0:04:17
      12000 -- [-2540.189] (-2542.035) (-2540.353) (-2540.149) * (-2539.591) (-2540.533) [-2540.787] (-2539.302) -- 0:04:07
      12500 -- (-2539.951) (-2543.043) (-2546.820) [-2539.731] * [-2541.965] (-2537.349) (-2539.727) (-2533.624) -- 0:03:57
      13000 -- (-2536.162) (-2535.085) [-2546.094] (-2543.807) * (-2544.317) (-2540.707) (-2540.082) [-2535.264] -- 0:03:47
      13500 -- (-2535.290) [-2539.776] (-2544.759) (-2538.450) * (-2539.036) (-2545.064) [-2537.806] (-2539.890) -- 0:04:52
      14000 -- (-2545.424) (-2540.519) (-2535.499) [-2536.194] * (-2550.372) (-2538.423) (-2538.625) [-2536.182] -- 0:04:41
      14500 -- (-2541.428) (-2539.011) (-2545.350) [-2534.857] * (-2537.888) (-2537.822) (-2539.986) [-2538.534] -- 0:04:31
      15000 -- (-2536.543) [-2535.689] (-2545.149) (-2537.872) * (-2547.901) (-2535.112) [-2541.689] (-2538.333) -- 0:04:22

      Average standard deviation of split frequencies: 0.044194

      15500 -- [-2540.797] (-2540.338) (-2536.312) (-2546.002) * (-2540.287) [-2542.092] (-2541.988) (-2540.037) -- 0:04:14
      16000 -- (-2540.550) (-2543.671) (-2540.929) [-2540.557] * (-2533.717) (-2539.877) (-2536.697) [-2539.451] -- 0:04:06
      16500 -- [-2536.777] (-2544.882) (-2542.550) (-2535.911) * (-2534.375) [-2545.557] (-2541.607) (-2545.061) -- 0:03:58
      17000 -- [-2536.617] (-2548.538) (-2542.096) (-2534.524) * (-2538.795) [-2541.398] (-2541.906) (-2547.260) -- 0:03:51
      17500 -- (-2542.980) (-2544.046) (-2542.881) [-2535.283] * [-2536.822] (-2541.549) (-2542.155) (-2541.554) -- 0:03:44
      18000 -- (-2541.808) (-2541.166) [-2544.635] (-2538.873) * (-2537.724) (-2544.224) (-2539.296) [-2543.844] -- 0:04:32
      18500 -- (-2536.948) [-2539.363] (-2548.255) (-2537.537) * [-2538.262] (-2542.747) (-2539.106) (-2546.713) -- 0:04:25
      19000 -- (-2537.153) (-2543.236) (-2551.678) [-2534.479] * [-2540.008] (-2547.265) (-2540.090) (-2542.872) -- 0:04:18
      19500 -- (-2532.647) [-2539.822] (-2545.055) (-2534.767) * (-2536.101) (-2544.180) (-2539.382) [-2541.360] -- 0:04:11
      20000 -- [-2537.300] (-2539.071) (-2539.099) (-2537.691) * (-2533.675) (-2544.017) (-2544.259) [-2536.444] -- 0:04:05

      Average standard deviation of split frequencies: 0.057025

      20500 -- (-2537.985) (-2545.177) [-2543.963] (-2538.381) * (-2535.650) (-2543.043) (-2538.981) [-2541.167] -- 0:03:58
      21000 -- (-2538.158) (-2537.745) (-2542.924) [-2534.189] * (-2543.582) [-2542.454] (-2541.415) (-2546.817) -- 0:03:53
      21500 -- (-2542.231) (-2542.885) (-2544.897) [-2534.766] * [-2537.048] (-2545.737) (-2534.165) (-2547.616) -- 0:03:47
      22000 -- (-2538.631) [-2538.209] (-2545.375) (-2536.902) * (-2542.443) (-2538.103) (-2536.002) [-2539.837] -- 0:03:42
      22500 -- (-2536.746) (-2535.987) (-2543.142) [-2535.989] * [-2538.707] (-2541.199) (-2542.219) (-2536.739) -- 0:04:20
      23000 -- (-2537.640) (-2543.755) [-2536.765] (-2536.992) * (-2536.208) (-2536.820) (-2539.107) [-2535.970] -- 0:04:14
      23500 -- (-2541.330) (-2539.392) (-2537.416) [-2540.456] * (-2540.059) (-2536.145) [-2536.184] (-2537.446) -- 0:04:09
      24000 -- (-2541.320) [-2539.676] (-2536.559) (-2541.592) * (-2536.369) (-2541.218) (-2541.571) [-2535.565] -- 0:04:04
      24500 -- (-2545.280) [-2539.210] (-2535.251) (-2539.498) * (-2536.426) [-2543.528] (-2536.815) (-2533.475) -- 0:03:58
      25000 -- (-2545.942) (-2538.871) [-2535.035] (-2537.449) * [-2541.049] (-2542.157) (-2539.412) (-2535.835) -- 0:03:54

      Average standard deviation of split frequencies: 0.060436

      25500 -- (-2539.938) (-2542.360) [-2531.943] (-2542.054) * [-2531.432] (-2540.054) (-2540.738) (-2537.985) -- 0:03:49
      26000 -- (-2541.969) (-2536.994) [-2537.966] (-2538.040) * (-2533.562) (-2541.692) (-2540.679) [-2538.597] -- 0:03:44
      26500 -- (-2541.921) (-2537.415) [-2538.781] (-2543.839) * (-2533.242) (-2537.980) (-2540.549) [-2538.309] -- 0:03:40
      27000 -- [-2542.886] (-2535.554) (-2537.557) (-2542.821) * [-2539.700] (-2545.452) (-2539.388) (-2540.503) -- 0:04:12
      27500 -- (-2541.193) [-2535.054] (-2539.351) (-2536.286) * (-2536.072) (-2547.352) [-2540.757] (-2541.967) -- 0:04:07
      28000 -- (-2534.473) [-2541.646] (-2539.949) (-2541.677) * (-2539.983) (-2537.316) (-2537.857) [-2542.092] -- 0:04:03
      28500 -- (-2535.564) [-2535.306] (-2539.305) (-2539.717) * (-2536.345) (-2539.061) (-2542.266) [-2540.895] -- 0:03:58
      29000 -- (-2538.993) [-2536.445] (-2545.050) (-2544.566) * (-2542.608) (-2536.335) (-2535.174) [-2537.559] -- 0:03:54
      29500 -- (-2537.973) (-2532.947) (-2544.577) [-2536.640] * (-2536.308) (-2535.548) [-2543.193] (-2544.820) -- 0:03:50
      30000 -- [-2540.422] (-2536.550) (-2543.062) (-2543.010) * (-2542.661) (-2536.451) [-2538.313] (-2534.062) -- 0:03:46

      Average standard deviation of split frequencies: 0.030744

      30500 -- [-2535.358] (-2547.805) (-2539.649) (-2540.941) * (-2535.822) (-2537.893) (-2543.919) [-2537.435] -- 0:03:42
      31000 -- [-2533.329] (-2550.561) (-2541.229) (-2537.224) * (-2535.163) [-2538.412] (-2543.820) (-2539.837) -- 0:03:38
      31500 -- [-2539.376] (-2543.248) (-2542.100) (-2543.203) * (-2533.224) (-2542.032) [-2535.557] (-2532.683) -- 0:04:05
      32000 -- [-2537.946] (-2540.687) (-2537.641) (-2537.428) * (-2536.672) [-2541.820] (-2539.972) (-2542.103) -- 0:04:02
      32500 -- (-2542.820) [-2538.062] (-2540.164) (-2541.315) * (-2537.454) (-2542.946) (-2539.702) [-2536.510] -- 0:03:58
      33000 -- (-2539.631) (-2541.507) (-2539.956) [-2536.676] * (-2542.049) (-2535.806) [-2538.114] (-2550.476) -- 0:03:54
      33500 -- [-2539.702] (-2541.542) (-2547.997) (-2538.088) * (-2538.946) [-2536.749] (-2546.715) (-2549.962) -- 0:03:50
      34000 -- [-2539.080] (-2542.866) (-2541.329) (-2544.166) * (-2540.787) (-2536.685) [-2540.145] (-2544.623) -- 0:03:47
      34500 -- (-2537.801) (-2542.033) [-2536.111] (-2547.257) * (-2545.461) (-2539.062) (-2539.795) [-2546.473] -- 0:03:43
      35000 -- [-2538.225] (-2541.531) (-2547.646) (-2538.781) * (-2533.602) [-2540.401] (-2538.926) (-2542.857) -- 0:03:40

      Average standard deviation of split frequencies: 0.026189

      35500 -- [-2538.664] (-2543.665) (-2541.012) (-2537.499) * (-2536.821) (-2535.928) [-2539.159] (-2546.442) -- 0:03:37
      36000 -- (-2537.870) (-2537.009) (-2547.973) [-2537.588] * (-2539.113) [-2538.437] (-2542.405) (-2540.820) -- 0:04:01
      36500 -- [-2537.049] (-2544.416) (-2538.986) (-2542.444) * [-2539.636] (-2538.777) (-2535.095) (-2546.856) -- 0:03:57
      37000 -- [-2539.588] (-2545.100) (-2545.419) (-2534.116) * (-2549.315) (-2542.055) [-2536.253] (-2541.695) -- 0:03:54
      37500 -- (-2540.859) (-2543.062) [-2535.203] (-2538.376) * (-2538.596) (-2543.132) (-2540.399) [-2540.004] -- 0:03:51
      38000 -- (-2536.484) (-2539.009) [-2533.323] (-2535.826) * (-2540.480) (-2544.019) (-2544.646) [-2539.681] -- 0:03:47
      38500 -- (-2537.861) [-2535.218] (-2541.872) (-2537.976) * [-2533.963] (-2545.764) (-2535.113) (-2538.513) -- 0:03:44
      39000 -- (-2538.414) (-2538.632) (-2541.282) [-2540.787] * (-2541.485) (-2543.371) [-2536.208] (-2535.920) -- 0:03:41
      39500 -- (-2539.741) (-2542.625) (-2537.516) [-2537.235] * (-2539.168) (-2548.186) (-2536.172) [-2539.711] -- 0:03:38
      40000 -- [-2538.329] (-2539.245) (-2545.196) (-2538.666) * (-2539.333) (-2554.741) [-2540.966] (-2532.640) -- 0:03:36

      Average standard deviation of split frequencies: 0.028980

      40500 -- [-2536.523] (-2539.413) (-2538.815) (-2543.668) * [-2534.862] (-2554.720) (-2535.593) (-2532.672) -- 0:03:56
      41000 -- (-2536.243) (-2536.227) (-2536.185) [-2533.988] * (-2551.518) (-2544.012) [-2540.091] (-2541.076) -- 0:03:53
      41500 -- (-2538.383) [-2538.306] (-2541.857) (-2536.868) * (-2539.702) (-2542.056) [-2540.753] (-2537.554) -- 0:03:50
      42000 -- (-2536.766) (-2540.481) (-2540.613) [-2539.582] * [-2537.915] (-2540.325) (-2538.573) (-2538.777) -- 0:03:48
      42500 -- (-2541.916) (-2539.988) (-2538.084) [-2537.202] * (-2537.454) [-2540.144] (-2540.064) (-2540.278) -- 0:03:45
      43000 -- (-2541.335) (-2544.657) (-2533.973) [-2539.445] * [-2536.466] (-2540.981) (-2536.634) (-2540.842) -- 0:03:42
      43500 -- (-2538.686) [-2537.920] (-2535.690) (-2544.651) * (-2537.760) (-2545.190) [-2535.425] (-2533.539) -- 0:03:39
      44000 -- (-2544.169) (-2541.359) (-2543.824) [-2538.490] * (-2538.713) (-2545.999) [-2543.630] (-2542.431) -- 0:03:37
      44500 -- (-2536.021) (-2541.469) [-2535.945] (-2533.433) * (-2538.217) [-2541.301] (-2539.075) (-2537.358) -- 0:03:34
      45000 -- (-2547.184) (-2545.966) [-2538.397] (-2540.342) * (-2538.427) (-2542.741) [-2535.912] (-2539.708) -- 0:03:53

      Average standard deviation of split frequencies: 0.020496

      45500 -- [-2536.648] (-2550.452) (-2544.958) (-2541.305) * (-2539.273) (-2546.557) [-2542.823] (-2536.564) -- 0:03:50
      46000 -- [-2535.751] (-2551.464) (-2536.792) (-2539.157) * [-2540.519] (-2540.371) (-2534.976) (-2535.162) -- 0:03:48
      46500 -- (-2535.831) [-2538.649] (-2541.047) (-2538.322) * (-2541.203) (-2550.669) [-2540.441] (-2535.668) -- 0:03:45
      47000 -- (-2544.082) (-2546.184) (-2546.406) [-2541.866] * [-2532.927] (-2537.797) (-2537.019) (-2536.666) -- 0:03:43
      47500 -- (-2541.491) (-2538.392) [-2542.002] (-2551.425) * (-2535.292) [-2537.626] (-2543.529) (-2533.810) -- 0:03:40
      48000 -- (-2541.874) [-2538.343] (-2540.724) (-2539.052) * (-2534.998) (-2534.302) (-2544.931) [-2537.191] -- 0:03:38
      48500 -- (-2543.172) (-2535.750) [-2538.160] (-2542.466) * [-2536.855] (-2535.310) (-2542.311) (-2537.935) -- 0:03:35
      49000 -- (-2546.998) (-2538.264) [-2543.185] (-2538.838) * (-2537.770) [-2534.377] (-2547.259) (-2537.336) -- 0:03:33
      49500 -- (-2539.263) (-2543.376) [-2540.147] (-2543.937) * [-2536.480] (-2538.049) (-2548.312) (-2542.470) -- 0:03:50
      50000 -- (-2542.448) (-2537.741) (-2545.519) [-2543.962] * (-2535.921) [-2533.270] (-2547.430) (-2538.164) -- 0:03:48

      Average standard deviation of split frequencies: 0.018608

      50500 -- (-2543.350) (-2537.424) [-2539.610] (-2542.084) * [-2537.891] (-2542.017) (-2543.486) (-2538.225) -- 0:03:45
      51000 -- (-2538.272) [-2542.580] (-2539.775) (-2539.642) * (-2537.226) [-2538.061] (-2544.903) (-2539.413) -- 0:03:43
      51500 -- (-2537.422) (-2540.967) [-2544.257] (-2531.196) * (-2545.778) (-2537.946) (-2545.753) [-2540.397] -- 0:03:41
      52000 -- (-2541.180) [-2538.628] (-2544.110) (-2537.084) * (-2540.910) (-2545.859) (-2551.987) [-2541.918] -- 0:03:38
      52500 -- [-2538.023] (-2536.785) (-2536.293) (-2540.486) * [-2540.730] (-2542.177) (-2542.929) (-2536.460) -- 0:03:36
      53000 -- (-2541.037) (-2534.704) [-2534.707] (-2537.605) * (-2542.666) (-2540.077) (-2546.085) [-2534.498] -- 0:03:34
      53500 -- (-2538.228) (-2541.947) (-2539.384) [-2539.589] * (-2544.085) (-2544.385) [-2541.278] (-2534.110) -- 0:03:32
      54000 -- (-2538.061) [-2538.109] (-2536.259) (-2536.600) * [-2535.530] (-2543.364) (-2540.299) (-2541.837) -- 0:03:47
      54500 -- (-2539.482) [-2534.345] (-2544.027) (-2542.156) * [-2538.988] (-2537.171) (-2539.200) (-2538.475) -- 0:03:45
      55000 -- (-2538.169) (-2537.592) (-2541.222) [-2540.327] * (-2535.421) (-2547.088) [-2537.342] (-2544.403) -- 0:03:43

      Average standard deviation of split frequencies: 0.016836

      55500 -- (-2542.562) (-2537.752) [-2539.266] (-2539.967) * (-2545.186) [-2538.600] (-2542.694) (-2544.592) -- 0:03:41
      56000 -- (-2539.496) [-2537.680] (-2536.809) (-2540.235) * [-2543.027] (-2544.115) (-2539.050) (-2544.408) -- 0:03:39
      56500 -- (-2535.023) [-2540.383] (-2543.838) (-2540.784) * (-2538.843) [-2534.474] (-2539.474) (-2549.370) -- 0:03:37
      57000 -- (-2534.771) (-2536.572) [-2534.933] (-2544.199) * (-2542.077) (-2533.992) (-2540.008) [-2536.031] -- 0:03:35
      57500 -- (-2540.084) (-2534.629) (-2543.958) [-2544.765] * (-2537.590) [-2539.021] (-2536.757) (-2535.874) -- 0:03:33
      58000 -- (-2539.590) [-2538.823] (-2539.313) (-2538.757) * (-2540.338) (-2537.170) [-2536.820] (-2541.332) -- 0:03:31
      58500 -- (-2536.323) (-2549.356) [-2532.255] (-2545.556) * [-2543.804] (-2543.269) (-2538.662) (-2541.130) -- 0:03:45
      59000 -- (-2542.062) (-2534.822) [-2537.197] (-2551.065) * (-2548.108) (-2534.273) [-2542.686] (-2546.191) -- 0:03:43
      59500 -- [-2535.740] (-2536.259) (-2536.400) (-2548.033) * [-2543.469] (-2538.818) (-2541.172) (-2542.505) -- 0:03:41
      60000 -- [-2536.206] (-2534.665) (-2539.252) (-2549.894) * (-2540.803) (-2541.911) [-2536.640] (-2537.984) -- 0:03:39

      Average standard deviation of split frequencies: 0.019426

      60500 -- (-2535.334) (-2536.207) [-2540.413] (-2543.841) * (-2537.520) (-2542.035) (-2543.386) [-2534.301] -- 0:03:37
      61000 -- (-2536.124) (-2537.267) [-2538.458] (-2541.174) * (-2534.880) [-2538.750] (-2541.784) (-2538.283) -- 0:03:35
      61500 -- (-2534.205) [-2535.401] (-2542.991) (-2543.776) * (-2541.141) [-2537.993] (-2538.610) (-2539.383) -- 0:03:33
      62000 -- (-2540.308) (-2541.021) [-2541.397] (-2544.413) * (-2542.916) [-2537.858] (-2539.027) (-2544.084) -- 0:03:31
      62500 -- [-2534.435] (-2546.581) (-2542.829) (-2549.113) * (-2538.162) (-2547.412) [-2537.663] (-2546.461) -- 0:03:30
      63000 -- (-2541.305) (-2535.631) [-2533.554] (-2546.462) * [-2539.398] (-2536.122) (-2537.125) (-2536.226) -- 0:03:43
      63500 -- [-2534.296] (-2543.321) (-2534.715) (-2536.070) * (-2548.429) (-2540.529) [-2532.560] (-2536.983) -- 0:03:41
      64000 -- (-2541.183) (-2540.415) [-2536.052] (-2535.822) * (-2538.117) [-2535.604] (-2539.664) (-2540.160) -- 0:03:39
      64500 -- [-2535.047] (-2541.213) (-2540.315) (-2540.431) * [-2538.392] (-2535.401) (-2538.578) (-2537.746) -- 0:03:37
      65000 -- (-2540.365) (-2540.072) [-2548.311] (-2537.042) * (-2538.973) (-2533.706) (-2538.811) [-2538.685] -- 0:03:35

      Average standard deviation of split frequencies: 0.017856

      65500 -- [-2539.441] (-2538.884) (-2536.286) (-2535.113) * (-2545.395) [-2532.334] (-2536.671) (-2537.314) -- 0:03:34
      66000 -- [-2533.910] (-2536.094) (-2537.509) (-2542.156) * (-2544.407) (-2534.406) [-2536.446] (-2538.693) -- 0:03:32
      66500 -- (-2534.592) (-2537.080) [-2538.598] (-2540.100) * (-2544.076) (-2537.904) [-2539.145] (-2538.244) -- 0:03:30
      67000 -- (-2538.981) [-2531.932] (-2534.754) (-2541.114) * (-2537.035) (-2540.739) [-2537.860] (-2551.239) -- 0:03:42
      67500 -- (-2541.552) (-2534.684) (-2541.100) [-2536.837] * [-2538.026] (-2544.901) (-2536.847) (-2543.433) -- 0:03:41
      68000 -- [-2542.050] (-2537.096) (-2535.000) (-2540.140) * [-2539.357] (-2538.562) (-2537.066) (-2540.417) -- 0:03:39
      68500 -- (-2547.902) [-2537.900] (-2535.790) (-2538.544) * (-2541.691) (-2537.525) [-2536.354] (-2548.947) -- 0:03:37
      69000 -- (-2548.082) (-2539.793) [-2533.860] (-2537.457) * (-2532.281) (-2536.773) [-2537.242] (-2540.186) -- 0:03:35
      69500 -- (-2539.407) (-2533.321) [-2539.319] (-2539.619) * (-2540.407) (-2540.836) (-2536.592) [-2537.653] -- 0:03:34
      70000 -- (-2542.394) (-2533.943) (-2539.370) [-2538.727] * [-2536.019] (-2541.588) (-2539.268) (-2538.391) -- 0:03:32

      Average standard deviation of split frequencies: 0.010006

      70500 -- (-2548.839) [-2531.736] (-2541.886) (-2543.819) * (-2539.240) [-2546.299] (-2539.232) (-2539.082) -- 0:03:30
      71000 -- (-2554.743) (-2534.364) (-2548.042) [-2540.244] * (-2543.639) (-2543.016) (-2541.470) [-2545.105] -- 0:03:29
      71500 -- (-2546.179) (-2534.058) [-2538.254] (-2534.594) * (-2547.796) (-2542.380) (-2545.794) [-2537.800] -- 0:03:40
      72000 -- (-2538.196) (-2537.993) (-2538.329) [-2537.782] * (-2548.728) (-2544.659) (-2542.930) [-2538.830] -- 0:03:39
      72500 -- (-2539.017) (-2534.292) [-2544.215] (-2538.521) * (-2540.782) (-2542.114) (-2541.657) [-2544.080] -- 0:03:37
      73000 -- [-2541.434] (-2544.516) (-2541.027) (-2534.583) * (-2537.742) (-2545.591) [-2541.499] (-2538.867) -- 0:03:35
      73500 -- (-2546.862) (-2535.306) [-2541.103] (-2535.446) * (-2540.694) (-2538.485) [-2541.070] (-2535.559) -- 0:03:34
      74000 -- (-2542.074) [-2534.278] (-2540.356) (-2540.999) * (-2539.204) (-2538.083) [-2535.803] (-2538.553) -- 0:03:32
      74500 -- [-2535.793] (-2543.924) (-2540.160) (-2541.681) * (-2542.455) [-2535.567] (-2539.190) (-2547.358) -- 0:03:31
      75000 -- (-2534.948) (-2542.958) (-2536.739) [-2538.485] * (-2536.099) [-2536.569] (-2538.150) (-2550.350) -- 0:03:29

