--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Mon Dec 05 10:09:39 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/373/RPA2-PB/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2809.67 -2824.58 2 -2809.37 -2826.18 -------------------------------------- TOTAL -2809.51 -2825.67 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 1.210242 0.010869 1.009106 1.407339 1.205791 1311.16 1406.08 1.000 r(A<->C){all} 0.110616 0.000405 0.070400 0.149331 0.109666 991.31 1028.22 1.000 r(A<->G){all} 0.327096 0.001514 0.254182 0.403331 0.325862 864.55 868.59 1.000 r(A<->T){all} 0.072923 0.000443 0.033245 0.113853 0.071470 1033.54 1061.45 1.000 r(C<->G){all} 0.078483 0.000240 0.050163 0.109557 0.077471 935.11 1110.24 1.004 r(C<->T){all} 0.343127 0.001369 0.267265 0.412214 0.342439 757.30 770.42 1.000 r(G<->T){all} 0.067755 0.000287 0.033964 0.099328 0.066327 1135.62 1171.84 1.000 pi(A){all} 0.234227 0.000219 0.206214 0.262763 0.233738 875.66 915.42 1.000 pi(C){all} 0.270287 0.000213 0.242988 0.300271 0.270243 1053.18 1145.74 1.000 pi(G){all} 0.281226 0.000236 0.251852 0.311382 0.281145 991.39 1054.90 1.000 pi(T){all} 0.214259 0.000185 0.189702 0.242241 0.214067 1018.40 1198.50 1.000 alpha{1,2} 0.129480 0.000229 0.101149 0.159989 0.128659 1501.00 1501.00 1.000 alpha{3} 3.483294 0.922106 1.806939 5.396241 3.358208 1352.04 1426.52 1.000 pinvar{all} 0.247805 0.002633 0.148348 0.347340 0.250910 1289.18 1370.63 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2625.435695 Model 2: PositiveSelection -2625.435695 Model 0: one-ratio -2640.459092 Model 3: discrete -2616.379039 Model 7: beta -2617.179514 Model 8: beta&w>1 -2616.826104 Model 0 vs 1 30.046793999999863 Model 2 vs 1 0.0 Model 8 vs 7 0.7068199999994249
>C1 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >C2 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKQLKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >C3 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >C4 MNDSFGDFNATQTAPSGAASSQKGEGIAPLVVKQIVDAPEGNIEMFGMQY AMACVVAIVRNIETSSTKITYALEDHSGRIDAHYWLEEGDALKAPEVMIN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKINVSEEG ISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo >C5 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEALNARYRAEDYQ SKGGAGGGAGASSGSGPIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >C6 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVIKQVVDAPEGNIELFGMQY AMVCVVGIVRNVETSSTKITYTVEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYK NKGGSGAVASSGSGSIADFTTSQSSAIVSGLDPKQQAVFQAIKSNVSEEG ISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo >C7 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY AMACVVGIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ NKGGSGAVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSEEG ISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo >C8 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVGIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEVLNARYRAEDYQ SKGGSGAGASSGGGSISDFTASQSTAIVSGLDPKQQAVFQAIKSNVSEEG ISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo >C9 MNDSFGDFNATQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY AMACVVAIVRNIETSSTKITYTLEDHSGRMDAHYWLEEGDALKAPEVMLN NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEALNARYRAEDYQ NKGGSSGVAPSGTGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSEEG ISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo >C10 MNDSFGDFNAIQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEALNARYRAEDYQ NKGGSSAVAPSGSGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSEEG ISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo >C11 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIEMFGMQY GMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN NYVKVYGTTRSQAGQKTLMVFKLLPVLDPNELCTHLLEVLNARYRAEDYQ NKGGSGAVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSEEG ISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=248 C1 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY C2 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY C3 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY C4 MNDSFGDFNATQTAPSGAASSQKGEGIAPLVVKQIVDAPEGNIEMFGMQY C5 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY C6 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVIKQVVDAPEGNIELFGMQY C7 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY C8 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY C9 MNDSFGDFNATQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY C10 MNDSFGDFNAIQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY C11 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIEMFGMQY ********** ***.:****.