      Average standard deviation of split frequencies: 0.009304

      75500 -- (-2538.366) (-2539.603) [-2531.125] (-2546.196) * (-2534.808) (-2542.194) (-2537.066) [-2540.985] -- 0:03:28
      76000 -- (-2536.214) (-2536.108) (-2538.775) [-2541.478] * (-2541.683) [-2536.768] (-2538.078) (-2544.714) -- 0:03:38
      76500 -- (-2539.691) [-2538.494] (-2542.828) (-2547.628) * (-2536.046) [-2541.660] (-2539.103) (-2544.550) -- 0:03:37
      77000 -- [-2536.790] (-2535.064) (-2538.239) (-2540.167) * (-2547.196) (-2538.413) (-2534.906) [-2538.396] -- 0:03:35
      77500 -- [-2539.313] (-2536.364) (-2544.330) (-2537.274) * (-2533.764) (-2539.736) [-2540.043] (-2543.858) -- 0:03:34
      78000 -- (-2540.970) [-2542.521] (-2545.617) (-2540.565) * (-2539.212) (-2535.807) [-2541.830] (-2546.302) -- 0:03:32
      78500 -- (-2542.829) [-2537.212] (-2544.611) (-2547.543) * [-2537.994] (-2536.627) (-2536.940) (-2540.343) -- 0:03:31
      79000 -- (-2540.624) (-2538.423) [-2543.278] (-2546.028) * (-2536.658) (-2542.560) (-2532.966) [-2536.575] -- 0:03:29
      79500 -- [-2551.951] (-2537.774) (-2539.223) (-2542.172) * (-2539.459) (-2538.583) (-2541.691) [-2536.383] -- 0:03:28
      80000 -- (-2544.476) (-2540.453) (-2542.011) [-2535.718] * [-2540.023] (-2545.137) (-2534.194) (-2544.685) -- 0:03:27

      Average standard deviation of split frequencies: 0.005844

      80500 -- (-2546.044) [-2539.990] (-2539.748) (-2536.869) * (-2538.815) (-2545.633) [-2534.044] (-2539.886) -- 0:03:37
      81000 -- (-2538.992) (-2538.898) [-2540.852] (-2543.395) * (-2538.312) (-2538.026) (-2540.100) [-2535.534] -- 0:03:35
      81500 -- [-2540.105] (-2538.357) (-2542.240) (-2539.304) * [-2538.643] (-2539.804) (-2542.390) (-2538.563) -- 0:03:34
      82000 -- (-2542.695) (-2542.532) [-2539.197] (-2546.879) * [-2535.955] (-2539.937) (-2540.733) (-2535.297) -- 0:03:32
      82500 -- (-2540.383) (-2544.589) [-2536.587] (-2546.218) * (-2532.329) [-2538.514] (-2544.871) (-2539.806) -- 0:03:31
      83000 -- (-2536.842) (-2537.830) (-2536.234) [-2538.302] * (-2536.970) (-2543.202) (-2540.423) [-2535.042] -- 0:03:29
      83500 -- (-2536.792) (-2545.489) (-2537.245) [-2535.900] * (-2539.618) (-2545.723) (-2549.897) [-2545.363] -- 0:03:28
      84000 -- (-2541.804) [-2537.330] (-2541.327) (-2538.615) * (-2541.686) [-2539.276] (-2547.152) (-2544.004) -- 0:03:27
      84500 -- (-2537.166) [-2533.783] (-2539.875) (-2540.900) * (-2541.467) [-2535.239] (-2540.330) (-2543.606) -- 0:03:25
      85000 -- [-2536.215] (-2535.329) (-2535.228) (-2538.368) * (-2546.429) [-2534.523] (-2542.530) (-2538.300) -- 0:03:35

      Average standard deviation of split frequencies: 0.005481

      85500 -- (-2540.181) [-2538.892] (-2540.738) (-2537.927) * (-2536.520) (-2537.570) [-2541.036] (-2543.015) -- 0:03:33
      86000 -- [-2535.785] (-2534.132) (-2546.641) (-2543.771) * (-2535.780) (-2542.245) [-2539.120] (-2542.927) -- 0:03:32
      86500 -- (-2540.245) [-2537.861] (-2539.798) (-2539.368) * (-2542.482) (-2539.048) (-2543.003) [-2535.177] -- 0:03:31
      87000 -- (-2541.425) (-2538.810) [-2538.035] (-2538.898) * (-2539.851) (-2537.770) (-2542.482) [-2535.780] -- 0:03:29
      87500 -- (-2538.357) [-2541.360] (-2542.840) (-2542.799) * (-2539.285) (-2538.978) (-2539.383) [-2547.079] -- 0:03:28
      88000 -- (-2534.827) [-2536.452] (-2540.901) (-2539.926) * (-2550.247) (-2537.819) (-2540.870) [-2538.789] -- 0:03:27
      88500 -- (-2531.821) [-2536.158] (-2541.946) (-2548.497) * (-2538.371) [-2536.770] (-2536.968) (-2535.469) -- 0:03:25
      89000 -- [-2537.283] (-2542.714) (-2541.274) (-2541.460) * (-2542.929) (-2536.662) [-2537.987] (-2539.421) -- 0:03:24
      89500 -- (-2534.069) [-2543.830] (-2537.263) (-2538.775) * (-2535.287) (-2540.973) (-2537.804) [-2539.529] -- 0:03:33
      90000 -- (-2538.724) (-2546.349) [-2533.300] (-2535.942) * [-2535.756] (-2539.606) (-2533.840) (-2535.541) -- 0:03:32

      Average standard deviation of split frequencies: 0.007799

      90500 -- [-2538.873] (-2541.678) (-2536.008) (-2540.789) * [-2547.674] (-2538.211) (-2537.772) (-2538.069) -- 0:03:31
      91000 -- (-2543.032) (-2538.871) (-2537.602) [-2536.166] * (-2543.457) (-2536.597) (-2535.886) [-2540.790] -- 0:03:29
      91500 -- [-2533.292] (-2537.533) (-2537.926) (-2539.860) * (-2543.441) [-2539.659] (-2536.889) (-2538.383) -- 0:03:28
      92000 -- (-2541.486) [-2538.126] (-2535.083) (-2533.849) * (-2540.346) [-2533.662] (-2536.469) (-2533.229) -- 0:03:27
      92500 -- (-2536.315) (-2536.442) (-2536.159) [-2539.746] * (-2539.103) [-2537.484] (-2539.071) (-2539.136) -- 0:03:26
      93000 -- (-2535.152) (-2535.034) (-2540.709) [-2534.286] * (-2537.846) (-2536.501) [-2547.175] (-2535.746) -- 0:03:24
      93500 -- (-2537.839) (-2535.331) (-2547.755) [-2535.081] * (-2538.924) (-2536.284) (-2540.551) [-2539.024] -- 0:03:23
      94000 -- (-2534.533) (-2539.197) (-2537.771) [-2537.231] * [-2539.938] (-2535.621) (-2544.730) (-2536.260) -- 0:03:32
      94500 -- [-2537.584] (-2538.907) (-2539.033) (-2536.780) * (-2537.654) [-2536.128] (-2545.378) (-2538.694) -- 0:03:30
      95000 -- [-2537.297] (-2535.101) (-2540.027) (-2538.162) * (-2535.199) [-2540.828] (-2537.341) (-2550.573) -- 0:03:29

      Average standard deviation of split frequencies: 0.009821

      95500 -- (-2537.706) [-2534.715] (-2539.525) (-2551.014) * (-2540.235) [-2536.358] (-2542.487) (-2541.237) -- 0:03:28
      96000 -- [-2538.242] (-2536.154) (-2537.296) (-2541.280) * (-2541.573) (-2541.660) [-2536.279] (-2542.083) -- 0:03:27
      96500 -- [-2537.039] (-2538.531) (-2541.075) (-2539.803) * (-2540.094) [-2536.506] (-2543.465) (-2547.564) -- 0:03:25
      97000 -- (-2545.627) (-2536.244) [-2542.563] (-2543.422) * [-2533.691] (-2537.431) (-2544.288) (-2540.682) -- 0:03:24
      97500 -- (-2538.192) (-2540.603) (-2540.843) [-2539.235] * (-2543.807) (-2540.627) [-2543.124] (-2536.623) -- 0:03:23
      98000 -- [-2538.361] (-2537.323) (-2534.527) (-2539.013) * (-2539.454) (-2538.142) [-2541.775] (-2540.936) -- 0:03:22
      98500 -- (-2539.743) [-2539.330] (-2538.470) (-2537.952) * (-2540.440) [-2538.194] (-2538.513) (-2538.299) -- 0:03:30
      99000 -- (-2541.078) (-2539.725) (-2539.891) [-2541.386] * (-2535.519) (-2538.981) [-2534.888] (-2537.447) -- 0:03:29
      99500 -- [-2538.455] (-2535.588) (-2539.918) (-2545.011) * (-2541.596) [-2544.246] (-2536.390) (-2545.625) -- 0:03:28
      100000 -- (-2532.658) (-2538.127) (-2536.097) [-2534.179] * [-2535.794] (-2544.070) (-2551.153) (-2537.495) -- 0:03:27

      Average standard deviation of split frequencies: 0.011707

      100500 -- (-2537.892) [-2536.456] (-2533.362) (-2541.815) * (-2540.309) (-2547.808) [-2536.875] (-2540.471) -- 0:03:25
      101000 -- (-2542.169) [-2540.402] (-2538.113) (-2542.154) * [-2533.037] (-2542.034) (-2542.375) (-2541.925) -- 0:03:24
      101500 -- (-2537.749) [-2539.345] (-2535.268) (-2546.006) * (-2534.344) [-2534.030] (-2535.549) (-2537.836) -- 0:03:23
      102000 -- [-2536.182] (-2545.742) (-2536.493) (-2538.809) * [-2538.642] (-2537.678) (-2538.335) (-2541.616) -- 0:03:22
      102500 -- (-2538.453) [-2543.192] (-2544.006) (-2543.144) * [-2534.605] (-2540.359) (-2534.507) (-2538.549) -- 0:03:21
      103000 -- [-2533.740] (-2540.638) (-2542.542) (-2535.888) * (-2538.457) (-2536.395) [-2539.575] (-2537.465) -- 0:03:29
      103500 -- [-2537.474] (-2548.412) (-2538.965) (-2536.609) * (-2536.309) (-2540.681) (-2539.444) [-2533.768] -- 0:03:27
      104000 -- (-2542.274) (-2535.817) [-2546.551] (-2542.560) * (-2535.274) (-2544.368) (-2546.181) [-2533.812] -- 0:03:26
      104500 -- (-2548.320) (-2534.171) (-2538.998) [-2541.565] * (-2537.885) (-2547.426) [-2538.924] (-2540.103) -- 0:03:25
      105000 -- (-2544.411) [-2538.221] (-2545.111) (-2545.765) * (-2542.124) (-2542.013) [-2537.030] (-2540.665) -- 0:03:24

      Average standard deviation of split frequencies: 0.008894

      105500 -- (-2543.739) (-2541.577) (-2538.683) [-2537.830] * [-2539.542] (-2542.614) (-2540.329) (-2537.650) -- 0:03:23
      106000 -- [-2542.547] (-2541.580) (-2544.944) (-2540.812) * (-2537.258) (-2536.015) [-2541.068] (-2545.159) -- 0:03:22
      106500 -- (-2540.912) (-2545.270) [-2538.366] (-2544.287) * [-2541.199] (-2539.401) (-2542.810) (-2541.549) -- 0:03:21
      107000 -- (-2539.850) (-2542.371) [-2542.871] (-2539.893) * (-2543.055) (-2541.377) [-2541.883] (-2540.623) -- 0:03:20
      107500 -- [-2543.157] (-2538.258) (-2547.004) (-2533.342) * (-2537.666) [-2537.998] (-2543.330) (-2537.014) -- 0:03:27
      108000 -- (-2539.530) [-2539.173] (-2545.774) (-2534.203) * (-2537.203) (-2549.643) [-2539.766] (-2544.377) -- 0:03:26
      108500 -- (-2542.177) (-2542.913) [-2540.082] (-2532.639) * [-2545.751] (-2540.316) (-2541.756) (-2544.321) -- 0:03:25
      109000 -- (-2537.245) [-2540.007] (-2540.207) (-2538.999) * (-2532.920) (-2537.253) [-2539.348] (-2539.195) -- 0:03:24
      109500 -- (-2539.393) (-2541.842) [-2540.520] (-2534.828) * (-2542.663) (-2540.616) (-2537.459) [-2542.547] -- 0:03:23
      110000 -- (-2548.538) (-2539.640) (-2541.127) [-2544.266] * [-2534.355] (-2540.812) (-2540.933) (-2538.364) -- 0:03:22

      Average standard deviation of split frequencies: 0.006390

      110500 -- [-2538.585] (-2546.119) (-2536.604) (-2545.413) * (-2535.097) (-2541.188) (-2537.352) [-2543.076] -- 0:03:21
      111000 -- [-2534.521] (-2541.036) (-2536.373) (-2534.519) * (-2536.263) (-2535.905) (-2537.637) [-2537.275] -- 0:03:20
      111500 -- (-2546.656) [-2542.666] (-2541.768) (-2537.642) * (-2543.804) (-2543.997) (-2534.909) [-2542.221] -- 0:03:27
      112000 -- (-2539.900) (-2545.800) [-2540.138] (-2538.839) * (-2538.816) [-2540.884] (-2538.757) (-2545.754) -- 0:03:26
      112500 -- (-2534.538) (-2547.637) [-2540.076] (-2537.120) * (-2534.473) (-2539.847) (-2539.403) [-2539.521] -- 0:03:25
      113000 -- (-2540.656) (-2546.175) (-2540.865) [-2535.895] * (-2537.236) [-2536.410] (-2540.306) (-2541.748) -- 0:03:24
      113500 -- (-2537.953) (-2538.535) (-2533.682) [-2538.954] * (-2538.027) (-2535.843) [-2538.052] (-2548.093) -- 0:03:23
      114000 -- [-2541.873] (-2538.855) (-2536.315) (-2545.847) * (-2537.813) (-2541.267) [-2541.461] (-2539.349) -- 0:03:22
      114500 -- [-2541.241] (-2545.684) (-2541.470) (-2542.602) * (-2539.992) (-2539.411) [-2534.099] (-2551.427) -- 0:03:21
      115000 -- [-2540.380] (-2540.558) (-2538.801) (-2536.988) * (-2544.518) [-2534.803] (-2534.351) (-2545.700) -- 0:03:20

      Average standard deviation of split frequencies: 0.006096

      115500 -- (-2544.927) (-2541.043) (-2537.536) [-2537.950] * [-2536.829] (-2540.310) (-2539.817) (-2545.213) -- 0:03:19
      116000 -- (-2538.387) (-2547.232) (-2539.728) [-2538.109] * [-2539.288] (-2544.708) (-2540.889) (-2541.795) -- 0:03:25
      116500 -- (-2548.822) (-2543.439) (-2539.819) [-2538.271] * (-2540.976) (-2536.902) (-2543.684) [-2544.027] -- 0:03:24
      117000 -- (-2539.167) [-2537.732] (-2533.281) (-2540.211) * (-2540.859) [-2538.627] (-2539.267) (-2536.607) -- 0:03:23
      117500 -- [-2537.217] (-2541.106) (-2537.598) (-2550.954) * (-2539.999) [-2536.663] (-2537.476) (-2535.282) -- 0:03:22
      118000 -- (-2543.261) (-2548.959) (-2539.759) [-2539.101] * [-2541.790] (-2547.441) (-2546.294) (-2545.538) -- 0:03:21
      118500 -- (-2543.384) [-2541.911] (-2535.357) (-2544.997) * [-2540.380] (-2540.526) (-2539.100) (-2543.192) -- 0:03:20
      119000 -- (-2540.658) [-2541.176] (-2534.865) (-2542.997) * (-2543.106) (-2538.570) [-2539.617] (-2541.452) -- 0:03:19
      119500 -- (-2542.298) [-2541.408] (-2540.286) (-2543.007) * (-2538.754) [-2548.809] (-2540.443) (-2540.690) -- 0:03:18
      120000 -- [-2541.046] (-2542.903) (-2536.203) (-2542.843) * (-2545.197) [-2541.981] (-2549.821) (-2538.610) -- 0:03:18

      Average standard deviation of split frequencies: 0.003907

      120500 -- [-2533.878] (-2539.610) (-2540.588) (-2537.836) * (-2542.809) (-2540.985) [-2534.104] (-2536.167) -- 0:03:24
      121000 -- [-2535.960] (-2544.305) (-2538.304) (-2538.720) * (-2546.872) [-2535.620] (-2540.968) (-2535.999) -- 0:03:23
      121500 -- [-2538.015] (-2535.301) (-2539.822) (-2543.251) * (-2543.418) (-2538.380) (-2535.643) [-2536.024] -- 0:03:22
      122000 -- (-2538.971) (-2538.355) [-2535.377] (-2538.912) * [-2534.489] (-2544.237) (-2533.486) (-2534.446) -- 0:03:21
      122500 -- (-2538.590) (-2539.989) (-2535.411) [-2538.282] * [-2535.076] (-2535.079) (-2535.960) (-2536.461) -- 0:03:20
      123000 -- [-2539.049] (-2541.131) (-2542.312) (-2544.996) * (-2540.385) [-2537.327] (-2541.069) (-2537.138) -- 0:03:19
      123500 -- (-2539.517) [-2541.115] (-2543.504) (-2536.410) * (-2537.858) (-2536.321) (-2547.588) [-2539.456] -- 0:03:18
      124000 -- (-2534.681) [-2539.719] (-2537.154) (-2534.781) * (-2541.789) (-2542.611) (-2541.187) [-2540.185] -- 0:03:17
      124500 -- [-2536.784] (-2537.661) (-2536.199) (-2541.549) * (-2546.239) (-2539.675) [-2538.524] (-2538.627) -- 0:03:16
      125000 -- (-2542.881) (-2536.253) [-2538.541] (-2538.732) * (-2535.692) (-2542.005) [-2534.850] (-2536.452) -- 0:03:23

      Average standard deviation of split frequencies: 0.003741

      125500 -- (-2539.170) (-2537.452) [-2535.531] (-2544.424) * (-2539.163) (-2543.134) [-2532.924] (-2538.676) -- 0:03:22
      126000 -- (-2538.432) [-2536.127] (-2538.682) (-2538.383) * (-2533.663) (-2545.623) (-2556.890) [-2543.541] -- 0:03:21
      126500 -- (-2539.299) [-2535.835] (-2536.604) (-2538.076) * (-2538.631) [-2532.245] (-2548.110) (-2538.916) -- 0:03:20
      127000 -- (-2542.644) (-2535.432) (-2538.058) [-2533.676] * (-2542.545) (-2536.392) [-2536.337] (-2538.550) -- 0:03:19
      127500 -- [-2536.854] (-2534.522) (-2533.748) (-2539.773) * (-2536.228) [-2537.580] (-2534.736) (-2538.867) -- 0:03:18
      128000 -- (-2539.993) (-2537.749) [-2539.423] (-2545.029) * [-2533.736] (-2541.938) (-2534.092) (-2538.548) -- 0:03:17
      128500 -- (-2541.408) [-2538.611] (-2540.023) (-2538.776) * (-2537.729) (-2542.101) [-2537.825] (-2538.071) -- 0:03:16
      129000 -- (-2541.364) [-2538.796] (-2536.040) (-2537.896) * (-2539.747) (-2542.116) [-2536.069] (-2536.793) -- 0:03:15
      129500 -- (-2540.474) (-2543.233) [-2533.876] (-2536.762) * (-2536.110) (-2546.863) [-2537.369] (-2539.483) -- 0:03:21
      130000 -- (-2546.928) [-2536.028] (-2538.720) (-2541.925) * [-2537.013] (-2535.948) (-2543.100) (-2542.809) -- 0:03:20

      Average standard deviation of split frequencies: 0.003608

      130500 -- (-2545.023) (-2538.852) [-2540.190] (-2542.304) * (-2536.567) [-2535.066] (-2542.787) (-2539.992) -- 0:03:19
      131000 -- (-2547.212) (-2534.173) [-2537.137] (-2541.211) * (-2538.182) (-2540.634) [-2540.206] (-2537.409) -- 0:03:19
      131500 -- (-2543.851) [-2537.882] (-2532.955) (-2538.401) * (-2536.860) [-2537.674] (-2539.309) (-2536.747) -- 0:03:18
      132000 -- (-2544.211) (-2539.085) (-2541.053) [-2542.045] * (-2537.607) (-2543.811) (-2544.545) [-2538.509] -- 0:03:17
      132500 -- [-2538.423] (-2552.177) (-2550.877) (-2541.935) * [-2536.027] (-2539.776) (-2535.545) (-2540.388) -- 0:03:16
      133000 -- [-2540.705] (-2540.557) (-2538.499) (-2536.940) * [-2537.021] (-2544.527) (-2539.611) (-2535.001) -- 0:03:15
      133500 -- (-2536.015) (-2540.871) (-2535.065) [-2536.448] * (-2536.690) (-2535.733) (-2542.711) [-2533.155] -- 0:03:14
      134000 -- [-2535.104] (-2535.571) (-2538.000) (-2540.632) * (-2539.937) [-2539.620] (-2540.410) (-2539.370) -- 0:03:20
      134500 -- [-2544.589] (-2538.567) (-2535.274) (-2537.411) * (-2538.245) [-2538.149] (-2545.894) (-2538.486) -- 0:03:19
      135000 -- (-2539.754) [-2535.904] (-2543.250) (-2544.170) * [-2539.270] (-2538.217) (-2542.033) (-2544.727) -- 0:03:18

      Average standard deviation of split frequencies: 0.003466

      135500 -- (-2543.369) (-2541.405) [-2541.323] (-2539.144) * (-2532.989) (-2533.533) [-2537.509] (-2538.702) -- 0:03:17
      136000 -- [-2545.413] (-2538.222) (-2536.535) (-2538.829) * (-2539.476) [-2536.814] (-2540.600) (-2538.409) -- 0:03:16
      136500 -- (-2538.632) (-2541.809) [-2536.342] (-2537.912) * [-2533.406] (-2537.788) (-2541.835) (-2552.054) -- 0:03:16
      137000 -- (-2539.942) (-2539.201) [-2534.664] (-2541.160) * [-2533.782] (-2540.185) (-2544.273) (-2538.580) -- 0:03:15
      137500 -- (-2538.671) [-2532.491] (-2537.384) (-2538.112) * (-2536.578) (-2535.661) (-2542.407) [-2539.839] -- 0:03:14
      138000 -- (-2547.468) (-2540.596) (-2536.482) [-2539.137] * (-2538.169) (-2534.851) (-2544.944) [-2542.850] -- 0:03:13
      138500 -- (-2547.714) [-2533.458] (-2542.455) (-2536.593) * [-2543.239] (-2544.866) (-2542.327) (-2542.314) -- 0:03:19
      139000 -- (-2537.535) [-2534.141] (-2542.891) (-2536.323) * (-2543.120) (-2538.340) (-2540.360) [-2535.547] -- 0:03:18
      139500 -- (-2536.778) (-2540.268) (-2537.866) [-2533.172] * (-2538.726) (-2539.893) [-2546.380] (-2548.558) -- 0:03:17
      140000 -- (-2543.483) (-2536.589) (-2542.306) [-2538.168] * (-2532.373) [-2533.978] (-2539.855) (-2542.762) -- 0:03:16

      Average standard deviation of split frequencies: 0.003351

      140500 -- (-2543.482) (-2539.536) (-2548.118) [-2535.269] * (-2539.069) (-2535.563) (-2543.624) [-2539.553] -- 0:03:15
      141000 -- (-2547.346) [-2543.585] (-2540.806) (-2537.677) * (-2544.915) [-2537.421] (-2540.220) (-2544.132) -- 0:03:14
      141500 -- (-2537.499) (-2552.461) (-2538.926) [-2535.778] * (-2537.007) (-2535.695) (-2541.219) [-2543.534] -- 0:03:14
      142000 -- (-2544.668) (-2540.727) (-2534.069) [-2540.782] * (-2539.111) (-2546.219) [-2541.205] (-2538.178) -- 0:03:13
      142500 -- (-2536.417) (-2542.483) (-2535.977) [-2538.571] * [-2537.367] (-2542.180) (-2548.723) (-2535.371) -- 0:03:12
      143000 -- (-2533.018) [-2541.238] (-2540.379) (-2534.698) * [-2540.737] (-2540.846) (-2537.386) (-2533.683) -- 0:03:17
      143500 -- [-2535.296] (-2536.017) (-2539.420) (-2538.833) * (-2535.837) (-2538.997) (-2535.594) [-2537.890] -- 0:03:16
      144000 -- (-2542.648) (-2539.641) (-2547.492) [-2536.262] * (-2543.160) [-2537.975] (-2535.866) (-2531.892) -- 0:03:16
      144500 -- [-2538.753] (-2550.039) (-2541.507) (-2536.625) * (-2544.242) [-2538.690] (-2535.457) (-2537.636) -- 0:03:15
      145000 -- [-2533.463] (-2542.642) (-2537.285) (-2542.947) * (-2539.004) (-2544.927) [-2534.657] (-2539.609) -- 0:03:14

      Average standard deviation of split frequencies: 0.003229

      145500 -- (-2537.872) (-2533.970) [-2538.948] (-2545.368) * [-2537.148] (-2544.661) (-2534.789) (-2537.742) -- 0:03:13
      146000 -- [-2537.510] (-2539.442) (-2538.215) (-2539.442) * (-2544.392) [-2539.356] (-2535.104) (-2546.483) -- 0:03:13
      146500 -- [-2538.177] (-2538.669) (-2544.571) (-2539.739) * [-2537.545] (-2538.008) (-2538.435) (-2533.912) -- 0:03:12
      147000 -- (-2534.807) [-2540.212] (-2537.373) (-2538.568) * (-2538.699) (-2534.670) (-2542.285) [-2540.082] -- 0:03:11
      147500 -- (-2533.594) [-2534.658] (-2539.266) (-2543.832) * [-2536.927] (-2538.563) (-2538.306) (-2536.724) -- 0:03:16
      148000 -- (-2544.670) (-2532.595) (-2535.542) [-2539.612] * (-2537.105) [-2538.623] (-2541.449) (-2534.922) -- 0:03:15
      148500 -- (-2539.435) [-2536.188] (-2539.025) (-2535.220) * (-2539.770) [-2535.931] (-2539.447) (-2538.330) -- 0:03:14
      149000 -- (-2542.258) (-2538.886) [-2537.466] (-2540.160) * (-2539.993) [-2541.806] (-2544.706) (-2534.299) -- 0:03:14
      149500 -- (-2541.734) (-2539.362) (-2536.780) [-2537.979] * (-2541.290) (-2541.655) (-2537.853) [-2536.319] -- 0:03:13
      150000 -- [-2535.790] (-2541.441) (-2538.712) (-2538.219) * (-2533.576) [-2542.279] (-2539.122) (-2536.897) -- 0:03:12

      Average standard deviation of split frequencies: 0.003129

      150500 -- [-2539.268] (-2548.127) (-2541.725) (-2543.869) * (-2540.254) (-2539.311) (-2538.690) [-2535.666] -- 0:03:11
      151000 -- (-2540.975) (-2546.039) (-2538.036) [-2537.044] * (-2543.797) [-2535.841] (-2538.426) (-2542.284) -- 0:03:11
      151500 -- (-2538.094) [-2535.532] (-2540.736) (-2541.514) * (-2539.847) [-2538.747] (-2538.238) (-2540.516) -- 0:03:10
      152000 -- (-2535.368) (-2536.939) [-2539.747] (-2539.315) * (-2537.794) (-2546.146) [-2544.052] (-2549.752) -- 0:03:15
      152500 -- (-2538.932) [-2540.316] (-2541.234) (-2539.975) * (-2536.080) [-2543.208] (-2544.911) (-2544.036) -- 0:03:14
      153000 -- (-2538.071) (-2546.632) (-2543.629) [-2535.997] * [-2545.097] (-2549.910) (-2538.898) (-2542.618) -- 0:03:13
      153500 -- (-2538.969) (-2543.030) [-2539.720] (-2541.797) * (-2537.057) (-2546.357) [-2540.801] (-2546.509) -- 0:03:13
      154000 -- (-2536.041) (-2539.685) (-2536.108) [-2534.250] * (-2533.798) [-2542.064] (-2548.755) (-2536.923) -- 0:03:12
      154500 -- [-2539.315] (-2541.688) (-2540.909) (-2540.424) * (-2537.795) (-2537.427) [-2539.198] (-2535.203) -- 0:03:11
      155000 -- [-2535.080] (-2545.619) (-2532.771) (-2534.557) * (-2543.717) (-2541.734) [-2539.205] (-2536.331) -- 0:03:10

      Average standard deviation of split frequencies: 0.003022

      155500 -- (-2536.515) (-2546.923) [-2537.408] (-2538.498) * [-2544.798] (-2538.825) (-2544.908) (-2544.957) -- 0:03:10
      156000 -- [-2543.507] (-2543.024) (-2539.792) (-2537.050) * (-2541.087) (-2540.766) (-2546.371) [-2538.609] -- 0:03:09
      156500 -- (-2547.834) [-2537.362] (-2546.432) (-2537.231) * (-2551.412) (-2540.166) [-2545.847] (-2534.499) -- 0:03:14
      157000 -- (-2545.004) [-2542.469] (-2535.347) (-2537.376) * [-2540.926] (-2547.992) (-2539.273) (-2535.547) -- 0:03:13
      157500 -- (-2542.000) [-2545.228] (-2542.898) (-2541.994) * [-2543.091] (-2545.276) (-2541.712) (-2539.601) -- 0:03:12
      158000 -- [-2544.804] (-2545.191) (-2537.378) (-2537.964) * [-2537.276] (-2539.435) (-2537.707) (-2532.184) -- 0:03:11
      158500 -- (-2538.532) (-2542.867) (-2539.553) [-2541.952] * (-2535.162) (-2539.060) (-2537.299) [-2535.695] -- 0:03:11
      159000 -- (-2538.211) (-2540.867) (-2535.027) [-2535.871] * (-2537.581) (-2539.043) (-2538.781) [-2535.235] -- 0:03:10
      159500 -- [-2540.691] (-2540.562) (-2539.764) (-2542.715) * (-2544.933) [-2540.144] (-2544.066) (-2536.630) -- 0:03:09
      160000 -- [-2538.117] (-2542.189) (-2539.381) (-2542.412) * (-2544.038) (-2540.820) [-2539.907] (-2532.794) -- 0:03:09

      Average standard deviation of split frequencies: 0.004401

      160500 -- (-2534.448) (-2534.209) [-2536.181] (-2546.159) * (-2547.171) (-2544.610) [-2535.047] (-2539.040) -- 0:03:08
      161000 -- (-2534.271) (-2532.519) (-2538.239) [-2535.339] * (-2539.238) (-2546.074) [-2537.716] (-2543.467) -- 0:03:12
      161500 -- [-2536.278] (-2543.633) (-2536.417) (-2542.726) * (-2532.728) (-2543.408) (-2537.153) [-2545.602] -- 0:03:12
      162000 -- [-2542.049] (-2538.326) (-2537.482) (-2540.473) * (-2541.115) (-2543.482) (-2539.985) [-2533.505] -- 0:03:11
      162500 -- (-2540.965) (-2541.281) [-2539.946] (-2542.203) * (-2536.444) (-2541.713) (-2542.468) [-2538.773] -- 0:03:10
      163000 -- [-2536.881] (-2542.146) (-2539.963) (-2536.235) * (-2536.249) (-2535.654) (-2539.340) [-2540.975] -- 0:03:09
      163500 -- (-2533.087) (-2535.173) [-2538.735] (-2542.590) * [-2535.559] (-2539.360) (-2535.521) (-2534.355) -- 0:03:09
      164000 -- (-2537.505) (-2537.918) (-2547.132) [-2540.180] * (-2541.927) (-2531.696) [-2534.531] (-2538.622) -- 0:03:08
      164500 -- (-2541.086) (-2536.034) (-2538.237) [-2537.049] * (-2541.070) [-2537.501] (-2535.004) (-2536.546) -- 0:03:07
      165000 -- (-2541.387) [-2533.605] (-2534.321) (-2538.313) * [-2535.244] (-2541.909) (-2541.024) (-2540.610) -- 0:03:07

      Average standard deviation of split frequencies: 0.004260

      165500 -- (-2538.002) [-2539.759] (-2538.119) (-2532.094) * (-2533.729) (-2538.806) (-2537.271) [-2535.055] -- 0:03:11
      166000 -- [-2539.500] (-2544.384) (-2540.855) (-2538.493) * (-2534.072) (-2541.400) (-2535.918) [-2535.367] -- 0:03:10
      166500 -- (-2541.568) (-2537.436) (-2538.835) [-2539.552] * (-2536.412) [-2535.360] (-2535.064) (-2535.864) -- 0:03:10
      167000 -- (-2538.386) (-2540.749) (-2542.822) [-2537.662] * (-2540.749) (-2539.579) [-2543.528] (-2549.087) -- 0:03:09
      167500 -- [-2542.723] (-2538.048) (-2541.267) (-2539.889) * (-2536.593) (-2537.995) (-2544.793) [-2535.861] -- 0:03:08
      168000 -- [-2539.420] (-2543.024) (-2540.848) (-2535.188) * (-2541.691) [-2542.303] (-2539.495) (-2539.013) -- 0:03:08
      168500 -- (-2537.079) (-2532.960) (-2537.251) [-2536.427] * (-2539.000) (-2540.912) (-2538.609) [-2537.579] -- 0:03:12
      169000 -- (-2541.140) [-2536.549] (-2539.321) (-2536.480) * (-2537.303) (-2543.625) (-2537.497) [-2536.038] -- 0:03:11
      169500 -- (-2537.048) (-2535.910) [-2545.598] (-2540.814) * (-2541.537) [-2538.821] (-2536.576) (-2538.514) -- 0:03:11
      170000 -- (-2543.278) (-2538.709) [-2539.724] (-2542.187) * (-2542.714) (-2540.181) [-2536.103] (-2532.847) -- 0:03:10

      Average standard deviation of split frequencies: 0.005524

      170500 -- [-2541.877] (-2536.309) (-2543.930) (-2542.448) * (-2550.723) (-2536.596) [-2541.532] (-2540.501) -- 0:03:09
      171000 -- (-2536.683) (-2545.815) (-2537.182) [-2537.664] * (-2541.770) (-2536.947) (-2543.476) [-2536.800] -- 0:03:09
      171500 -- (-2545.582) (-2536.030) [-2537.081] (-2542.602) * (-2543.503) (-2541.900) (-2542.350) [-2531.949] -- 0:03:08
      172000 -- (-2540.168) [-2534.443] (-2538.815) (-2538.829) * (-2550.507) (-2543.736) [-2539.759] (-2538.758) -- 0:03:07
      172500 -- (-2542.132) [-2536.972] (-2539.277) (-2536.320) * (-2546.357) [-2544.826] (-2542.303) (-2539.049) -- 0:03:07
      173000 -- (-2540.058) (-2537.580) [-2533.454] (-2537.704) * [-2540.849] (-2537.918) (-2538.981) (-2543.052) -- 0:03:11
      173500 -- (-2536.379) [-2542.672] (-2539.080) (-2537.138) * (-2541.141) (-2544.250) [-2538.643] (-2537.419) -- 0:03:10
      174000 -- (-2543.929) (-2537.850) [-2538.416] (-2538.653) * [-2535.526] (-2545.688) (-2540.113) (-2546.904) -- 0:03:09
      174500 -- (-2543.519) (-2549.450) [-2539.952] (-2542.471) * (-2531.625) (-2535.614) (-2536.040) [-2537.534] -- 0:03:09
      175000 -- [-2541.031] (-2544.629) (-2535.659) (-2537.204) * [-2532.646] (-2545.897) (-2537.054) (-2538.259) -- 0:03:08

      Average standard deviation of split frequencies: 0.005357

      175500 -- (-2539.580) [-2536.747] (-2539.968) (-2536.502) * [-2536.999] (-2548.278) (-2540.339) (-2539.423) -- 0:03:07
      176000 -- (-2544.104) [-2538.841] (-2538.182) (-2536.880) * [-2543.893] (-2544.229) (-2538.010) (-2536.938) -- 0:03:07
      176500 -- (-2538.631) (-2534.572) (-2541.318) [-2540.880] * (-2551.954) (-2538.574) [-2534.004] (-2536.920) -- 0:03:06
      177000 -- (-2538.000) [-2537.330] (-2537.131) (-2542.142) * (-2540.761) (-2537.220) (-2537.889) [-2537.912] -- 0:03:05
      177500 -- (-2536.732) [-2536.062] (-2540.115) (-2546.613) * (-2539.903) (-2545.513) (-2546.502) [-2539.993] -- 0:03:09
      178000 -- (-2536.044) (-2539.605) [-2540.408] (-2542.909) * (-2538.030) (-2550.898) [-2534.734] (-2539.448) -- 0:03:09
      178500 -- (-2547.286) (-2535.450) [-2534.771] (-2539.463) * (-2544.810) (-2544.471) [-2534.063] (-2534.781) -- 0:03:08
      179000 -- [-2539.776] (-2538.019) (-2532.700) (-2540.783) * (-2542.746) [-2546.925] (-2539.299) (-2539.252) -- 0:03:08
      179500 -- (-2544.597) (-2541.134) [-2540.227] (-2540.544) * (-2549.703) (-2540.351) [-2536.920] (-2536.365) -- 0:03:07
      180000 -- (-2542.669) (-2548.361) (-2535.032) [-2537.184] * [-2540.621] (-2543.700) (-2540.478) (-2542.002) -- 0:03:06

      Average standard deviation of split frequencies: 0.006523

      180500 -- (-2541.250) (-2548.698) [-2539.603] (-2543.054) * (-2539.887) (-2538.657) [-2540.680] (-2537.865) -- 0:03:06
      181000 -- (-2542.078) [-2538.994] (-2535.126) (-2542.133) * (-2543.227) (-2535.343) (-2544.009) [-2538.897] -- 0:03:05
      181500 -- (-2537.804) (-2539.139) (-2536.809) [-2539.589] * [-2536.242] (-2545.742) (-2534.277) (-2541.013) -- 0:03:04
      182000 -- (-2537.766) (-2534.765) (-2531.510) [-2538.475] * (-2536.817) (-2537.217) (-2542.101) [-2540.719] -- 0:03:08
      182500 -- [-2541.271] (-2545.523) (-2538.555) (-2539.341) * [-2539.170] (-2537.510) (-2539.291) (-2537.309) -- 0:03:08
      183000 -- [-2537.820] (-2540.127) (-2534.018) (-2542.380) * (-2534.028) (-2540.120) [-2543.649] (-2544.581) -- 0:03:07
      183500 -- (-2537.974) (-2538.601) [-2547.942] (-2543.237) * [-2538.812] (-2549.029) (-2540.461) (-2538.289) -- 0:03:06
      184000 -- (-2539.231) [-2536.763] (-2542.434) (-2541.082) * [-2542.727] (-2553.147) (-2538.706) (-2550.463) -- 0:03:06
      184500 -- [-2539.032] (-2539.809) (-2541.315) (-2543.905) * (-2540.179) (-2541.027) (-2547.666) [-2535.935] -- 0:03:05
      185000 -- (-2543.128) (-2536.401) (-2546.295) [-2537.347] * (-2542.557) (-2539.578) [-2544.811] (-2538.607) -- 0:03:05

      Average standard deviation of split frequencies: 0.006336

      185500 -- [-2539.999] (-2536.688) (-2550.439) (-2538.792) * (-2542.093) (-2537.827) [-2540.491] (-2542.563) -- 0:03:04
      186000 -- [-2539.325] (-2538.570) (-2544.192) (-2536.618) * (-2538.618) [-2544.509] (-2538.652) (-2538.448) -- 0:03:03
      186500 -- [-2539.638] (-2540.996) (-2539.967) (-2536.931) * (-2540.172) (-2533.528) (-2538.046) [-2537.477] -- 0:03:07
      187000 -- (-2544.366) (-2534.721) [-2546.999] (-2543.598) * (-2538.707) [-2533.153] (-2537.806) (-2538.570) -- 0:03:06
      187500 -- (-2545.119) [-2536.632] (-2536.869) (-2548.703) * [-2539.671] (-2530.720) (-2538.268) (-2542.150) -- 0:03:06
      188000 -- (-2535.655) [-2539.200] (-2539.648) (-2542.838) * (-2540.654) [-2534.702] (-2532.280) (-2544.226) -- 0:03:05
      188500 -- (-2540.701) [-2532.971] (-2535.448) (-2542.483) * (-2539.330) (-2543.917) (-2536.720) [-2539.685] -- 0:03:05
      189000 -- (-2536.722) (-2538.056) [-2537.282] (-2547.755) * [-2539.297] (-2543.353) (-2539.317) (-2535.290) -- 0:03:04
      189500 -- [-2539.341] (-2543.252) (-2544.195) (-2545.156) * (-2540.545) (-2542.312) [-2540.098] (-2538.298) -- 0:03:03
      190000 -- (-2536.323) [-2536.400] (-2544.566) (-2543.762) * [-2534.755] (-2535.925) (-2543.260) (-2536.085) -- 0:03:03

      Average standard deviation of split frequencies: 0.008653

      190500 -- (-2541.236) [-2534.646] (-2544.717) (-2543.002) * [-2537.869] (-2538.600) (-2544.567) (-2540.173) -- 0:03:06
      191000 -- (-2539.090) (-2547.860) (-2542.307) [-2539.871] * (-2539.676) (-2550.009) [-2549.100] (-2537.268) -- 0:03:06
      191500 -- (-2541.867) (-2539.834) (-2537.124) [-2539.287] * [-2536.474] (-2547.330) (-2544.878) (-2538.348) -- 0:03:05
      192000 -- (-2539.929) (-2543.721) (-2543.584) [-2537.789] * (-2535.785) (-2538.551) (-2542.883) [-2540.473] -- 0:03:05
      192500 -- [-2548.646] (-2543.054) (-2535.928) (-2542.477) * (-2539.504) (-2535.197) (-2542.166) [-2543.156] -- 0:03:04
      193000 -- (-2540.651) (-2538.498) [-2537.276] (-2543.180) * (-2536.931) (-2535.900) [-2541.874] (-2539.034) -- 0:03:03
      193500 -- (-2539.373) (-2540.412) [-2537.056] (-2540.131) * (-2546.693) [-2533.216] (-2536.914) (-2538.659) -- 0:03:03
      194000 -- [-2541.982] (-2539.623) (-2539.993) (-2547.431) * (-2542.837) [-2537.625] (-2543.370) (-2535.320) -- 0:03:02
      194500 -- [-2540.515] (-2543.406) (-2541.989) (-2537.803) * (-2543.451) [-2537.365] (-2540.419) (-2535.399) -- 0:03:02
      195000 -- [-2535.959] (-2541.511) (-2539.915) (-2535.327) * (-2534.894) [-2538.617] (-2537.936) (-2537.047) -- 0:03:05

      Average standard deviation of split frequencies: 0.008418

      195500 -- [-2539.561] (-2539.793) (-2545.280) (-2534.149) * [-2532.662] (-2542.503) (-2541.290) (-2535.346) -- 0:03:05
      196000 -- [-2537.197] (-2549.441) (-2539.005) (-2536.719) * (-2539.635) (-2546.202) (-2544.159) [-2538.733] -- 0:03:04
      196500 -- [-2541.520] (-2541.343) (-2541.207) (-2541.482) * [-2538.377] (-2541.620) (-2541.576) (-2536.610) -- 0:03:04
      197000 -- (-2542.194) (-2547.651) [-2538.188] (-2535.883) * [-2542.078] (-2533.630) (-2537.607) (-2542.644) -- 0:03:03
      197500 -- (-2542.023) (-2544.608) [-2534.718] (-2538.173) * [-2539.563] (-2538.866) (-2540.221) (-2545.886) -- 0:03:02
      198000 -- (-2535.162) (-2537.768) [-2541.838] (-2537.480) * [-2541.901] (-2540.288) (-2538.058) (-2538.303) -- 0:03:06
      198500 -- (-2541.732) [-2538.158] (-2539.246) (-2545.004) * [-2541.785] (-2542.715) (-2541.976) (-2541.311) -- 0:03:05
      199000 -- [-2536.386] (-2534.577) (-2532.694) (-2546.801) * (-2537.845) (-2543.236) [-2532.189] (-2536.586) -- 0:03:05
      199500 -- (-2538.950) [-2535.874] (-2540.249) (-2537.023) * (-2538.254) (-2537.786) [-2533.936] (-2540.580) -- 0:03:04
      200000 -- (-2537.529) (-2540.857) [-2539.601] (-2541.372) * (-2533.336) [-2538.210] (-2541.479) (-2541.644) -- 0:03:04

      Average standard deviation of split frequencies: 0.008222

      200500 -- (-2535.268) (-2542.795) (-2543.776) [-2536.692] * [-2539.754] (-2535.715) (-2536.371) (-2540.713) -- 0:03:03
      201000 -- (-2546.144) (-2543.114) [-2541.110] (-2533.748) * (-2543.290) (-2537.675) [-2540.855] (-2537.992) -- 0:03:02
      201500 -- (-2546.189) (-2542.368) [-2539.043] (-2535.811) * (-2545.205) [-2536.980] (-2542.819) (-2541.545) -- 0:03:06
      202000 -- (-2547.240) (-2543.210) (-2541.299) [-2542.124] * (-2537.102) [-2539.113] (-2535.797) (-2537.158) -- 0:03:05
      202500 -- (-2541.322) (-2538.578) [-2538.131] (-2541.472) * (-2538.324) (-2541.976) (-2545.469) [-2535.916] -- 0:03:05
      203000 -- (-2541.232) (-2544.044) (-2539.095) [-2535.979] * (-2538.950) (-2540.379) (-2536.789) [-2536.677] -- 0:03:04
      203500 -- [-2544.030] (-2542.202) (-2534.882) (-2542.322) * (-2547.724) (-2538.928) [-2537.178] (-2536.794) -- 0:03:03
      204000 -- (-2538.510) (-2539.988) (-2544.075) [-2535.538] * (-2536.153) [-2542.018] (-2543.619) (-2540.163) -- 0:03:03
      204500 -- (-2533.729) (-2539.587) [-2536.648] (-2546.117) * [-2540.058] (-2541.337) (-2539.935) (-2535.561) -- 0:03:02
      205000 -- (-2538.697) [-2536.495] (-2540.975) (-2543.667) * (-2549.610) [-2540.654] (-2541.948) (-2543.297) -- 0:03:02

      Average standard deviation of split frequencies: 0.010298

      205500 -- (-2539.190) [-2534.405] (-2545.871) (-2541.786) * [-2539.892] (-2537.829) (-2537.638) (-2541.226) -- 0:03:01
      206000 -- (-2535.078) (-2535.360) [-2538.849] (-2540.320) * [-2535.461] (-2543.812) (-2537.378) (-2543.005) -- 0:03:05
      206500 -- (-2541.818) [-2534.144] (-2536.631) (-2536.753) * (-2536.164) (-2543.421) (-2538.779) [-2532.756] -- 0:03:04
      207000 -- (-2541.432) (-2538.202) (-2536.691) [-2535.306] * (-2535.318) (-2542.710) (-2541.668) [-2536.245] -- 0:03:03
      207500 -- (-2535.914) (-2539.524) [-2540.735] (-2535.052) * (-2542.057) (-2541.621) (-2535.542) [-2541.231] -- 0:03:03
      208000 -- (-2536.630) [-2542.056] (-2537.187) (-2543.793) * (-2535.597) (-2542.017) (-2537.047) [-2535.037] -- 0:03:02
      208500 -- (-2537.148) (-2542.372) [-2534.939] (-2542.738) * (-2544.991) [-2531.558] (-2546.131) (-2538.640) -- 0:03:02
      209000 -- [-2539.129] (-2538.202) (-2541.393) (-2538.665) * (-2539.536) (-2539.019) (-2549.477) [-2538.105] -- 0:03:01
      209500 -- (-2541.602) (-2543.329) [-2540.246] (-2536.243) * (-2542.858) [-2539.676] (-2534.060) (-2543.676) -- 0:03:01
      210000 -- (-2544.791) (-2547.816) (-2534.824) [-2538.931] * (-2542.080) [-2538.057] (-2534.035) (-2545.058) -- 0:03:00

      Average standard deviation of split frequencies: 0.010070

      210500 -- [-2539.682] (-2551.405) (-2545.382) (-2535.491) * (-2539.998) (-2542.345) [-2533.977] (-2541.768) -- 0:03:03
      211000 -- (-2545.614) [-2540.551] (-2535.996) (-2542.733) * (-2540.137) [-2536.475] (-2533.133) (-2538.269) -- 0:03:03
      211500 -- [-2534.378] (-2548.159) (-2537.338) (-2541.438) * (-2538.840) (-2545.476) (-2545.416) [-2535.903] -- 0:03:02
      212000 -- (-2540.954) (-2543.943) (-2540.419) [-2536.654] * (-2540.385) (-2548.435) [-2544.985] (-2540.790) -- 0:03:02
      212500 -- (-2538.719) (-2536.126) [-2543.946] (-2537.101) * (-2534.457) (-2544.917) [-2540.803] (-2535.827) -- 0:03:01
      213000 -- [-2539.666] (-2544.120) (-2538.157) (-2534.702) * (-2539.019) (-2539.086) [-2541.367] (-2538.520) -- 0:03:01
      213500 -- (-2552.555) (-2540.551) (-2539.346) [-2536.900] * [-2537.561] (-2539.624) (-2536.427) (-2534.650) -- 0:03:00
      214000 -- (-2539.528) (-2546.086) [-2540.520] (-2542.838) * (-2532.955) (-2540.627) [-2540.388] (-2541.058) -- 0:02:59
      214500 -- (-2536.741) (-2542.406) [-2543.511] (-2539.545) * (-2535.583) [-2533.664] (-2533.172) (-2538.188) -- 0:02:59
      215000 -- (-2536.301) [-2539.970] (-2541.869) (-2540.348) * (-2538.228) (-2536.293) [-2533.947] (-2539.490) -- 0:03:02

      Average standard deviation of split frequencies: 0.008730

      215500 -- (-2537.147) (-2543.811) (-2538.625) [-2537.054] * (-2542.731) [-2537.165] (-2543.139) (-2540.173) -- 0:03:02
      216000 -- (-2542.087) (-2539.616) [-2536.969] (-2539.435) * (-2533.889) [-2540.453] (-2539.816) (-2538.568) -- 0:03:01
      216500 -- (-2544.547) (-2539.098) (-2538.304) [-2537.640] * (-2540.481) (-2532.869) (-2536.542) [-2536.982] -- 0:03:00
      217000 -- (-2543.792) [-2538.666] (-2543.953) (-2541.053) * (-2536.375) [-2534.306] (-2535.800) (-2543.584) -- 0:03:00
      217500 -- (-2539.551) [-2540.739] (-2550.488) (-2538.950) * (-2542.191) (-2541.135) (-2535.662) [-2540.001] -- 0:02:59
      218000 -- (-2543.840) (-2536.003) [-2538.915] (-2546.429) * (-2543.660) (-2537.280) [-2535.625] (-2547.084) -- 0:02:59
      218500 -- (-2539.874) (-2541.478) [-2537.080] (-2539.076) * (-2547.626) (-2542.129) [-2539.253] (-2540.690) -- 0:02:58
      219000 -- (-2538.387) (-2533.055) (-2535.550) [-2540.657] * (-2536.813) [-2536.096] (-2541.602) (-2543.040) -- 0:02:58
      219500 -- (-2536.450) [-2534.162] (-2536.177) (-2546.765) * (-2539.450) (-2535.277) (-2538.028) [-2542.644] -- 0:03:01
      220000 -- (-2536.341) (-2542.082) [-2538.948] (-2542.356) * [-2536.167] (-2539.639) (-2536.085) (-2543.845) -- 0:03:00

      Average standard deviation of split frequencies: 0.008545

      220500 -- (-2538.164) (-2540.522) [-2531.544] (-2539.004) * [-2541.211] (-2537.463) (-2542.424) (-2538.650) -- 0:03:00
      221000 -- (-2539.731) (-2539.721) (-2538.480) [-2534.372] * (-2539.677) (-2537.784) (-2545.489) [-2539.148] -- 0:02:59
      221500 -- (-2536.431) [-2542.628] (-2543.797) (-2543.015) * (-2535.702) (-2534.997) [-2540.825] (-2537.299) -- 0:02:59
      222000 -- [-2537.843] (-2545.476) (-2540.220) (-2543.895) * [-2537.478] (-2542.066) (-2543.630) (-2539.193) -- 0:02:58
      222500 -- (-2542.114) [-2538.202] (-2542.450) (-2549.041) * [-2538.664] (-2538.193) (-2538.264) (-2546.232) -- 0:02:58
      223000 -- (-2536.384) [-2535.283] (-2541.334) (-2555.124) * (-2537.195) (-2537.780) [-2535.184] (-2538.937) -- 0:02:57
      223500 -- [-2535.310] (-2532.802) (-2540.009) (-2545.945) * [-2538.960] (-2544.091) (-2538.730) (-2544.840) -- 0:02:57
      224000 -- [-2535.069] (-2542.151) (-2548.240) (-2548.301) * [-2536.608] (-2541.238) (-2535.235) (-2543.927) -- 0:03:00
      224500 -- [-2539.082] (-2539.801) (-2541.592) (-2540.654) * (-2532.948) (-2539.653) (-2536.593) [-2535.946] -- 0:02:59
      225000 -- [-2539.529] (-2537.662) (-2544.567) (-2533.750) * (-2542.209) (-2544.071) [-2536.447] (-2543.150) -- 0:02:59

      Average standard deviation of split frequencies: 0.007301

      225500 -- (-2550.144) (-2539.212) [-2542.777] (-2542.325) * (-2535.691) (-2536.694) (-2538.047) [-2534.352] -- 0:02:58
      226000 -- (-2556.249) (-2539.077) (-2540.773) [-2535.668] * (-2539.087) (-2544.253) [-2538.622] (-2533.777) -- 0:02:58
      226500 -- [-2541.633] (-2537.835) (-2540.512) (-2537.053) * [-2538.264] (-2540.069) (-2540.057) (-2537.323) -- 0:02:57
      227000 -- (-2547.959) (-2544.579) (-2551.346) [-2533.675] * (-2541.672) [-2540.664] (-2539.233) (-2537.094) -- 0:02:57
      227500 -- [-2540.224] (-2547.563) (-2540.707) (-2542.290) * [-2537.916] (-2541.934) (-2540.738) (-2539.011) -- 0:02:56
      228000 -- (-2539.548) [-2539.128] (-2538.431) (-2537.097) * (-2543.851) (-2536.676) (-2534.531) [-2539.521] -- 0:02:56
      228500 -- (-2537.229) (-2537.449) (-2543.719) [-2539.745] * (-2544.153) (-2541.233) [-2539.566] (-2543.547) -- 0:02:58
      229000 -- [-2533.960] (-2537.930) (-2538.772) (-2539.354) * (-2547.876) (-2537.858) [-2536.805] (-2542.622) -- 0:02:58
      229500 -- (-2534.360) (-2541.959) [-2537.368] (-2540.789) * [-2545.335] (-2539.184) (-2538.908) (-2535.091) -- 0:02:57
      230000 -- [-2536.774] (-2544.579) (-2535.987) (-2537.956) * (-2538.712) (-2542.938) [-2533.980] (-2534.328) -- 0:02:57

      Average standard deviation of split frequencies: 0.006131

      230500 -- (-2538.127) (-2538.814) (-2541.068) [-2534.651] * [-2536.413] (-2539.627) (-2537.496) (-2538.238) -- 0:02:56
      231000 -- (-2540.367) [-2535.731] (-2540.304) (-2542.703) * (-2537.090) (-2542.188) [-2540.053] (-2538.381) -- 0:02:56
      231500 -- [-2543.625] (-2532.039) (-2541.925) (-2539.486) * (-2540.670) (-2535.473) [-2542.689] (-2537.732) -- 0:02:55
      232000 -- (-2537.371) [-2539.654] (-2544.015) (-2541.694) * (-2540.307) [-2534.837] (-2547.233) (-2538.052) -- 0:02:55
      232500 -- (-2541.564) [-2540.820] (-2545.103) (-2539.160) * (-2535.918) [-2534.769] (-2541.626) (-2539.717) -- 0:02:54
      233000 -- (-2546.423) (-2548.888) [-2539.608] (-2544.794) * (-2539.028) (-2545.339) (-2540.254) [-2540.824] -- 0:02:57
      233500 -- (-2547.398) (-2546.451) [-2543.642] (-2546.049) * [-2536.472] (-2541.021) (-2535.738) (-2543.577) -- 0:02:57
      234000 -- (-2540.470) (-2540.746) [-2537.184] (-2540.217) * (-2538.736) (-2543.653) [-2543.530] (-2545.125) -- 0:02:56
      234500 -- (-2541.385) (-2538.879) (-2541.703) [-2539.033] * (-2548.659) [-2535.322] (-2537.504) (-2545.249) -- 0:02:56
      235000 -- (-2538.792) [-2542.802] (-2544.924) (-2542.559) * [-2539.715] (-2540.303) (-2540.404) (-2550.420) -- 0:02:55

      Average standard deviation of split frequencies: 0.005992

      235500 -- (-2547.640) (-2539.988) (-2543.697) [-2542.757] * (-2541.422) (-2534.966) (-2545.597) [-2547.942] -- 0:02:55
      236000 -- (-2536.584) [-2537.521] (-2544.136) (-2542.197) * (-2543.724) [-2542.656] (-2538.314) (-2547.912) -- 0:02:54
      236500 -- [-2536.032] (-2538.272) (-2545.493) (-2539.535) * [-2538.338] (-2538.637) (-2541.171) (-2542.283) -- 0:02:54
      237000 -- (-2544.650) (-2544.342) (-2542.998) [-2543.413] * (-2539.838) (-2538.055) (-2537.801) [-2537.146] -- 0:02:57
      237500 -- (-2543.932) [-2539.662] (-2537.155) (-2541.871) * (-2543.887) (-2534.353) (-2538.622) [-2535.379] -- 0:02:56
      238000 -- (-2535.630) (-2539.419) [-2533.707] (-2544.210) * (-2546.284) (-2542.586) [-2538.531] (-2539.189) -- 0:02:56
      238500 -- [-2540.466] (-2536.698) (-2537.869) (-2543.046) * (-2537.244) (-2546.125) [-2535.398] (-2539.941) -- 0:02:55
      239000 -- [-2536.727] (-2547.459) (-2544.302) (-2544.751) * (-2549.505) [-2540.857] (-2541.137) (-2539.317) -- 0:02:55
      239500 -- [-2538.459] (-2541.088) (-2535.813) (-2538.015) * (-2541.158) [-2534.942] (-2540.677) (-2539.626) -- 0:02:54
      240000 -- (-2536.190) (-2538.493) (-2539.543) [-2543.569] * (-2543.022) (-2534.253) (-2539.662) [-2539.594] -- 0:02:54

      Average standard deviation of split frequencies: 0.005876

      240500 -- (-2539.563) (-2543.787) (-2536.976) [-2535.128] * [-2547.826] (-2547.043) (-2536.622) (-2541.764) -- 0:02:53
      241000 -- (-2533.831) [-2541.225] (-2541.961) (-2536.460) * (-2544.771) (-2537.359) [-2542.052] (-2542.899) -- 0:02:53
      241500 -- (-2539.848) (-2543.978) [-2537.561] (-2538.716) * [-2545.290] (-2539.981) (-2545.273) (-2538.669) -- 0:02:55
      242000 -- (-2534.806) (-2544.082) (-2537.744) [-2542.291] * (-2539.804) (-2537.361) (-2543.973) [-2538.938] -- 0:02:55
      242500 -- (-2547.773) (-2541.036) (-2542.495) [-2534.153] * (-2537.873) (-2540.258) (-2541.983) [-2541.536] -- 0:02:54
      243000 -- (-2545.530) [-2546.153] (-2546.117) (-2540.744) * (-2536.179) (-2537.160) [-2540.506] (-2547.862) -- 0:02:54
      243500 -- [-2537.243] (-2543.374) (-2541.296) (-2535.531) * [-2537.606] (-2544.127) (-2537.844) (-2544.391) -- 0:02:53
      244000 -- [-2543.338] (-2540.605) (-2540.161) (-2534.598) * (-2541.121) [-2535.845] (-2539.457) (-2539.961) -- 0:02:53
      244500 -- (-2539.251) [-2537.880] (-2538.555) (-2542.536) * (-2539.112) [-2536.325] (-2535.559) (-2539.312) -- 0:02:53
      245000 -- (-2541.244) (-2539.370) [-2539.686] (-2546.281) * (-2540.033) (-2540.249) [-2537.811] (-2537.916) -- 0:02:52

      Average standard deviation of split frequencies: 0.006707

      245500 -- (-2533.902) (-2540.077) (-2539.891) [-2536.144] * [-2536.603] (-2539.225) (-2545.289) (-2539.133) -- 0:02:52
      246000 -- (-2538.698) [-2538.030] (-2546.871) (-2538.394) * (-2533.621) [-2543.992] (-2540.419) (-2536.918) -- 0:02:54
      246500 -- (-2537.700) (-2534.599) (-2543.899) [-2537.629] * (-2537.934) [-2536.775] (-2539.133) (-2537.292) -- 0:02:54
      247000 -- (-2537.299) (-2533.534) (-2541.022) [-2537.501] * (-2536.531) [-2541.178] (-2540.715) (-2538.019) -- 0:02:53
      247500 -- [-2533.491] (-2537.812) (-2539.743) (-2541.498) * (-2533.975) [-2535.729] (-2547.457) (-2537.883) -- 0:02:53
      248000 -- (-2537.495) [-2543.477] (-2536.255) (-2544.910) * (-2541.282) [-2536.594] (-2542.868) (-2535.313) -- 0:02:52
      248500 -- (-2535.067) [-2537.855] (-2538.853) (-2542.359) * [-2538.312] (-2532.447) (-2544.679) (-2538.053) -- 0:02:52
      249000 -- [-2534.124] (-2536.867) (-2541.458) (-2545.234) * (-2540.125) (-2541.103) [-2543.716] (-2541.510) -- 0:02:51
      249500 -- [-2535.764] (-2544.655) (-2537.062) (-2541.429) * [-2538.153] (-2542.809) (-2535.145) (-2544.052) -- 0:02:51
      250000 -- [-2531.839] (-2541.588) (-2539.629) (-2538.053) * [-2538.207] (-2540.109) (-2537.734) (-2558.402) -- 0:02:51

      Average standard deviation of split frequencies: 0.006582

      250500 -- (-2536.916) (-2537.293) [-2535.330] (-2531.881) * (-2541.532) [-2538.637] (-2543.534) (-2540.121) -- 0:02:50
      251000 -- (-2537.744) [-2536.411] (-2541.427) (-2536.162) * [-2541.329] (-2539.933) (-2547.930) (-2540.079) -- 0:02:53
      251500 -- (-2534.786) (-2539.987) (-2536.742) [-2538.210] * (-2540.650) (-2538.312) (-2540.826) [-2538.767] -- 0:02:52
      252000 -- (-2542.760) (-2542.225) (-2536.194) [-2543.256] * [-2536.723] (-2545.041) (-2542.645) (-2537.489) -- 0:02:52
      252500 -- (-2542.619) (-2551.621) (-2540.675) [-2534.759] * (-2540.083) (-2537.199) (-2539.665) [-2543.912] -- 0:02:51
      253000 -- (-2538.039) (-2536.351) (-2537.937) [-2539.118] * (-2537.953) (-2538.985) (-2545.620) [-2534.388] -- 0:02:51
      253500 -- (-2533.771) (-2543.857) (-2540.997) [-2535.874] * [-2539.518] (-2542.442) (-2545.178) (-2535.595) -- 0:02:50
      254000 -- (-2538.191) (-2539.649) [-2540.779] (-2545.034) * (-2547.278) [-2541.277] (-2540.912) (-2537.891) -- 0:02:50
      254500 -- (-2535.214) [-2542.733] (-2535.894) (-2540.760) * [-2544.369] (-2532.560) (-2537.349) (-2549.188) -- 0:02:49
      255000 -- [-2538.381] (-2540.521) (-2535.213) (-2545.185) * (-2536.112) (-2536.285) (-2538.723) [-2543.760] -- 0:02:49

      Average standard deviation of split frequencies: 0.006445

      255500 -- (-2541.449) (-2542.922) [-2535.163] (-2539.300) * (-2541.779) (-2539.361) [-2537.166] (-2536.759) -- 0:02:51
      256000 -- (-2538.100) (-2542.807) [-2538.203] (-2543.836) * (-2539.054) (-2536.931) [-2535.239] (-2537.009) -- 0:02:51
      256500 -- (-2536.641) (-2545.491) [-2537.921] (-2536.811) * (-2540.440) (-2535.960) [-2539.796] (-2541.455) -- 0:02:51
      257000 -- (-2536.664) [-2534.494] (-2540.060) (-2539.027) * (-2534.833) (-2540.388) [-2539.308] (-2539.269) -- 0:02:50
      257500 -- (-2544.987) (-2547.415) (-2537.607) [-2535.873] * [-2537.762] (-2548.437) (-2541.391) (-2544.170) -- 0:02:50
      258000 -- [-2540.679] (-2538.613) (-2544.527) (-2548.131) * (-2538.248) (-2541.894) [-2536.340] (-2536.986) -- 0:02:49
      258500 -- (-2534.550) [-2546.436] (-2544.551) (-2544.375) * (-2538.107) (-2543.515) [-2537.215] (-2540.624) -- 0:02:49
      259000 -- [-2534.409] (-2542.205) (-2546.808) (-2545.900) * (-2544.900) (-2537.996) (-2541.330) [-2536.847] -- 0:02:48
      259500 -- (-2534.311) (-2536.541) (-2539.496) [-2544.332] * (-2536.152) [-2540.664] (-2538.232) (-2541.105) -- 0:02:48
      260000 -- (-2540.484) [-2532.844] (-2539.233) (-2543.504) * (-2537.356) (-2536.833) (-2540.605) [-2535.416] -- 0:02:50

      Average standard deviation of split frequencies: 0.006330

      260500 -- (-2534.434) [-2536.856] (-2550.782) (-2535.025) * [-2538.658] (-2538.333) (-2542.353) (-2545.170) -- 0:02:50
      261000 -- [-2537.363] (-2537.680) (-2539.673) (-2545.066) * (-2541.571) (-2536.120) (-2536.448) [-2538.421] -- 0:02:49
      261500 -- (-2537.178) (-2537.709) (-2548.262) [-2538.758] * (-2538.810) [-2539.640] (-2540.612) (-2540.263) -- 0:02:49
      262000 -- (-2538.689) (-2539.110) (-2542.422) [-2537.825] * (-2542.344) (-2542.210) (-2537.872) [-2538.879] -- 0:02:49
      262500 -- (-2541.887) (-2545.469) [-2538.020] (-2546.988) * (-2540.179) [-2539.522] (-2537.344) (-2545.049) -- 0:02:48
      263000 -- (-2537.019) (-2542.400) [-2538.319] (-2541.531) * (-2543.740) [-2540.581] (-2539.715) (-2536.774) -- 0:02:48
      263500 -- (-2533.755) (-2543.529) [-2535.601] (-2542.008) * (-2537.373) [-2540.166] (-2539.379) (-2544.249) -- 0:02:47
      264000 -- [-2540.690] (-2539.344) (-2537.480) (-2544.153) * [-2531.877] (-2542.346) (-2531.733) (-2543.909) -- 0:02:50
      264500 -- (-2531.938) (-2540.899) (-2542.380) [-2546.916] * (-2532.985) (-2536.572) (-2538.115) [-2544.274] -- 0:02:49
      265000 -- [-2537.205] (-2536.782) (-2543.217) (-2541.379) * [-2536.803] (-2537.228) (-2536.113) (-2542.197) -- 0:02:49

      Average standard deviation of split frequencies: 0.006203

      265500 -- (-2552.594) (-2538.459) [-2542.196] (-2543.393) * [-2535.166] (-2535.095) (-2533.336) (-2536.738) -- 0:02:48
      266000 -- [-2535.905] (-2536.986) (-2546.509) (-2549.976) * (-2544.652) (-2538.738) (-2541.551) [-2539.896] -- 0:02:48
      266500 -- (-2540.844) (-2537.698) [-2535.818] (-2541.452) * (-2541.748) (-2535.853) (-2538.602) [-2534.339] -- 0:02:47
      267000 -- [-2536.659] (-2546.404) (-2542.854) (-2541.859) * (-2543.727) (-2539.393) (-2533.197) [-2536.397] -- 0:02:47
      267500 -- (-2533.771) (-2540.861) [-2535.161] (-2547.020) * (-2537.441) (-2543.013) [-2534.216] (-2535.439) -- 0:02:47
      268000 -- (-2541.999) [-2536.257] (-2537.714) (-2539.923) * (-2539.062) (-2543.447) [-2535.762] (-2535.426) -- 0:02:46
      268500 -- (-2542.715) (-2534.959) [-2538.768] (-2541.647) * (-2536.824) [-2544.520] (-2538.257) (-2538.899) -- 0:02:48
      269000 -- (-2548.881) (-2543.086) (-2539.140) [-2541.414] * (-2534.526) (-2538.995) (-2539.836) [-2538.118] -- 0:02:48
      269500 -- [-2539.353] (-2539.000) (-2543.373) (-2541.036) * [-2544.140] (-2537.071) (-2543.451) (-2547.860) -- 0:02:48
      270000 -- (-2542.936) (-2545.428) [-2533.016] (-2541.613) * (-2539.078) (-2533.694) (-2539.320) [-2540.173] -- 0:02:47

      Average standard deviation of split frequencies: 0.006967

      270500 -- (-2537.089) [-2539.795] (-2534.188) (-2536.032) * (-2535.014) (-2533.571) [-2534.298] (-2539.677) -- 0:02:47
      271000 -- (-2543.754) (-2538.996) (-2540.922) [-2534.979] * (-2539.448) (-2535.806) (-2537.244) [-2541.434] -- 0:02:46
      271500 -- (-2535.188) [-2538.358] (-2547.259) (-2536.347) * (-2545.982) (-2539.697) (-2537.934) [-2536.461] -- 0:02:46
      272000 -- (-2539.794) (-2539.983) [-2537.623] (-2537.155) * (-2538.674) (-2539.008) (-2535.203) [-2538.229] -- 0:02:45
      272500 -- (-2540.453) (-2537.306) [-2539.153] (-2539.599) * [-2543.524] (-2538.420) (-2540.445) (-2540.328) -- 0:02:45
      273000 -- (-2540.841) (-2536.822) (-2541.288) [-2538.786] * (-2536.765) (-2542.818) [-2536.583] (-2539.935) -- 0:02:47
      273500 -- (-2543.710) (-2534.641) (-2543.611) [-2539.130] * (-2535.253) (-2538.232) (-2536.221) [-2545.511] -- 0:02:47
      274000 -- (-2537.859) (-2538.509) (-2536.377) [-2538.466] * (-2537.003) (-2550.288) [-2537.984] (-2543.265) -- 0:02:46
      274500 -- [-2544.427] (-2539.507) (-2541.463) (-2537.444) * (-2538.640) [-2535.702] (-2539.777) (-2538.919) -- 0:02:46
      275000 -- (-2542.570) (-2542.415) [-2536.227] (-2542.260) * (-2539.742) (-2534.268) (-2541.965) [-2537.149] -- 0:02:46

      Average standard deviation of split frequencies: 0.006832

      275500 -- (-2543.802) [-2537.736] (-2538.104) (-2534.634) * (-2539.377) [-2540.247] (-2541.765) (-2544.550) -- 0:02:45
      276000 -- (-2535.031) (-2539.046) (-2541.637) [-2536.140] * (-2542.883) (-2535.945) [-2540.633] (-2538.679) -- 0:02:45
      276500 -- (-2536.225) [-2535.786] (-2539.418) (-2535.862) * [-2541.382] (-2540.223) (-2543.998) (-2535.346) -- 0:02:44
      277000 -- (-2533.523) (-2538.011) [-2536.185] (-2537.006) * (-2549.060) (-2544.462) [-2538.845] (-2534.732) -- 0:02:44
      277500 -- [-2536.656] (-2536.966) (-2541.741) (-2536.896) * (-2544.555) (-2542.612) [-2541.361] (-2544.372) -- 0:02:46
      278000 -- (-2539.842) (-2543.320) (-2539.915) [-2537.231] * (-2537.682) (-2541.310) [-2542.722] (-2543.154) -- 0:02:46
      278500 -- [-2535.544] (-2541.634) (-2538.247) (-2539.975) * (-2532.580) (-2539.517) (-2537.808) [-2536.549] -- 0:02:45
      279000 -- (-2539.426) (-2539.413) (-2539.077) [-2536.863] * (-2537.363) [-2539.964] (-2539.511) (-2548.778) -- 0:02:45
      279500 -- (-2537.218) (-2538.008) [-2541.343] (-2539.349) * (-2533.959) (-2545.117) [-2535.598] (-2538.914) -- 0:02:44
      280000 -- (-2543.408) (-2538.929) (-2537.447) [-2541.022] * (-2543.485) (-2540.223) (-2535.588) [-2538.514] -- 0:02:44

      Average standard deviation of split frequencies: 0.006718

      280500 -- (-2541.595) (-2538.433) [-2531.699] (-2534.045) * (-2541.993) [-2536.631] (-2535.209) (-2539.706) -- 0:02:44
      281000 -- (-2538.077) (-2543.960) [-2539.413] (-2535.686) * (-2537.513) [-2536.090] (-2547.573) (-2546.849) -- 0:02:43
      281500 -- (-2541.154) (-2537.939) [-2535.303] (-2537.818) * (-2536.398) [-2536.128] (-2544.090) (-2534.740) -- 0:02:43
      282000 -- [-2539.423] (-2542.124) (-2545.194) (-2543.083) * (-2540.540) (-2537.576) (-2554.880) [-2542.646] -- 0:02:45
      282500 -- (-2541.081) (-2542.208) [-2533.323] (-2538.027) * (-2538.537) (-2538.324) [-2543.815] (-2538.911) -- 0:02:45
      283000 -- (-2536.809) (-2541.941) (-2539.408) [-2543.117] * [-2542.361] (-2541.881) (-2537.634) (-2539.238) -- 0:02:44
      283500 -- [-2537.085] (-2539.098) (-2538.122) (-2540.540) * (-2539.990) [-2536.171] (-2537.777) (-2537.180) -- 0:02:44
      284000 -- (-2541.956) (-2540.259) (-2538.149) [-2533.361] * (-2537.764) (-2541.034) [-2535.235] (-2534.197) -- 0:02:43
      284500 -- [-2536.017] (-2539.351) (-2546.865) (-2546.944) * (-2536.963) (-2536.841) (-2539.352) [-2534.115] -- 0:02:43
      285000 -- [-2535.435] (-2541.631) (-2536.864) (-2542.469) * (-2545.020) [-2536.397] (-2541.122) (-2545.076) -- 0:02:43

      Average standard deviation of split frequencies: 0.006593

      285500 -- (-2538.704) (-2538.043) (-2542.193) [-2542.718] * (-2539.574) [-2537.336] (-2535.148) (-2545.010) -- 0:02:42
      286000 -- (-2540.030) (-2539.718) (-2545.043) [-2538.771] * [-2540.843] (-2538.075) (-2544.137) (-2539.493) -- 0:02:42
      286500 -- (-2544.547) (-2539.679) (-2539.472) [-2535.868] * [-2535.445] (-2540.959) (-2539.646) (-2534.772) -- 0:02:44
      287000 -- (-2536.203) (-2540.891) (-2540.864) [-2537.397] * (-2533.655) (-2544.107) (-2542.287) [-2537.768] -- 0:02:43
      287500 -- (-2537.689) (-2539.336) [-2534.169] (-2541.528) * (-2532.873) (-2534.316) [-2541.034] (-2541.084) -- 0:02:43
      288000 -- (-2541.823) (-2539.151) [-2543.178] (-2544.328) * (-2540.333) [-2536.500] (-2545.639) (-2545.420) -- 0:02:43
      288500 -- (-2536.518) (-2538.490) (-2540.206) [-2540.500] * (-2541.391) [-2536.896] (-2544.700) (-2538.802) -- 0:02:42
      289000 -- (-2535.226) [-2538.991] (-2534.981) (-2544.298) * [-2536.357] (-2544.445) (-2538.623) (-2538.325) -- 0:02:42
      289500 -- (-2542.035) (-2541.975) (-2541.779) [-2538.623] * [-2539.066] (-2545.148) (-2542.079) (-2537.749) -- 0:02:41
      290000 -- (-2535.152) (-2539.625) [-2539.294] (-2544.143) * (-2540.714) (-2540.351) (-2538.428) [-2539.567] -- 0:02:41

      Average standard deviation of split frequencies: 0.006487

      290500 -- [-2536.930] (-2538.224) (-2533.409) (-2542.972) * [-2536.934] (-2537.943) (-2537.430) (-2542.871) -- 0:02:41
      291000 -- (-2534.886) (-2539.526) [-2537.913] (-2539.996) * (-2539.190) [-2537.537] (-2536.144) (-2545.960) -- 0:02:43
      291500 -- (-2536.564) [-2536.606] (-2537.502) (-2537.605) * (-2536.844) (-2536.929) (-2543.206) [-2538.464] -- 0:02:42
      292000 -- (-2544.374) (-2541.161) (-2536.774) [-2535.708] * [-2539.334] (-2536.742) (-2537.323) (-2538.063) -- 0:02:42
      292500 -- (-2538.240) [-2545.049] (-2537.792) (-2535.095) * [-2535.580] (-2537.884) (-2536.881) (-2536.778) -- 0:02:42
      293000 -- [-2534.816] (-2541.368) (-2544.924) (-2537.881) * [-2537.417] (-2534.377) (-2542.824) (-2537.399) -- 0:02:41
      293500 -- (-2545.148) [-2539.472] (-2541.608) (-2533.933) * (-2542.114) (-2532.823) (-2544.880) [-2536.202] -- 0:02:41
      294000 -- (-2543.751) (-2539.518) (-2541.976) [-2540.209] * (-2535.904) (-2535.145) (-2535.342) [-2536.937] -- 0:02:40
      294500 -- (-2539.184) (-2539.101) [-2538.039] (-2542.220) * (-2534.822) (-2545.930) (-2535.061) [-2541.145] -- 0:02:40
      295000 -- (-2535.382) [-2539.821] (-2537.386) (-2544.740) * (-2537.787) [-2543.959] (-2536.436) (-2537.607) -- 0:02:40

      Average standard deviation of split frequencies: 0.006370

      295500 -- (-2536.478) [-2536.556] (-2540.724) (-2545.243) * (-2543.015) (-2540.428) [-2538.241] (-2538.200) -- 0:02:42
      296000 -- (-2541.286) (-2538.098) (-2542.058) [-2539.503] * [-2541.922] (-2543.157) (-2541.753) (-2536.214) -- 0:02:41
      296500 -- [-2540.123] (-2538.124) (-2537.897) (-2537.571) * (-2538.290) (-2540.429) (-2539.218) [-2538.733] -- 0:02:41
      297000 -- (-2539.817) [-2533.737] (-2539.431) (-2543.561) * (-2538.038) [-2542.402] (-2538.271) (-2539.220) -- 0:02:40
      297500 -- [-2538.535] (-2537.161) (-2542.917) (-2538.556) * (-2542.492) (-2539.635) [-2534.826] (-2543.517) -- 0:02:40
      298000 -- [-2542.428] (-2537.446) (-2537.566) (-2548.459) * [-2533.877] (-2538.778) (-2545.058) (-2536.919) -- 0:02:40
      298500 -- (-2547.311) [-2535.957] (-2539.321) (-2545.938) * (-2544.839) (-2542.449) [-2537.504] (-2541.770) -- 0:02:39
      299000 -- (-2546.003) (-2539.921) [-2540.848] (-2535.161) * [-2543.445] (-2539.161) (-2532.580) (-2539.245) -- 0:02:39
      299500 -- (-2542.579) [-2542.014] (-2537.449) (-2543.834) * (-2540.385) (-2538.215) [-2534.409] (-2538.912) -- 0:02:39
      300000 -- (-2545.401) [-2535.868] (-2534.477) (-2547.116) * (-2548.811) (-2541.040) [-2537.912] (-2533.427) -- 0:02:41

      Average standard deviation of split frequencies: 0.006271

      300500 -- (-2541.369) (-2542.494) [-2537.152] (-2551.327) * [-2540.341] (-2540.653) (-2536.531) (-2536.748) -- 0:02:40
      301000 -- (-2535.959) [-2535.409] (-2538.268) (-2551.070) * (-2543.888) (-2538.474) (-2531.350) [-2534.479] -- 0:02:40
      301500 -- [-2540.230] (-2537.924) (-2537.451) (-2544.150) * (-2539.964) (-2540.580) [-2537.390] (-2536.080) -- 0:02:39
      302000 -- [-2541.294] (-2537.741) (-2536.685) (-2547.977) * (-2536.039) (-2540.036) [-2535.746] (-2542.176) -- 0:02:39
      302500 -- (-2542.425) [-2535.143] (-2536.577) (-2541.579) * (-2536.533) [-2542.822] (-2537.048) (-2541.840) -- 0:02:39
      303000 -- (-2540.913) (-2536.130) [-2536.300] (-2543.756) * (-2539.872) (-2539.312) (-2542.150) [-2534.481] -- 0:02:38
      303500 -- (-2542.552) (-2542.671) [-2539.756] (-2544.984) * (-2540.309) [-2539.118] (-2545.658) (-2543.520) -- 0:02:38
      304000 -- (-2547.517) [-2538.396] (-2538.543) (-2540.952) * (-2535.756) [-2539.156] (-2536.736) (-2537.176) -- 0:02:37
      304500 -- (-2543.782) (-2544.467) [-2541.023] (-2544.085) * (-2536.038) [-2533.797] (-2538.555) (-2551.964) -- 0:02:39
      305000 -- (-2535.278) (-2542.953) [-2544.012] (-2540.006) * [-2540.580] (-2537.136) (-2538.837) (-2538.835) -- 0:02:39

      Average standard deviation of split frequencies: 0.006932

      305500 -- (-2534.041) [-2541.737] (-2549.118) (-2537.870) * (-2542.093) (-2538.140) [-2537.200] (-2541.761) -- 0:02:39
      306000 -- (-2543.065) (-2538.072) (-2543.423) [-2539.474] * (-2537.291) [-2539.386] (-2536.948) (-2550.899) -- 0:02:38
      306500 -- (-2546.294) [-2545.213] (-2553.652) (-2547.761) * (-2540.886) (-2544.589) [-2536.251] (-2547.787) -- 0:02:38
      307000 -- [-2535.655] (-2545.594) (-2546.115) (-2538.302) * [-2540.829] (-2538.863) (-2537.209) (-2535.902) -- 0:02:38
      307500 -- (-2534.129) (-2539.655) [-2543.297] (-2544.168) * [-2539.054] (-2535.754) (-2539.588) (-2544.748) -- 0:02:37
      308000 -- [-2535.160] (-2542.396) (-2539.228) (-2540.337) * [-2534.649] (-2539.837) (-2536.901) (-2546.741) -- 0:02:37
      308500 -- (-2536.623) [-2537.301] (-2538.938) (-2537.374) * [-2537.528] (-2542.039) (-2540.255) (-2538.777) -- 0:02:36
      309000 -- [-2535.909] (-2544.810) (-2544.016) (-2538.792) * [-2538.205] (-2537.656) (-2547.495) (-2540.080) -- 0:02:38
      309500 -- [-2532.977] (-2545.370) (-2552.370) (-2542.484) * (-2536.537) (-2540.456) [-2543.647] (-2540.598) -- 0:02:38
      310000 -- (-2545.551) (-2541.482) (-2541.462) [-2534.036] * [-2542.621] (-2539.161) (-2544.655) (-2533.964) -- 0:02:38

      Average standard deviation of split frequencies: 0.007587

      310500 -- (-2540.000) (-2536.899) (-2538.335) [-2549.429] * (-2543.244) (-2546.752) [-2539.213] (-2543.994) -- 0:02:37
      311000 -- (-2542.800) (-2534.301) [-2541.220] (-2537.052) * (-2538.883) [-2545.103] (-2544.494) (-2542.885) -- 0:02:37
      311500 -- (-2542.288) [-2537.348] (-2536.756) (-2540.896) * (-2539.521) [-2540.927] (-2536.089) (-2548.313) -- 0:02:36
      312000 -- (-2548.736) (-2539.018) [-2536.495] (-2543.331) * (-2542.693) (-2543.311) (-2539.871) [-2535.239] -- 0:02:36
      312500 -- (-2539.629) (-2540.306) (-2533.614) [-2535.729] * (-2546.085) (-2536.445) [-2538.602] (-2534.331) -- 0:02:36
      313000 -- (-2554.864) (-2547.874) [-2540.408] (-2538.430) * (-2535.809) (-2548.060) (-2536.592) [-2539.091] -- 0:02:38
      313500 -- (-2535.824) (-2539.761) [-2534.867] (-2541.315) * (-2534.671) (-2536.833) (-2537.996) [-2543.844] -- 0:02:37
      314000 -- (-2539.713) (-2537.745) (-2537.796) [-2543.579] * [-2538.939] (-2539.724) (-2539.982) (-2541.406) -- 0:02:37
      314500 -- (-2536.517) (-2544.472) [-2540.130] (-2539.792) * [-2535.561] (-2539.018) (-2541.664) (-2539.816) -- 0:02:36
      315000 -- (-2538.317) [-2542.262] (-2540.803) (-2539.355) * [-2534.503] (-2536.669) (-2540.005) (-2541.512) -- 0:02:36

      Average standard deviation of split frequencies: 0.007459

      315500 -- [-2533.652] (-2539.242) (-2534.163) (-2543.680) * (-2539.277) [-2537.708] (-2544.795) (-2534.813) -- 0:02:36
      316000 -- (-2539.607) (-2537.400) (-2541.429) [-2539.024] * (-2542.788) (-2537.219) [-2538.482] (-2537.654) -- 0:02:35
      316500 -- (-2534.815) (-2542.882) (-2539.278) [-2537.022] * (-2540.800) (-2539.965) [-2539.913] (-2536.720) -- 0:02:35
      317000 -- (-2539.929) (-2543.370) (-2538.646) [-2537.457] * (-2537.828) [-2539.052] (-2545.854) (-2540.439) -- 0:02:35
      317500 -- (-2539.866) (-2544.835) (-2543.735) [-2536.633] * (-2542.701) [-2536.527] (-2539.646) (-2541.267) -- 0:02:36
      318000 -- (-2542.034) (-2544.883) (-2539.827) [-2537.909] * (-2539.646) (-2543.654) (-2535.772) [-2537.834] -- 0:02:36
      318500 -- [-2536.366] (-2536.872) (-2537.789) (-2538.791) * [-2537.018] (-2535.114) (-2547.532) (-2537.530) -- 0:02:36
      319000 -- (-2537.392) (-2536.448) [-2536.869] (-2544.763) * (-2537.643) (-2539.412) (-2535.199) [-2537.435] -- 0:02:35
      319500 -- (-2538.203) [-2533.425] (-2535.869) (-2537.840) * (-2542.304) [-2538.163] (-2538.579) (-2547.651) -- 0:02:35
      320000 -- (-2538.458) (-2541.964) (-2541.417) [-2540.256] * (-2543.745) [-2535.290] (-2543.192) (-2537.597) -- 0:02:35

      Average standard deviation of split frequencies: 0.007350

      320500 -- (-2532.345) (-2539.473) [-2541.213] (-2540.964) * [-2539.781] (-2535.542) (-2540.750) (-2538.703) -- 0:02:34
      321000 -- (-2542.067) (-2542.685) [-2536.673] (-2539.160) * [-2540.884] (-2537.541) (-2537.294) (-2544.212) -- 0:02:34
      321500 -- [-2538.679] (-2540.463) (-2542.243) (-2535.745) * (-2548.114) (-2537.896) [-2538.908] (-2542.982) -- 0:02:34
      322000 -- (-2542.319) (-2541.487) [-2535.073] (-2541.952) * (-2541.534) (-2538.154) (-2535.147) [-2537.668] -- 0:02:33
      322500 -- [-2543.702] (-2536.169) (-2539.560) (-2536.278) * (-2537.277) (-2540.901) (-2539.799) [-2534.256] -- 0:02:35
      323000 -- (-2537.024) (-2537.347) (-2537.334) [-2536.325] * (-2548.697) [-2537.074] (-2539.863) (-2541.286) -- 0:02:35
      323500 -- (-2546.770) [-2538.978] (-2537.522) (-2540.887) * (-2546.305) (-2536.152) (-2534.891) [-2542.386] -- 0:02:34
      324000 -- [-2538.504] (-2537.547) (-2539.772) (-2544.462) * (-2546.762) [-2536.310] (-2539.745) (-2544.579) -- 0:02:34
      324500 -- (-2541.678) (-2535.690) [-2542.858] (-2543.814) * (-2535.119) [-2543.737] (-2538.453) (-2543.722) -- 0:02:34
      325000 -- [-2536.949] (-2538.866) (-2538.287) (-2547.453) * (-2537.263) [-2537.635] (-2538.817) (-2542.375) -- 0:02:33

      Average standard deviation of split frequencies: 0.006507

      325500 -- [-2536.972] (-2542.994) (-2537.807) (-2539.161) * (-2537.026) (-2542.616) [-2540.906] (-2539.336) -- 0:02:33
      326000 -- (-2534.344) (-2542.472) [-2538.039] (-2539.691) * (-2538.927) [-2535.339] (-2547.731) (-2539.050) -- 0:02:32
      326500 -- (-2541.247) (-2541.701) [-2537.462] (-2542.664) * (-2537.134) (-2540.712) (-2545.537) [-2541.431] -- 0:02:34
      327000 -- (-2537.017) (-2543.281) [-2537.214] (-2534.801) * [-2542.337] (-2542.941) (-2538.626) (-2537.474) -- 0:02:34
      327500 -- (-2537.135) (-2538.224) [-2541.180] (-2537.041) * (-2538.495) (-2537.661) (-2543.926) [-2541.385] -- 0:02:34
      328000 -- (-2537.873) (-2535.090) [-2537.913] (-2540.791) * (-2536.807) [-2541.514] (-2544.401) (-2541.696) -- 0:02:33
      328500 -- (-2538.778) [-2549.142] (-2535.506) (-2540.808) * (-2536.887) [-2538.235] (-2539.849) (-2538.713) -- 0:02:33
      329000 -- (-2543.181) [-2542.747] (-2534.833) (-2536.081) * (-2545.278) (-2536.894) (-2536.904) [-2546.293] -- 0:02:32
      329500 -- (-2556.189) [-2535.742] (-2536.727) (-2536.541) * (-2542.991) [-2537.908] (-2540.644) (-2549.711) -- 0:02:32
      330000 -- (-2542.955) [-2541.721] (-2543.400) (-2538.077) * [-2541.680] (-2537.055) (-2538.579) (-2538.077) -- 0:02:32

      Average standard deviation of split frequencies: 0.006415

      330500 -- (-2539.027) (-2546.073) (-2545.038) [-2533.078] * (-2544.931) [-2540.248] (-2545.833) (-2541.427) -- 0:02:31
      331000 -- [-2533.545] (-2537.229) (-2546.870) (-2535.553) * (-2537.605) [-2533.309] (-2539.657) (-2542.547) -- 0:02:33
      331500 -- [-2535.022] (-2533.222) (-2541.966) (-2538.938) * (-2538.439) (-2535.153) [-2533.167] (-2541.287) -- 0:02:33
      332000 -- (-2542.811) [-2538.347] (-2537.305) (-2540.051) * (-2537.510) (-2538.022) [-2535.184] (-2538.284) -- 0:02:32
      332500 -- (-2541.960) [-2542.135] (-2544.805) (-2534.637) * [-2534.931] (-2542.569) (-2539.315) (-2537.294) -- 0:02:32
      333000 -- (-2537.464) (-2539.439) [-2535.830] (-2537.244) * (-2536.370) (-2534.805) [-2543.650] (-2547.328) -- 0:02:32
      333500 -- (-2540.169) (-2536.525) (-2550.279) [-2536.415] * (-2534.314) [-2536.082] (-2545.334) (-2532.911) -- 0:02:31
      334000 -- [-2539.658] (-2549.145) (-2539.951) (-2543.011) * (-2535.337) (-2539.811) (-2535.233) [-2536.223] -- 0:02:31
      334500 -- [-2534.206] (-2543.747) (-2541.216) (-2542.735) * [-2537.342] (-2537.442) (-2539.693) (-2536.471) -- 0:02:31
      335000 -- [-2539.011] (-2540.563) (-2537.754) (-2542.126) * (-2536.399) (-2538.397) [-2536.355] (-2539.080) -- 0:02:30

      Average standard deviation of split frequencies: 0.006313

      335500 -- (-2546.343) (-2547.613) (-2540.519) [-2540.376] * (-2539.140) [-2536.870] (-2539.354) (-2536.309) -- 0:02:32
      336000 -- (-2543.919) (-2542.553) [-2536.846] (-2543.315) * (-2543.693) [-2543.292] (-2556.515) (-2534.971) -- 0:02:32
      336500 -- (-2539.143) (-2543.322) [-2532.675] (-2537.425) * (-2543.114) (-2539.633) [-2545.516] (-2535.987) -- 0:02:31
      337000 -- [-2540.388] (-2544.409) (-2533.152) (-2541.310) * (-2547.426) [-2535.394] (-2545.793) (-2540.888) -- 0:02:31
      337500 -- (-2538.830) (-2543.993) [-2535.818] (-2545.850) * (-2534.936) [-2532.680] (-2546.173) (-2540.045) -- 0:02:31
      338000 -- (-2538.896) (-2538.742) [-2536.039] (-2537.707) * [-2534.048] (-2539.004) (-2545.092) (-2540.489) -- 0:02:30
      338500 -- (-2535.470) (-2543.557) [-2543.321] (-2541.317) * (-2538.811) (-2543.712) (-2540.567) [-2543.514] -- 0:02:30
      339000 -- (-2540.250) (-2545.872) (-2537.726) [-2534.847] * (-2549.118) [-2533.798] (-2539.806) (-2539.726) -- 0:02:30
      339500 -- (-2541.201) [-2536.503] (-2537.319) (-2535.111) * [-2544.392] (-2537.530) (-2540.781) (-2534.878) -- 0:02:29
      340000 -- [-2542.468] (-2538.213) (-2540.574) (-2544.985) * (-2543.617) [-2536.651] (-2540.777) (-2538.958) -- 0:02:31

      Average standard deviation of split frequencies: 0.006227

      340500 -- (-2537.712) [-2534.646] (-2538.267) (-2537.275) * (-2541.645) (-2539.415) (-2541.679) [-2539.688] -- 0:02:31
      341000 -- [-2542.502] (-2538.376) (-2539.442) (-2539.897) * (-2545.266) (-2535.840) [-2542.692] (-2538.088) -- 0:02:30
      341500 -- (-2540.121) [-2537.473] (-2549.895) (-2536.036) * (-2543.140) (-2537.484) (-2543.822) [-2535.104] -- 0:02:30
      342000 -- (-2542.010) (-2537.252) (-2541.701) [-2537.526] * [-2541.131] (-2537.901) (-2539.776) (-2536.873) -- 0:02:30
      342500 -- [-2538.296] (-2538.049) (-2537.956) (-2537.427) * (-2542.313) [-2539.267] (-2535.015) (-2538.609) -- 0:02:29
      343000 -- (-2538.613) (-2544.155) (-2545.154) [-2544.225] * (-2541.756) [-2538.701] (-2540.430) (-2538.192) -- 0:02:29
      343500 -- [-2537.135] (-2541.660) (-2534.549) (-2538.418) * (-2540.040) (-2538.593) (-2535.984) [-2535.721] -- 0:02:29
      344000 -- (-2537.220) [-2539.877] (-2543.348) (-2541.403) * [-2534.985] (-2537.791) (-2533.689) (-2537.709) -- 0:02:28
      344500 -- [-2538.218] (-2535.911) (-2541.782) (-2541.423) * (-2542.719) [-2534.512] (-2535.783) (-2533.461) -- 0:02:30
      345000 -- (-2544.019) [-2537.810] (-2553.353) (-2541.000) * (-2547.508) [-2534.038] (-2536.293) (-2544.542) -- 0:02:29

      Average standard deviation of split frequencies: 0.005450

      345500 -- (-2550.545) [-2534.253] (-2547.584) (-2538.808) * [-2537.225] (-2544.399) (-2538.337) (-2540.206) -- 0:02:29
      346000 -- (-2539.379) [-2541.114] (-2535.427) (-2536.486) * (-2545.660) (-2543.675) (-2541.012) [-2532.426] -- 0:02:29
      346500 -- [-2540.055] (-2541.410) (-2539.969) (-2540.552) * (-2546.903) [-2542.679] (-2545.921) (-2540.252) -- 0:02:28
      347000 -- [-2541.142] (-2542.952) (-2531.166) (-2543.514) * (-2546.297) [-2534.397] (-2541.169) (-2533.323) -- 0:02:28
      347500 -- [-2539.642] (-2542.020) (-2540.738) (-2543.329) * (-2549.372) [-2543.060] (-2540.924) (-2539.445) -- 0:02:28
      348000 -- (-2538.309) (-2537.125) (-2537.551) [-2537.350] * (-2543.940) (-2540.803) (-2540.055) [-2547.616] -- 0:02:28
      348500 -- [-2539.238] (-2535.582) (-2540.664) (-2539.803) * (-2536.337) (-2540.142) [-2542.644] (-2540.556) -- 0:02:27
      349000 -- [-2537.821] (-2537.092) (-2538.543) (-2541.249) * (-2541.695) [-2541.699] (-2537.674) (-2544.327) -- 0:02:29
      349500 -- (-2533.940) [-2537.440] (-2538.495) (-2554.425) * (-2535.508) [-2542.140] (-2542.911) (-2541.321) -- 0:02:28
      350000 -- (-2537.130) [-2534.321] (-2539.963) (-2545.111) * (-2540.735) [-2540.246] (-2538.095) (-2542.420) -- 0:02:28

      Average standard deviation of split frequencies: 0.005377

      350500 -- (-2542.247) (-2537.100) [-2533.239] (-2551.748) * (-2540.789) (-2540.022) [-2535.783] (-2540.546) -- 0:02:28
      351000 -- (-2541.657) (-2539.197) [-2536.215] (-2542.197) * (-2538.127) (-2540.676) [-2543.652] (-2539.347) -- 0:02:27
      351500 -- (-2537.275) (-2534.784) (-2549.234) [-2542.913] * (-2538.692) (-2544.529) [-2542.176] (-2541.769) -- 0:02:27
      352000 -- [-2535.515] (-2534.532) (-2539.728) (-2542.986) * (-2545.431) (-2548.131) [-2538.929] (-2537.747) -- 0:02:27
      352500 -- (-2535.122) (-2540.671) [-2535.743] (-2544.443) * [-2534.578] (-2549.576) (-2544.214) (-2540.962) -- 0:02:26
      353000 -- [-2539.722] (-2542.395) (-2540.797) (-2539.415) * [-2536.057] (-2543.095) (-2540.168) (-2541.846) -- 0:02:26
      353500 -- [-2536.891] (-2534.932) (-2540.899) (-2534.790) * [-2540.216] (-2539.046) (-2538.687) (-2540.817) -- 0:02:28
      354000 -- (-2540.935) [-2533.732] (-2541.942) (-2537.371) * (-2540.786) [-2534.418] (-2550.334) (-2540.540) -- 0:02:27
      354500 -- (-2532.902) (-2538.290) (-2532.356) [-2537.445] * (-2538.284) (-2535.628) (-2542.545) [-2536.595] -- 0:02:27
      355000 -- [-2538.910] (-2536.418) (-2537.789) (-2538.743) * (-2548.608) (-2534.955) [-2545.548] (-2541.414) -- 0:02:27

      Average standard deviation of split frequencies: 0.005959

      355500 -- (-2538.177) (-2540.101) [-2536.970] (-2545.428) * (-2543.800) [-2541.292] (-2540.028) (-2533.134) -- 0:02:26
      356000 -- [-2539.563] (-2533.626) (-2539.978) (-2535.162) * (-2542.395) (-2541.354) [-2538.044] (-2539.706) -- 0:02:26
      356500 -- (-2543.985) (-2551.544) (-2539.794) [-2539.164] * (-2539.208) (-2543.654) (-2537.782) [-2537.553] -- 0:02:26
      357000 -- [-2541.072] (-2551.215) (-2535.698) (-2536.028) * (-2540.629) [-2536.447] (-2543.044) (-2538.182) -- 0:02:25
      357500 -- (-2538.765) (-2539.754) [-2536.387] (-2539.956) * [-2541.478] (-2542.650) (-2545.055) (-2546.861) -- 0:02:25
      358000 -- [-2538.684] (-2540.111) (-2538.598) (-2537.196) * (-2537.597) (-2536.765) (-2536.026) [-2539.270] -- 0:02:27
      358500 -- (-2538.182) [-2537.952] (-2538.771) (-2534.310) * [-2543.330] (-2541.593) (-2542.831) (-2535.871) -- 0:02:26
      359000 -- (-2539.293) (-2537.433) (-2547.556) [-2538.569] * [-2543.948] (-2543.037) (-2543.375) (-2541.169) -- 0:02:26
      359500 -- (-2535.568) (-2536.575) (-2540.265) [-2535.580] * [-2539.075] (-2544.214) (-2540.618) (-2548.600) -- 0:02:26
      360000 -- (-2535.255) (-2546.760) (-2544.195) [-2533.590] * (-2540.599) (-2543.497) [-2535.541] (-2536.477) -- 0:02:25

      Average standard deviation of split frequencies: 0.005882

      360500 -- [-2539.677] (-2542.029) (-2548.221) (-2536.858) * (-2537.670) (-2537.066) [-2541.055] (-2539.031) -- 0:02:25
      361000 -- (-2541.163) (-2544.199) [-2544.841] (-2542.126) * (-2539.068) [-2535.361] (-2538.012) (-2544.658) -- 0:02:25
      361500 -- (-2545.028) (-2538.961) [-2537.474] (-2539.647) * (-2538.086) [-2538.251] (-2540.620) (-2544.443) -- 0:02:24
      362000 -- (-2538.527) [-2539.054] (-2537.494) (-2535.764) * (-2537.716) (-2540.076) (-2542.495) [-2537.806] -- 0:02:24
      362500 -- (-2537.867) (-2538.198) [-2532.449] (-2536.927) * (-2534.749) [-2540.955] (-2537.170) (-2537.622) -- 0:02:25
      363000 -- (-2537.912) (-2538.838) [-2540.212] (-2539.595) * [-2539.835] (-2540.800) (-2540.657) (-2543.467) -- 0:02:25
      363500 -- (-2546.075) (-2537.328) (-2542.131) [-2536.371] * [-2531.781] (-2539.099) (-2541.056) (-2539.195) -- 0:02:25
      364000 -- (-2536.510) [-2535.659] (-2541.760) (-2535.672) * (-2535.712) (-2533.611) (-2543.304) [-2536.811] -- 0:02:25
      364500 -- (-2538.067) [-2538.438] (-2541.031) (-2549.799) * (-2539.286) (-2540.876) [-2540.285] (-2534.589) -- 0:02:24
      365000 -- (-2542.831) [-2537.949] (-2542.514) (-2536.494) * (-2539.156) (-2540.527) (-2537.592) [-2538.068] -- 0:02:24

      Average standard deviation of split frequencies: 0.006440

      365500 -- (-2544.310) [-2536.251] (-2547.976) (-2541.677) * [-2533.753] (-2536.780) (-2539.335) (-2539.447) -- 0:02:24
      366000 -- (-2540.502) [-2539.750] (-2541.561) (-2535.754) * (-2535.468) (-2540.133) (-2537.422) [-2535.767] -- 0:02:23
      366500 -- (-2534.037) [-2534.228] (-2543.086) (-2544.992) * [-2534.308] (-2539.486) (-2543.528) (-2535.610) -- 0:02:23
      367000 -- (-2541.039) (-2543.761) [-2544.794] (-2540.639) * (-2537.596) (-2537.014) (-2536.983) [-2536.095] -- 0:02:24
      367500 -- (-2539.824) [-2538.392] (-2539.837) (-2547.036) * (-2540.258) (-2542.756) (-2537.400) [-2541.511] -- 0:02:24
      368000 -- (-2547.667) (-2539.713) (-2548.667) [-2549.368] * (-2543.520) (-2542.731) (-2536.787) [-2537.238] -- 0:02:24
      368500 -- (-2544.653) [-2540.336] (-2540.406) (-2545.310) * [-2536.923] (-2537.297) (-2537.257) (-2539.751) -- 0:02:23
      369000 -- (-2541.733) (-2538.303) [-2539.260] (-2539.266) * [-2535.751] (-2541.011) (-2537.705) (-2541.762) -- 0:02:23
      369500 -- (-2537.988) (-2535.790) (-2540.010) [-2543.811] * (-2544.608) (-2537.205) (-2545.642) [-2541.240] -- 0:02:23
      370000 -- (-2541.548) [-2538.838] (-2534.981) (-2537.970) * (-2536.677) [-2542.564] (-2535.155) (-2539.744) -- 0:02:23

      Average standard deviation of split frequencies: 0.005723

      370500 -- (-2539.044) (-2540.197) (-2533.602) [-2536.270] * (-2536.797) (-2540.334) (-2537.316) [-2536.301] -- 0:02:22
      371000 -- (-2545.481) [-2532.697] (-2538.817) (-2535.632) * [-2535.860] (-2536.595) (-2537.189) (-2537.994) -- 0:02:22
      371500 -- (-2539.904) [-2543.623] (-2542.852) (-2540.162) * (-2537.760) (-2538.531) (-2538.573) [-2537.040] -- 0:02:23
      372000 -- (-2534.872) (-2543.000) [-2534.165] (-2538.706) * (-2537.001) [-2535.643] (-2537.625) (-2539.397) -- 0:02:23
      372500 -- [-2541.500] (-2536.644) (-2545.132) (-2542.808) * (-2541.665) (-2536.004) (-2539.509) [-2536.191] -- 0:02:23
      373000 -- (-2537.399) [-2535.556] (-2540.665) (-2539.939) * (-2536.501) [-2535.661] (-2535.345) (-2541.192) -- 0:02:22
      373500 -- (-2537.099) [-2536.670] (-2542.047) (-2539.207) * [-2538.320] (-2543.311) (-2543.235) (-2535.352) -- 0:02:22
      374000 -- [-2536.942] (-2536.181) (-2540.164) (-2541.289) * [-2538.484] (-2538.917) (-2541.072) (-2539.563) -- 0:02:22
      374500 -- [-2536.716] (-2536.591) (-2536.462) (-2534.180) * (-2544.810) (-2543.262) (-2536.029) [-2537.822] -- 0:02:21
      375000 -- (-2544.845) (-2536.986) [-2536.794] (-2536.668) * (-2542.593) (-2535.717) [-2535.330] (-2544.247) -- 0:02:21

      Average standard deviation of split frequencies: 0.005642

      375500 -- (-2546.474) (-2543.568) (-2537.121) [-2535.389] * (-2536.997) (-2542.239) [-2538.410] (-2540.568) -- 0:02:21
      376000 -- (-2544.916) (-2546.978) [-2536.448] (-2537.959) * (-2539.315) (-2536.325) (-2543.992) [-2533.003] -- 0:02:22
      376500 -- (-2538.270) (-2535.614) [-2537.673] (-2546.546) * [-2541.564] (-2535.557) (-2541.855) (-2543.380) -- 0:02:22
      377000 -- [-2543.117] (-2542.603) (-2543.366) (-2536.601) * (-2545.091) (-2536.375) [-2538.695] (-2537.924) -- 0:02:22
      377500 -- (-2540.960) [-2539.069] (-2537.289) (-2542.895) * (-2533.461) (-2537.672) [-2539.753] (-2538.464) -- 0:02:21
      378000 -- [-2537.876] (-2541.456) (-2542.459) (-2545.532) * [-2537.170] (-2541.181) (-2540.458) (-2539.597) -- 0:02:21
      378500 -- [-2537.344] (-2534.528) (-2543.160) (-2540.409) * (-2537.723) [-2536.622] (-2538.163) (-2536.066) -- 0:02:21
      379000 -- (-2535.851) [-2536.264] (-2537.247) (-2539.295) * (-2535.549) (-2544.420) [-2535.327] (-2542.356) -- 0:02:20
      379500 -- (-2539.388) (-2537.286) [-2536.479] (-2536.183) * (-2534.009) (-2542.723) (-2540.593) [-2537.550] -- 0:02:20
      380000 -- (-2551.832) (-2539.337) [-2534.638] (-2537.216) * [-2545.335] (-2537.215) (-2539.847) (-2538.188) -- 0:02:20

      Average standard deviation of split frequencies: 0.005573

      380500 -- [-2541.924] (-2541.372) (-2536.776) (-2538.319) * (-2539.154) (-2539.842) (-2540.096) [-2536.524] -- 0:02:21
      381000 -- (-2541.173) [-2541.418] (-2542.987) (-2543.283) * [-2538.585] (-2536.427) (-2545.512) (-2539.697) -- 0:02:21
      381500 -- [-2537.456] (-2544.516) (-2541.353) (-2542.285) * (-2536.221) [-2542.738] (-2534.712) (-2536.738) -- 0:02:21
      382000 -- (-2543.008) [-2534.649] (-2540.663) (-2541.494) * [-2546.659] (-2537.134) (-2544.976) (-2535.903) -- 0:02:20
      382500 -- (-2548.275) [-2535.386] (-2538.464) (-2539.716) * [-2537.369] (-2537.971) (-2538.408) (-2534.279) -- 0:02:20
      383000 -- (-2541.690) (-2542.831) (-2538.073) [-2537.035] * (-2534.485) (-2540.724) (-2541.725) [-2538.138] -- 0:02:20
      383500 -- [-2535.993] (-2537.782) (-2535.325) (-2537.894) * [-2539.515] (-2542.890) (-2535.399) (-2536.439) -- 0:02:19
      384000 -- [-2536.336] (-2534.879) (-2538.111) (-2537.504) * (-2538.931) (-2541.547) (-2537.081) [-2536.456] -- 0:02:19
      384500 -- (-2541.219) [-2541.431] (-2538.144) (-2536.745) * [-2538.590] (-2536.786) (-2536.320) (-2538.740) -- 0:02:19
      385000 -- (-2544.656) (-2538.132) (-2544.278) [-2541.138] * (-2541.856) (-2536.639) (-2536.107) [-2537.807] -- 0:02:20

      Average standard deviation of split frequencies: 0.005496

      385500 -- [-2534.640] (-2540.242) (-2543.228) (-2536.896) * [-2543.719] (-2536.581) (-2541.264) (-2538.247) -- 0:02:20
      386000 -- [-2536.184] (-2542.581) (-2538.368) (-2537.660) * (-2540.794) [-2539.939] (-2537.221) (-2542.476) -- 0:02:19
      386500 -- (-2536.841) (-2539.697) [-2536.903] (-2541.984) * [-2539.751] (-2544.328) (-2533.588) (-2545.810) -- 0:02:19
      387000 -- (-2535.933) (-2540.040) [-2535.138] (-2535.745) * [-2541.342] (-2540.226) (-2538.248) (-2538.546) -- 0:02:19
      387500 -- (-2537.149) [-2540.789] (-2541.228) (-2539.572) * (-2542.258) [-2533.161] (-2543.216) (-2541.458) -- 0:02:19
      388000 -- (-2537.995) (-2543.098) [-2539.409] (-2538.911) * (-2544.591) (-2533.659) (-2542.225) [-2539.698] -- 0:02:18
      388500 -- (-2536.829) (-2543.659) [-2535.814] (-2536.206) * (-2541.722) (-2534.671) [-2533.860] (-2538.513) -- 0:02:18
      389000 -- (-2538.477) [-2551.958] (-2543.324) (-2542.229) * (-2543.714) (-2536.977) [-2542.709] (-2538.676) -- 0:02:18
      389500 -- [-2544.047] (-2547.976) (-2536.094) (-2542.065) * (-2543.128) (-2540.356) (-2538.975) [-2539.582] -- 0:02:19
      390000 -- (-2540.756) [-2543.095] (-2545.520) (-2536.995) * (-2538.624) (-2537.386) (-2534.324) [-2533.701] -- 0:02:19

      Average standard deviation of split frequencies: 0.004827

      390500 -- [-2535.751] (-2545.094) (-2545.831) (-2541.515) * (-2537.125) [-2540.416] (-2538.174) (-2537.154) -- 0:02:18
      391000 -- [-2536.309] (-2540.954) (-2536.804) (-2538.990) * [-2537.960] (-2538.893) (-2542.031) (-2533.820) -- 0:02:18
      391500 -- [-2535.948] (-2545.882) (-2538.334) (-2547.188) * (-2539.603) [-2543.018] (-2533.732) (-2544.522) -- 0:02:18
      392000 -- [-2536.228] (-2541.247) (-2539.323) (-2547.226) * (-2540.702) (-2535.848) [-2532.244] (-2540.040) -- 0:02:18
      392500 -- [-2534.537] (-2537.320) (-2534.923) (-2539.408) * (-2542.531) [-2535.399] (-2532.060) (-2544.636) -- 0:02:17
      393000 -- [-2535.201] (-2535.372) (-2538.999) (-2547.975) * (-2544.402) [-2539.680] (-2540.195) (-2543.051) -- 0:02:17
      393500 -- (-2537.903) [-2539.547] (-2533.439) (-2536.783) * (-2538.798) [-2534.477] (-2534.424) (-2542.090) -- 0:02:17
      394000 -- (-2541.512) (-2546.941) [-2540.232] (-2536.444) * [-2536.809] (-2540.811) (-2535.023) (-2540.848) -- 0:02:18
      394500 -- (-2541.971) (-2534.681) (-2542.554) [-2536.526] * (-2540.697) (-2538.872) (-2532.318) [-2541.964] -- 0:02:18
      395000 -- [-2538.428] (-2539.817) (-2533.431) (-2541.319) * [-2536.001] (-2542.915) (-2548.277) (-2545.364) -- 0:02:17

      Average standard deviation of split frequencies: 0.004762

      395500 -- [-2538.915] (-2548.825) (-2535.608) (-2542.140) * [-2543.393] (-2538.582) (-2544.783) (-2536.663) -- 0:02:17
      396000 -- (-2533.454) [-2543.266] (-2545.809) (-2534.852) * (-2537.697) [-2539.388] (-2543.192) (-2540.473) -- 0:02:17
      396500 -- (-2547.184) (-2538.466) [-2538.793] (-2541.310) * (-2542.929) (-2547.124) [-2547.125] (-2541.825) -- 0:02:16
      397000 -- (-2543.588) (-2539.945) [-2540.714] (-2537.624) * (-2543.386) [-2535.998] (-2541.116) (-2541.838) -- 0:02:16
      397500 -- (-2536.779) (-2540.666) (-2543.511) [-2534.084] * [-2537.720] (-2548.753) (-2544.730) (-2545.724) -- 0:02:16
      398000 -- (-2539.682) (-2534.967) (-2537.204) [-2539.583] * (-2538.314) (-2540.979) [-2539.912] (-2540.590) -- 0:02:16
      398500 -- (-2544.797) (-2536.560) (-2536.494) [-2534.529] * (-2543.137) (-2539.233) [-2536.185] (-2542.555) -- 0:02:17
      399000 -- [-2548.882] (-2541.115) (-2538.534) (-2544.293) * (-2534.748) [-2540.255] (-2535.651) (-2551.876) -- 0:02:17
      399500 -- (-2541.256) (-2538.433) [-2541.247] (-2539.127) * [-2532.307] (-2533.931) (-2540.376) (-2545.275) -- 0:02:16
      400000 -- (-2537.059) (-2538.850) [-2537.032] (-2540.072) * [-2536.340] (-2540.776) (-2542.071) (-2538.539) -- 0:02:16

      Average standard deviation of split frequencies: 0.004118

      400500 -- [-2537.102] (-2541.266) (-2551.686) (-2533.706) * [-2540.006] (-2548.763) (-2543.177) (-2540.611) -- 0:02:16
      401000 -- (-2534.783) (-2544.060) (-2544.646) [-2535.750] * (-2550.808) (-2541.403) (-2543.878) [-2542.523] -- 0:02:15
      401500 -- [-2537.219] (-2542.295) (-2534.866) (-2531.766) * (-2544.412) [-2538.228] (-2543.754) (-2548.945) -- 0:02:15
      402000 -- (-2538.071) (-2543.403) (-2533.065) [-2538.581] * (-2535.267) (-2543.608) [-2541.408] (-2542.798) -- 0:02:15
      402500 -- (-2539.185) (-2535.691) [-2534.455] (-2545.380) * [-2532.873] (-2541.525) (-2540.760) (-2537.811) -- 0:02:15
      403000 -- (-2539.082) (-2537.088) (-2532.962) [-2537.920] * [-2535.219] (-2546.559) (-2537.265) (-2545.514) -- 0:02:16
      403500 -- (-2543.409) (-2537.081) [-2539.655] (-2547.783) * (-2540.516) [-2538.091] (-2535.974) (-2541.502) -- 0:02:16
      404000 -- (-2537.692) (-2541.646) [-2540.369] (-2540.687) * (-2539.575) (-2536.808) [-2537.288] (-2539.980) -- 0:02:15
      404500 -- (-2536.526) (-2536.442) (-2547.631) [-2540.353] * (-2545.143) (-2540.753) (-2536.945) [-2540.123] -- 0:02:15
      405000 -- (-2537.868) (-2536.773) (-2548.999) [-2538.030] * (-2536.763) (-2538.517) [-2536.339] (-2539.377) -- 0:02:15

      Average standard deviation of split frequencies: 0.004644

      405500 -- [-2534.334] (-2535.900) (-2536.936) (-2538.051) * [-2535.387] (-2536.296) (-2541.716) (-2536.028) -- 0:02:14
      406000 -- [-2545.692] (-2536.743) (-2535.292) (-2539.756) * (-2540.234) (-2536.791) (-2537.581) [-2543.202] -- 0:02:14
      406500 -- (-2535.057) (-2543.245) (-2538.546) [-2534.391] * [-2536.756] (-2539.115) (-2538.041) (-2535.758) -- 0:02:14
      407000 -- [-2538.457] (-2536.324) (-2543.236) (-2533.982) * (-2537.859) [-2539.263] (-2536.275) (-2547.054) -- 0:02:15
      407500 -- [-2541.136] (-2547.547) (-2539.462) (-2539.322) * (-2541.873) (-2543.340) [-2536.769] (-2535.079) -- 0:02:15
      408000 -- (-2541.541) [-2542.024] (-2536.258) (-2538.908) * (-2543.691) [-2544.255] (-2536.084) (-2533.195) -- 0:02:14
      408500 -- (-2543.079) (-2538.682) (-2540.086) [-2535.435] * (-2546.148) (-2534.781) (-2540.872) [-2535.953] -- 0:02:14
      409000 -- (-2534.199) [-2538.994] (-2541.296) (-2542.171) * (-2538.693) (-2536.499) [-2541.506] (-2539.795) -- 0:02:14
      409500 -- [-2537.331] (-2538.322) (-2537.836) (-2543.505) * [-2538.617] (-2539.789) (-2533.467) (-2540.271) -- 0:02:14
      410000 -- (-2546.411) [-2540.373] (-2537.575) (-2549.647) * (-2540.917) (-2538.105) (-2537.732) [-2532.084] -- 0:02:13

      Average standard deviation of split frequencies: 0.004592

      410500 -- [-2542.699] (-2546.203) (-2539.050) (-2542.047) * (-2536.128) (-2535.173) (-2538.997) [-2536.060] -- 0:02:13
      411000 -- (-2543.955) (-2539.503) [-2540.144] (-2545.190) * (-2534.707) (-2541.624) (-2536.250) [-2537.767] -- 0:02:13
      411500 -- (-2542.565) [-2538.090] (-2537.556) (-2548.655) * [-2542.119] (-2548.605) (-2537.613) (-2537.299) -- 0:02:14
      412000 -- (-2537.382) (-2538.827) [-2545.716] (-2537.066) * (-2546.366) [-2538.317] (-2541.554) (-2534.295) -- 0:02:14
      412500 -- (-2539.030) [-2534.253] (-2539.395) (-2538.175) * (-2539.228) (-2538.488) [-2540.138] (-2538.388) -- 0:02:13
      413000 -- (-2544.622) [-2537.809] (-2544.529) (-2540.678) * (-2540.628) [-2538.000] (-2545.402) (-2539.395) -- 0:02:13
      413500 -- (-2533.239) [-2539.365] (-2536.919) (-2546.150) * (-2537.477) (-2538.812) (-2540.646) [-2538.175] -- 0:02:13
      414000 -- (-2532.200) (-2535.405) (-2541.253) [-2534.642] * [-2544.050] (-2540.935) (-2541.110) (-2547.363) -- 0:02:13
      414500 -- [-2548.040] (-2547.363) (-2536.939) (-2535.338) * (-2540.077) (-2537.756) [-2538.804] (-2539.779) -- 0:02:12
      415000 -- (-2543.865) [-2540.143] (-2537.770) (-2539.118) * (-2539.504) (-2534.733) [-2538.131] (-2534.012) -- 0:02:12

      Average standard deviation of split frequencies: 0.005099

      415500 -- (-2535.204) (-2536.212) [-2537.609] (-2546.003) * (-2534.207) (-2539.516) [-2538.354] (-2540.090) -- 0:02:12
      416000 -- (-2539.327) (-2544.717) [-2539.623] (-2544.163) * (-2537.290) [-2542.116] (-2536.041) (-2537.440) -- 0:02:13
      416500 -- [-2536.137] (-2539.690) (-2535.953) (-2543.787) * (-2540.034) (-2541.003) [-2535.626] (-2543.981) -- 0:02:13
      417000 -- (-2546.469) [-2538.325] (-2538.228) (-2535.542) * (-2544.229) (-2544.270) [-2539.884] (-2541.621) -- 0:02:12
      417500 -- (-2544.714) (-2541.191) [-2537.442] (-2539.131) * (-2542.143) (-2538.802) [-2539.980] (-2542.090) -- 0:02:12
      418000 -- (-2543.568) [-2535.028] (-2535.617) (-2537.907) * (-2538.508) (-2544.940) (-2538.796) [-2536.364] -- 0:02:12
      418500 -- (-2541.552) (-2536.399) [-2536.787] (-2537.515) * [-2541.172] (-2542.780) (-2542.022) (-2536.243) -- 0:02:12
      419000 -- (-2539.051) [-2539.350] (-2542.402) (-2540.848) * [-2540.055] (-2537.475) (-2534.441) (-2540.270) -- 0:02:11
      419500 -- (-2540.745) (-2542.668) [-2537.110] (-2538.549) * (-2539.558) (-2538.773) [-2536.404] (-2552.817) -- 0:02:11
      420000 -- [-2533.761] (-2536.418) (-2537.187) (-2543.308) * (-2542.137) [-2538.319] (-2537.099) (-2536.233) -- 0:02:11

      Average standard deviation of split frequencies: 0.004482

      420500 -- (-2542.722) (-2541.369) (-2540.455) [-2537.498] * (-2542.649) [-2542.968] (-2539.971) (-2538.459) -- 0:02:12
      421000 -- (-2540.389) [-2534.685] (-2534.773) (-2536.162) * (-2541.671) (-2544.307) [-2533.202] (-2539.995) -- 0:02:12
      421500 -- (-2544.311) [-2533.550] (-2543.069) (-2534.750) * [-2539.242] (-2538.526) (-2541.914) (-2541.901) -- 0:02:11
      422000 -- (-2544.666) [-2538.715] (-2535.656) (-2535.767) * [-2538.286] (-2539.298) (-2538.043) (-2542.304) -- 0:02:11
      422500 -- (-2546.399) (-2549.086) [-2537.346] (-2538.380) * (-2540.574) [-2536.800] (-2542.793) (-2546.392) -- 0:02:11
      423000 -- (-2538.650) [-2535.187] (-2533.429) (-2538.387) * (-2543.227) [-2537.819] (-2536.414) (-2542.735) -- 0:02:10
      423500 -- (-2541.506) (-2541.566) [-2535.242] (-2544.911) * [-2539.637] (-2536.864) (-2534.771) (-2538.552) -- 0:02:10
      424000 -- (-2537.947) (-2538.530) (-2537.508) [-2533.400] * (-2545.444) (-2538.697) [-2538.164] (-2539.646) -- 0:02:10
      424500 -- (-2541.057) [-2540.592] (-2537.252) (-2538.845) * [-2535.232] (-2538.539) (-2541.444) (-2537.572) -- 0:02:10
      425000 -- (-2550.888) (-2544.225) [-2537.886] (-2537.829) * (-2553.389) (-2538.906) [-2535.024] (-2535.463) -- 0:02:11

      Average standard deviation of split frequencies: 0.004426

      425500 -- (-2539.981) [-2536.783] (-2536.489) (-2537.140) * (-2549.752) (-2548.943) (-2540.050) [-2538.589] -- 0:02:10
      426000 -- (-2534.014) (-2541.407) (-2535.605) [-2537.031] * (-2548.532) (-2540.215) (-2539.495) [-2536.365] -- 0:02:10
      426500 -- [-2535.456] (-2538.924) (-2534.080) (-2540.652) * (-2538.663) (-2539.102) [-2540.009] (-2535.301) -- 0:02:10
      427000 -- (-2532.929) [-2533.157] (-2536.550) (-2541.114) * (-2537.022) (-2539.315) [-2538.514] (-2545.098) -- 0:02:10
      427500 -- [-2536.304] (-2544.986) (-2544.065) (-2535.640) * [-2536.885] (-2540.765) (-2541.229) (-2541.566) -- 0:02:09
      428000 -- (-2552.213) (-2540.319) [-2537.332] (-2542.317) * (-2539.423) [-2537.890] (-2536.137) (-2539.097) -- 0:02:09
      428500 -- (-2540.437) [-2533.871] (-2535.942) (-2547.312) * [-2536.872] (-2532.666) (-2534.676) (-2542.028) -- 0:02:09
      429000 -- (-2539.938) (-2538.985) (-2538.839) [-2538.512] * [-2537.459] (-2540.759) (-2533.512) (-2542.017) -- 0:02:09
      429500 -- (-2542.019) (-2535.850) (-2536.519) [-2545.088] * [-2536.099] (-2541.495) (-2542.527) (-2539.472) -- 0:02:10
      430000 -- (-2543.654) [-2536.137] (-2540.030) (-2546.800) * (-2539.004) [-2541.402] (-2543.048) (-2545.756) -- 0:02:09

      Average standard deviation of split frequencies: 0.003831

      430500 -- (-2543.870) (-2536.945) [-2539.065] (-2542.079) * [-2541.018] (-2541.001) (-2548.409) (-2541.917) -- 0:02:09
      431000 -- (-2535.806) (-2534.519) [-2536.292] (-2537.743) * (-2540.791) (-2540.389) [-2540.478] (-2548.580) -- 0:02:09
      431500 -- (-2536.694) [-2543.169] (-2537.915) (-2533.662) * (-2542.828) (-2545.577) [-2540.913] (-2545.300) -- 0:02:09
      432000 -- (-2536.219) [-2537.770] (-2535.888) (-2538.677) * (-2536.916) (-2542.916) (-2541.097) [-2542.535] -- 0:02:08
      432500 -- (-2542.159) (-2541.200) (-2542.791) [-2534.281] * (-2535.751) (-2542.509) [-2545.777] (-2544.654) -- 0:02:08
      433000 -- (-2542.100) (-2542.354) (-2541.264) [-2534.142] * (-2535.433) (-2547.082) (-2548.083) [-2539.486] -- 0:02:08
      433500 -- [-2540.860] (-2545.763) (-2540.265) (-2538.492) * (-2538.197) (-2548.309) (-2541.413) [-2540.896] -- 0:02:08
      434000 -- (-2545.097) [-2546.330] (-2540.269) (-2543.047) * (-2537.633) (-2546.530) [-2538.709] (-2534.540) -- 0:02:09
      434500 -- (-2546.548) [-2545.554] (-2538.218) (-2547.482) * (-2539.093) [-2539.081] (-2548.467) (-2540.686) -- 0:02:08
      435000 -- (-2544.600) (-2534.596) [-2540.845] (-2551.013) * (-2537.094) (-2540.287) [-2538.981] (-2543.954) -- 0:02:08

      Average standard deviation of split frequencies: 0.003784

      435500 -- (-2543.076) (-2539.953) [-2536.608] (-2544.195) * (-2544.209) (-2537.376) (-2535.345) [-2541.420] -- 0:02:08
      436000 -- (-2553.193) [-2538.689] (-2542.072) (-2538.372) * (-2537.524) (-2534.081) [-2534.983] (-2537.021) -- 0:02:08
      436500 -- (-2538.709) (-2535.344) (-2538.628) [-2536.478] * [-2534.769] (-2539.536) (-2541.206) (-2541.532) -- 0:02:07
      437000 -- (-2539.638) [-2535.395] (-2534.919) (-2538.709) * (-2536.829) [-2539.227] (-2540.444) (-2534.484) -- 0:02:07
      437500 -- (-2538.889) (-2539.068) [-2539.165] (-2537.199) * (-2540.289) (-2536.188) [-2537.823] (-2539.635) -- 0:02:07
      438000 -- (-2544.005) (-2538.383) (-2541.468) [-2534.186] * (-2539.937) [-2534.865] (-2536.959) (-2540.706) -- 0:02:07
      438500 -- (-2539.050) [-2538.845] (-2545.347) (-2532.531) * [-2536.531] (-2540.456) (-2540.709) (-2536.619) -- 0:02:08
      439000 -- (-2544.689) (-2536.654) (-2552.492) [-2536.257] * (-2540.817) [-2540.819] (-2534.931) (-2535.027) -- 0:02:07
      439500 -- (-2545.753) (-2548.706) (-2547.153) [-2536.923] * (-2540.821) (-2539.436) [-2538.825] (-2534.304) -- 0:02:07
      440000 -- (-2556.004) [-2544.035] (-2553.209) (-2535.791) * [-2538.833] (-2536.371) (-2543.721) (-2540.004) -- 0:02:07

      Average standard deviation of split frequencies: 0.002674

      440500 -- (-2539.923) [-2539.806] (-2541.441) (-2535.933) * (-2540.230) (-2545.240) (-2540.177) [-2541.166] -- 0:02:07
      441000 -- (-2539.290) (-2538.898) (-2544.849) [-2537.451] * (-2536.047) (-2538.973) (-2547.766) [-2540.937] -- 0:02:06
      441500 -- [-2536.131] (-2541.417) (-2540.649) (-2540.700) * (-2538.640) (-2540.149) [-2537.073] (-2541.444) -- 0:02:06
      442000 -- (-2542.860) (-2534.374) [-2540.360] (-2533.790) * (-2539.031) (-2539.328) (-2536.148) [-2536.392] -- 0:02:06
      442500 -- (-2539.735) (-2537.185) [-2538.328] (-2540.932) * (-2533.275) (-2538.142) [-2538.821] (-2541.793) -- 0:02:05
      443000 -- (-2541.456) (-2533.262) (-2534.355) [-2543.613] * (-2542.768) (-2536.759) [-2540.744] (-2539.447) -- 0:02:06
      443500 -- [-2536.681] (-2536.456) (-2534.600) (-2544.710) * (-2543.011) [-2540.685] (-2544.180) (-2537.152) -- 0:02:06
      444000 -- (-2540.870) (-2537.647) [-2534.612] (-2537.096) * [-2543.636] (-2537.449) (-2538.286) (-2538.926) -- 0:02:06
      444500 -- (-2541.113) (-2535.890) [-2538.883] (-2535.373) * (-2540.205) [-2540.255] (-2544.953) (-2533.753) -- 0:02:06
      445000 -- [-2535.522] (-2541.185) (-2537.945) (-2537.734) * [-2538.424] (-2542.291) (-2543.128) (-2543.681) -- 0:02:05

      Average standard deviation of split frequencies: 0.002642

      445500 -- (-2542.851) (-2540.116) (-2533.166) [-2535.169] * [-2538.464] (-2552.724) (-2538.652) (-2537.627) -- 0:02:05
      446000 -- (-2542.670) (-2536.668) [-2538.631] (-2537.988) * (-2535.334) [-2546.354] (-2545.188) (-2534.553) -- 0:02:05
      446500 -- [-2539.102] (-2536.631) (-2542.957) (-2533.394) * (-2544.428) [-2537.385] (-2544.053) (-2535.094) -- 0:02:05
      447000 -- (-2553.399) (-2538.813) (-2543.674) [-2537.488] * [-2536.150] (-2539.234) (-2537.461) (-2538.147) -- 0:02:04
      447500 -- (-2547.716) [-2536.682] (-2538.178) (-2539.743) * (-2540.371) (-2544.571) (-2535.640) [-2538.871] -- 0:02:05
      448000 -- [-2536.467] (-2536.290) (-2539.571) (-2542.095) * (-2538.678) (-2538.204) [-2533.447] (-2550.329) -- 0:02:05
      448500 -- [-2535.579] (-2538.673) (-2537.642) (-2535.375) * (-2545.173) [-2542.767] (-2537.953) (-2536.323) -- 0:02:05
      449000 -- (-2539.231) (-2538.518) [-2535.960] (-2556.399) * (-2543.586) (-2534.142) (-2537.681) [-2536.868] -- 0:02:05
      449500 -- [-2536.383] (-2535.557) (-2534.876) (-2543.482) * (-2553.628) (-2535.087) [-2539.721] (-2534.360) -- 0:02:04
      450000 -- [-2540.613] (-2542.635) (-2542.329) (-2547.798) * (-2541.426) (-2537.523) (-2535.333) [-2535.758] -- 0:02:04

      Average standard deviation of split frequencies: 0.002615

      450500 -- (-2538.736) (-2532.519) (-2537.989) [-2539.707] * (-2547.428) [-2540.541] (-2534.672) (-2538.087) -- 0:02:04
      451000 -- (-2545.153) [-2539.572] (-2534.829) (-2536.537) * [-2538.618] (-2547.635) (-2539.931) (-2535.130) -- 0:02:04
      451500 -- (-2544.959) (-2538.401) [-2536.519] (-2543.895) * (-2545.051) (-2543.812) (-2536.903) [-2534.635] -- 0:02:03
      452000 -- (-2546.056) (-2532.823) [-2538.945] (-2541.147) * (-2540.568) (-2535.793) [-2538.049] (-2536.963) -- 0:02:04
      452500 -- (-2539.990) (-2537.762) [-2537.501] (-2548.028) * (-2542.343) [-2540.404] (-2535.187) (-2540.994) -- 0:02:04
      453000 -- (-2539.924) [-2536.237] (-2546.384) (-2535.408) * (-2539.531) [-2535.160] (-2543.100) (-2537.836) -- 0:02:04
      453500 -- [-2538.963] (-2533.412) (-2540.699) (-2541.136) * (-2540.708) (-2541.290) (-2538.899) [-2536.406] -- 0:02:04
      454000 -- (-2535.747) (-2539.434) [-2536.954] (-2538.324) * (-2542.142) (-2545.118) [-2535.818] (-2537.698) -- 0:02:03
      454500 -- (-2539.376) (-2538.437) (-2540.286) [-2537.630] * (-2541.232) (-2537.784) [-2534.684] (-2535.836) -- 0:02:03
      455000 -- [-2538.545] (-2541.440) (-2539.885) (-2536.585) * (-2541.988) (-2533.411) [-2541.210] (-2533.711) -- 0:02:03

      Average standard deviation of split frequencies: 0.002584

      455500 -- (-2537.693) [-2536.903] (-2546.761) (-2540.332) * (-2536.638) [-2538.398] (-2537.936) (-2538.546) -- 0:02:03
      456000 -- (-2539.742) (-2537.244) [-2537.285] (-2536.749) * [-2533.373] (-2541.256) (-2538.461) (-2536.086) -- 0:02:02
      456500 -- (-2535.329) [-2532.907] (-2536.920) (-2535.011) * (-2542.494) (-2541.892) (-2545.144) [-2539.836] -- 0:02:03
      457000 -- (-2541.056) (-2545.653) [-2533.998] (-2543.004) * (-2538.241) [-2539.131] (-2552.368) (-2548.348) -- 0:02:03
      457500 -- (-2541.957) (-2538.712) [-2538.562] (-2533.714) * (-2542.725) [-2535.721] (-2541.584) (-2537.784) -- 0:02:03
      458000 -- (-2542.005) (-2538.713) [-2542.577] (-2538.841) * (-2540.059) (-2539.614) [-2541.381] (-2540.804) -- 0:02:03
      458500 -- (-2540.295) [-2538.795] (-2531.742) (-2551.642) * (-2537.340) [-2540.297] (-2542.612) (-2540.731) -- 0:02:02
      459000 -- (-2544.845) (-2536.627) [-2538.749] (-2538.655) * (-2537.593) [-2542.363] (-2538.049) (-2537.316) -- 0:02:02
      459500 -- (-2541.245) (-2532.866) [-2534.781] (-2544.464) * [-2535.530] (-2541.176) (-2540.216) (-2536.597) -- 0:02:02
      460000 -- (-2543.789) (-2542.827) (-2540.473) [-2539.321] * [-2540.736] (-2538.006) (-2535.854) (-2544.403) -- 0:02:02

      Average standard deviation of split frequencies: 0.003070

      460500 -- (-2536.981) [-2536.732] (-2539.245) (-2543.958) * (-2539.848) (-2535.004) (-2537.852) [-2532.752] -- 0:02:01
      461000 -- (-2542.168) [-2537.827] (-2542.800) (-2540.389) * [-2542.053] (-2539.427) (-2536.238) (-2534.092) -- 0:02:02
      461500 -- (-2544.532) (-2534.810) (-2540.581) [-2540.038] * [-2536.251] (-2540.422) (-2537.190) (-2541.491) -- 0:02:02
      462000 -- [-2539.386] (-2541.427) (-2541.352) (-2536.074) * (-2537.705) [-2535.444] (-2539.266) (-2541.103) -- 0:02:02
      462500 -- (-2548.400) [-2539.484] (-2543.062) (-2537.123) * [-2541.984] (-2544.848) (-2544.644) (-2540.101) -- 0:02:02
      463000 -- [-2543.432] (-2540.124) (-2546.713) (-2543.456) * (-2549.435) [-2537.012] (-2540.463) (-2538.339) -- 0:02:01
      463500 -- (-2544.170) (-2538.681) (-2545.323) [-2535.798] * (-2551.726) [-2539.670] (-2541.945) (-2540.736) -- 0:02:01
      464000 -- (-2544.929) [-2541.540] (-2544.816) (-2541.984) * [-2540.310] (-2541.248) (-2535.266) (-2540.665) -- 0:02:01
      464500 -- (-2542.829) (-2536.681) [-2541.284] (-2535.796) * (-2536.699) [-2538.874] (-2542.095) (-2536.456) -- 0:02:01
      465000 -- (-2540.712) (-2536.633) (-2542.204) [-2537.729] * (-2536.583) [-2535.690] (-2544.371) (-2539.756) -- 0:02:00

      Average standard deviation of split frequencies: 0.003035

      465500 -- (-2541.446) [-2543.840] (-2548.201) (-2542.076) * (-2539.118) (-2540.529) (-2538.811) [-2542.354] -- 0:02:01
      466000 -- (-2542.337) (-2537.860) [-2540.368] (-2538.513) * (-2534.944) (-2536.169) (-2545.131) [-2538.265] -- 0:02:01
      466500 -- (-2550.718) (-2536.177) (-2541.045) [-2540.025] * [-2542.764] (-2534.306) (-2536.624) (-2535.130) -- 0:02:01
      467000 -- [-2551.095] (-2536.344) (-2544.282) (-2542.120) * [-2542.924] (-2539.429) (-2536.674) (-2537.206) -- 0:02:00
      467500 -- (-2550.531) [-2541.123] (-2540.807) (-2538.307) * (-2539.963) (-2540.309) (-2539.200) [-2536.694] -- 0:02:00
      468000 -- [-2540.511] (-2539.560) (-2541.628) (-2536.906) * (-2536.485) (-2545.009) (-2534.660) [-2535.320] -- 0:02:00
      468500 -- [-2540.232] (-2540.200) (-2538.733) (-2539.262) * (-2532.861) (-2543.036) (-2538.690) [-2540.979] -- 0:02:00
      469000 -- (-2538.138) (-2540.200) [-2534.830] (-2535.521) * [-2538.871] (-2544.353) (-2547.619) (-2537.816) -- 0:02:00
      469500 -- (-2535.953) (-2539.106) [-2537.638] (-2540.356) * (-2545.619) [-2542.741] (-2538.894) (-2541.367) -- 0:01:59
      470000 -- (-2539.661) (-2538.578) (-2540.126) [-2542.953] * (-2542.583) (-2541.311) [-2540.828] (-2543.413) -- 0:02:00

      Average standard deviation of split frequencies: 0.001502

      470500 -- [-2540.130] (-2544.846) (-2538.435) (-2548.031) * (-2543.035) (-2538.984) (-2536.651) [-2540.600] -- 0:02:00
      471000 -- (-2537.701) (-2539.903) (-2541.770) [-2543.577] * [-2538.210] (-2534.986) (-2543.454) (-2547.414) -- 0:02:00
      471500 -- (-2538.048) [-2537.035] (-2538.362) (-2543.860) * (-2548.035) [-2539.206] (-2550.907) (-2547.702) -- 0:01:59
      472000 -- [-2541.604] (-2539.808) (-2543.164) (-2539.442) * (-2546.841) [-2542.286] (-2534.915) (-2539.748) -- 0:01:59
      472500 -- (-2534.555) (-2538.852) (-2541.126) [-2534.110] * (-2540.931) [-2533.858] (-2543.298) (-2538.698) -- 0:01:59
      473000 -- (-2539.311) (-2538.345) (-2537.248) [-2537.517] * (-2542.750) [-2534.708] (-2537.434) (-2542.436) -- 0:01:59
      473500 -- [-2544.640] (-2538.245) (-2535.529) (-2544.230) * (-2542.987) [-2537.301] (-2541.617) (-2541.566) -- 0:01:58
      474000 -- (-2541.203) [-2538.014] (-2536.543) (-2535.629) * (-2542.357) (-2537.589) [-2537.409] (-2536.357) -- 0:01:58
      474500 -- (-2538.217) [-2540.549] (-2536.763) (-2539.819) * (-2535.966) [-2538.807] (-2535.790) (-2544.763) -- 0:01:59
      475000 -- (-2537.562) (-2541.336) (-2538.605) [-2545.330] * (-2539.930) (-2544.748) [-2536.778] (-2544.681) -- 0:01:59

      Average standard deviation of split frequencies: 0.001981

      475500 -- (-2539.362) (-2538.596) [-2538.561] (-2539.339) * (-2537.620) (-2545.199) [-2533.927] (-2539.004) -- 0:01:59
      476000 -- (-2536.804) (-2542.807) (-2538.322) [-2537.607] * (-2537.857) (-2539.262) [-2533.809] (-2538.964) -- 0:01:58
      476500 -- (-2546.161) (-2537.230) (-2544.496) [-2539.171] * (-2536.668) (-2536.893) [-2536.673] (-2536.177) -- 0:01:58
      477000 -- [-2540.221] (-2537.785) (-2540.289) (-2533.950) * [-2539.594] (-2538.416) (-2540.993) (-2545.638) -- 0:01:58
      477500 -- [-2537.203] (-2540.982) (-2542.162) (-2536.579) * (-2538.660) (-2541.320) [-2536.049] (-2543.472) -- 0:01:58
      478000 -- (-2549.755) (-2542.410) (-2536.486) [-2535.780] * (-2537.844) [-2542.103] (-2541.187) (-2543.664) -- 0:01:57
      478500 -- [-2538.395] (-2537.192) (-2539.110) (-2535.703) * [-2533.157] (-2533.350) (-2535.565) (-2536.692) -- 0:01:57
      479000 -- (-2539.879) (-2539.386) [-2536.659] (-2542.731) * [-2538.630] (-2544.125) (-2537.562) (-2541.825) -- 0:01:58
      479500 -- (-2535.635) (-2542.080) [-2534.218] (-2540.093) * (-2539.395) (-2539.522) (-2537.660) [-2539.441] -- 0:01:58
      480000 -- (-2547.785) [-2536.704] (-2539.326) (-2539.867) * (-2546.109) [-2539.192] (-2542.900) (-2549.467) -- 0:01:58

      Average standard deviation of split frequencies: 0.001961

      480500 -- (-2541.575) (-2543.008) (-2541.517) [-2549.351] * (-2549.173) (-2543.766) [-2537.107] (-2539.936) -- 0:01:57
      481000 -- (-2532.297) (-2541.339) [-2533.840] (-2539.478) * (-2543.158) (-2540.184) (-2540.546) [-2541.216] -- 0:01:57
      481500 -- (-2539.169) [-2536.983] (-2533.092) (-2545.830) * [-2540.884] (-2539.022) (-2549.221) (-2543.688) -- 0:01:57
      482000 -- (-2537.211) [-2541.457] (-2541.718) (-2539.596) * (-2540.560) (-2543.071) [-2537.535] (-2540.934) -- 0:01:57
      482500 -- [-2536.154] (-2546.691) (-2539.620) (-2541.857) * (-2542.695) (-2538.197) (-2536.074) [-2540.926] -- 0:01:56
      483000 -- (-2540.216) (-2539.917) (-2537.428) [-2540.320] * (-2542.425) (-2545.863) [-2540.669] (-2542.354) -- 0:01:56
      483500 -- [-2534.140] (-2538.153) (-2536.507) (-2542.773) * [-2535.876] (-2547.896) (-2533.654) (-2539.309) -- 0:01:57
      484000 -- [-2539.468] (-2532.662) (-2535.865) (-2545.285) * (-2538.326) [-2540.755] (-2534.659) (-2539.788) -- 0:01:57
      484500 -- (-2539.808) [-2535.660] (-2542.880) (-2538.916) * (-2541.629) (-2540.046) (-2543.285) [-2537.431] -- 0:01:57
      485000 -- (-2547.890) (-2533.927) (-2541.605) [-2545.078] * (-2535.842) (-2537.953) (-2542.477) [-2535.339] -- 0:01:56

      Average standard deviation of split frequencies: 0.001940

      485500 -- (-2543.699) (-2538.529) [-2537.164] (-2538.451) * [-2535.279] (-2540.077) (-2541.664) (-2532.384) -- 0:01:56
      486000 -- (-2540.117) [-2533.427] (-2538.209) (-2545.827) * (-2539.247) (-2549.766) (-2536.546) [-2537.395] -- 0:01:56
      486500 -- (-2541.850) (-2539.374) [-2547.276] (-2545.657) * [-2536.428] (-2533.531) (-2542.442) (-2538.234) -- 0:01:56
      487000 -- (-2546.864) (-2539.346) [-2537.259] (-2539.246) * (-2537.950) (-2537.054) (-2539.051) [-2538.352] -- 0:01:55
      487500 -- [-2538.558] (-2537.838) (-2545.998) (-2540.300) * (-2544.936) (-2538.073) (-2539.921) [-2545.408] -- 0:01:55
      488000 -- [-2536.628] (-2540.437) (-2538.152) (-2538.255) * (-2550.869) (-2544.487) [-2538.182] (-2542.247) -- 0:01:56
      488500 -- (-2536.967) [-2535.412] (-2545.885) (-2548.323) * (-2541.615) [-2537.913] (-2540.676) (-2542.294) -- 0:01:56
      489000 -- (-2542.391) (-2538.119) (-2539.168) [-2538.796] * (-2546.885) (-2537.673) [-2545.235] (-2544.784) -- 0:01:55
      489500 -- [-2540.756] (-2534.258) (-2543.871) (-2536.873) * (-2543.775) (-2539.160) (-2544.392) [-2538.192] -- 0:01:55
      490000 -- (-2538.410) (-2545.135) [-2541.153] (-2546.581) * (-2542.705) (-2537.568) (-2537.711) [-2535.173] -- 0:01:55

      Average standard deviation of split frequencies: 0.001441

      490500 -- (-2543.099) (-2543.216) [-2538.146] (-2539.310) * (-2538.702) (-2545.013) [-2535.008] (-2537.191) -- 0:01:55
      491000 -- (-2541.565) [-2539.335] (-2543.014) (-2536.475) * (-2543.642) (-2543.161) [-2540.602] (-2537.497) -- 0:01:55
      491500 -- (-2541.916) (-2545.053) (-2540.922) [-2539.963] * (-2541.431) (-2549.161) [-2535.660] (-2542.641) -- 0:01:54
      492000 -- (-2542.365) (-2541.172) (-2542.051) [-2540.892] * [-2546.836] (-2541.279) (-2536.438) (-2544.603) -- 0:01:54
      492500 -- [-2538.149] (-2550.466) (-2543.939) (-2542.838) * (-2544.457) (-2537.561) [-2538.508] (-2537.885) -- 0:01:55
      493000 -- (-2540.623) (-2539.771) [-2547.411] (-2544.199) * (-2540.438) (-2539.263) [-2536.711] (-2538.547) -- 0:01:55
      493500 -- (-2542.350) (-2537.765) [-2538.180] (-2544.946) * (-2543.026) [-2543.643] (-2543.904) (-2540.473) -- 0:01:54
      494000 -- [-2537.030] (-2540.523) (-2542.752) (-2540.522) * (-2541.508) (-2546.132) (-2533.731) [-2540.724] -- 0:01:54
      494500 -- (-2543.288) [-2536.792] (-2551.747) (-2545.339) * [-2543.426] (-2536.661) (-2544.678) (-2536.709) -- 0:01:54
      495000 -- [-2540.792] (-2543.621) (-2545.580) (-2547.441) * (-2549.229) [-2540.191] (-2537.818) (-2535.309) -- 0:01:54

      Average standard deviation of split frequencies: 0.001426

      495500 -- (-2540.588) (-2539.232) [-2537.239] (-2541.194) * [-2535.997] (-2537.025) (-2539.399) (-2534.946) -- 0:01:54
      496000 -- (-2542.204) (-2539.560) [-2541.128] (-2546.385) * (-2537.066) (-2548.078) (-2535.749) [-2537.506] -- 0:01:53
      496500 -- (-2537.231) [-2532.882] (-2536.596) (-2543.922) * (-2538.069) (-2540.706) [-2537.362] (-2536.276) -- 0:01:53
      497000 -- [-2536.613] (-2539.659) (-2537.992) (-2545.136) * (-2539.183) (-2549.220) [-2537.674] (-2536.474) -- 0:01:54
      497500 -- [-2539.321] (-2540.242) (-2530.950) (-2539.809) * (-2534.736) (-2548.231) [-2539.984] (-2532.513) -- 0:01:54
      498000 -- [-2535.576] (-2537.536) (-2539.942) (-2541.854) * (-2542.235) (-2538.261) (-2534.486) [-2535.522] -- 0:01:53
      498500 -- (-2542.079) [-2532.053] (-2547.943) (-2536.344) * [-2536.626] (-2538.133) (-2538.593) (-2537.219) -- 0:01:53
      499000 -- (-2545.647) (-2541.810) [-2538.244] (-2539.463) * (-2538.040) (-2540.284) [-2536.490] (-2547.246) -- 0:01:53
      499500 -- (-2543.080) (-2542.079) [-2540.451] (-2536.606) * [-2537.702] (-2538.769) (-2540.236) (-2536.150) -- 0:01:53
      500000 -- [-2540.677] (-2543.614) (-2538.497) (-2539.291) * (-2543.334) (-2535.997) [-2539.685] (-2540.480) -- 0:01:53

      Average standard deviation of split frequencies: 0.001412

      500500 -- (-2543.319) (-2546.397) [-2534.347] (-2542.224) * [-2536.246] (-2534.247) (-2533.889) (-2541.516) -- 0:01:52
      501000 -- [-2536.676] (-2539.026) (-2538.265) (-2538.411) * (-2537.113) (-2537.455) [-2539.379] (-2552.265) -- 0:01:52
      501500 -- [-2536.747] (-2538.086) (-2535.030) (-2537.710) * (-2542.165) (-2534.937) (-2542.916) [-2538.611] -- 0:01:53
      502000 -- (-2537.285) (-2539.107) (-2532.445) [-2538.089] * (-2546.193) (-2542.321) [-2544.816] (-2540.665) -- 0:01:53
      502500 -- [-2535.531] (-2542.764) (-2540.528) (-2542.142) * (-2538.962) [-2535.354] (-2538.429) (-2536.461) -- 0:01:52
      503000 -- (-2536.005) [-2542.723] (-2538.667) (-2534.409) * (-2541.352) (-2540.962) (-2546.423) [-2538.461] -- 0:01:52
      503500 -- [-2533.558] (-2543.627) (-2539.523) (-2535.041) * [-2546.676] (-2539.741) (-2539.194) (-2536.573) -- 0:01:52
      504000 -- (-2536.957) [-2543.800] (-2538.923) (-2539.386) * [-2539.759] (-2540.776) (-2540.276) (-2539.735) -- 0:01:52
      504500 -- [-2540