******.***:**:*********:***** C1 AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN C2 AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN C3 AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN C4 AMACVVAIVRNIETSSTKITYALEDHSGRIDAHYWLEEGDALKAPEVMIN C5 AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN C6 AMVCVVGIVRNVETSSTKITYTVEDHSGRIDAHYWLEEGDALKAPEVMVN C7 AMACVVGIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN C8 AMACVVGIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN C9 AMACVVAIVRNIETSSTKITYTLEDHSGRMDAHYWLEEGDALKAPEVMLN C10 AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN C11 GMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN .*.***.****:*********::******:******************:* C1 NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ C2 NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ C3 NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ C4 NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ C5 NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEALNARYRAEDYQ C6 NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYK C7 NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ C8 NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEVLNARYRAEDYQ C9 NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEALNARYRAEDYQ C10 NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEALNARYRAEDYQ C11 NYVKVYGTTRSQAGQKTLMVFKLLPVLDPNELCTHLLEVLNARYRAEDYQ ************.*.****:*****:*****:******.**********: C1 SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE C2 SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE C3 SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE C4 SKGGAG--AGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKINVSE C5 SKGGAGGGAGASSGSGPIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE C6 NKGGSG--AVASSGSGSIADFTTSQSSAIVSGLDPKQQAVFQAIKSNVSE C7 NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE C8 SKGGSG--AGASSGGGSISDFTASQSTAIVSGLDPKQQAVFQAIKSNVSE C9 NKGGSS--GVAPSGTGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE C10 NKGGSS--AVAPSGSGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE C11 NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE .***:. . *.** *.*:***:***:******:*********** **** C1 EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM-- C2 EGISRKQLKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM-- C3 EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM-- C4 EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo C5 EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM-- C6 EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo C7 EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo C8 EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo C9 EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo C10 EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo C11 EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo ******:****************:********************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked Input File /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [27854] Library Relaxation: Multi_proc [72] Relaxation Summary: [27854]--->[27668] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/373/RPA2-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.619 Mb, Max= 31.378 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM-- >C2 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKQLKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM-- >C3 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM-- >C4 MNDSFGDFNATQTAPSGAASSQKGEGIAPLVVKQIVDAPEGNIEMFGMQY AMACVVAIVRNIETSSTKITYALEDHSGRIDAHYWLEEGDALKAPEVMIN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAG--AGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKINVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo >C5 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEALNARYRAEDYQ SKGGAGGGAGASSGSGPIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM-- >C6 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVIKQVVDAPEGNIELFGMQY AMVCVVGIVRNVETSSTKITYTVEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYK NKGGSG--AVASSGSGSIADFTTSQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo >C7 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY AMACVVGIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo >C8 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVGIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEVLNARYRAEDYQ SKGGSG--AGASSGGGSISDFTASQSTAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo >C9 MNDSFGDFNATQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY AMACVVAIVRNIETSSTKITYTLEDHSGRMDAHYWLEEGDALKAPEVMLN NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEALNARYRAEDYQ NKGGSS--GVAPSGTGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo >C10 MNDSFGDFNAIQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEALNARYRAEDYQ NKGGSS--AVAPSGSGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo >C11 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIEMFGMQY GMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN NYVKVYGTTRSQAGQKTLMVFKLLPVLDPNELCTHLLEVLNARYRAEDYQ NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo FORMAT of file /tmp/tmp4049379897180434448aln Not Supported[FATAL:T-COFFEE] >C1 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM-- >C2 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKQLKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM-- >C3 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM-- >C4 MNDSFGDFNATQTAPSGAASSQKGEGIAPLVVKQIVDAPEGNIEMFGMQY AMACVVAIVRNIETSSTKITYALEDHSGRIDAHYWLEEGDALKAPEVMIN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAG--AGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKINVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo >C5 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEALNARYRAEDYQ SKGGAGGGAGASSGSGPIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM-- >C6 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVIKQVVDAPEGNIELFGMQY AMVCVVGIVRNVETSSTKITYTVEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYK NKGGSG--AVASSGSGSIADFTTSQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo >C7 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY AMACVVGIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo >C8 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVGIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEVLNARYRAEDYQ SKGGSG--AGASSGGGSISDFTASQSTAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo >C9 MNDSFGDFNATQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY AMACVVAIVRNIETSSTKITYTLEDHSGRMDAHYWLEEGDALKAPEVMLN NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEALNARYRAEDYQ NKGGSS--GVAPSGTGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo >C10 MNDSFGDFNAIQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEALNARYRAEDYQ NKGGSS--AVAPSGSGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo >C11 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIEMFGMQY GMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN NYVKVYGTTRSQAGQKTLMVFKLLPVLDPNELCTHLLEVLNARYRAEDYQ NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:248 S:99 BS:248 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # SEQ_INDEX C7 6 # SEQ_INDEX C8 7 # SEQ_INDEX C9 8 # SEQ_INDEX C10 9 # SEQ_INDEX C11 10 # PW_SEQ_DISTANCES BOT 0 1 98.78 C1 C2 98.78 TOP 1 0 98.78 C2 C1 98.78 BOT 0 2 99.19 C1 C3 99.19 TOP 2 0 99.19 C3 C1 99.19 BOT 0 3 96.72 C1 C4 96.72 TOP 3 0 96.72 C4 C1 96.72 BOT 0 4 97.97 C1 C5 97.97 TOP 4 0 97.97 C5 C1 97.97 BOT 0 5 94.67 C1 C6 94.67 TOP 5 0 94.67 C6 C1 94.67 BOT 0 6 96.31 C1 C7 96.31 TOP 6 0 96.31 C7 C1 96.31 BOT 0 7 95.49 C1 C8 95.49 TOP 7 0 95.49 C8 C1 95.49 BOT 0 8 92.21 C1 C9 92.21 TOP 8 0 92.21 C9 C1 92.21 BOT 0 9 92.21 C1 C10 92.21 TOP 9 0 92.21 C10 C1 92.21 BOT 0 10 95.08 C1 C11 95.08 TOP 10 0 95.08 C11 C1 95.08 BOT 1 2 99.59 C2 C3 99.59 TOP 2 1 99.59 C3 C2 99.59 BOT 1 3 95.90 C2 C4 95.90 TOP 3 1 95.90 C4 C2 95.90 BOT 1 4 97.56 C2 C5 97.56 TOP 4 1 97.56 C5 C2 97.56 BOT 1 5 94.26 C2 C6 94.26 TOP 5 1 94.26 C6 C2 94.26 BOT 1 6 96.72 C2 C7 96.72 TOP 6 1 96.72 C7 C2 96.72 BOT 1 7 95.08 C2 C8 95.08 TOP 7 1 95.08 C8 C2 95.08 BOT 1 8 92.62 C2 C9 92.62 TOP 8 1 92.62 C9 C2 92.62 BOT 1 9 92.62 C2 C10 92.62 TOP 9 1 92.62 C10 C2 92.62 BOT 1 10 94.67 C2 C11 94.67 TOP 10 1 94.67 C11 C2 94.67 BOT 2 3 96.31 C3 C4 96.31 TOP 3 2 96.31 C4 C3 96.31 BOT 2 4 97.97 C3 C5 97.97 TOP 4 2 97.97 C5 C3 97.97 BOT 2 5 94.67 C3 C6 94.67 TOP 5 2 94.67 C6 C3 94.67 BOT 2 6 97.13 C3 C7 97.13 TOP 6 2 97.13 C7 C3 97.13 BOT 2 7 95.49 C3 C8 95.49 TOP 7 2 95.49 C8 C3 95.49 BOT 2 8 93.03 C3 C9 93.03 TOP 8 2 93.03 C9 C3 93.03 BOT 2 9 93.03 C3 C10 93.03 TOP 9 2 93.03 C10 C3 93.03 BOT 2 10 95.08 C3 C11 95.08 TOP 10 2 95.08 C11 C3 95.08 BOT 3 4 96.31 C4 C5 96.31 TOP 4 3 96.31 C5 C4 96.31 BOT 3 5 91.46 C4 C6 91.46 TOP 5 3 91.46 C6 C4 91.46 BOT 3 6 93.50 C4 C7 93.50 TOP 6 3 93.50 C7 C4 93.50 BOT 3 7 93.09 C4 C8 93.09 TOP 7 3 93.09 C8 C4 93.09 BOT 3 8 90.65 C4 C9 90.65 TOP 8 3 90.65 C9 C4 90.65 BOT 3 9 90.65 C4 C10 90.65 TOP 9 3 90.65 C10 C4 90.65 BOT 3 10 93.90 C4 C11 93.90 TOP 10 3 93.90 C11 C4 93.90 BOT 4 5 93.03 C5 C6 93.03 TOP 5 4 93.03 C6 C5 93.03 BOT 4 6 95.49 C5 C7 95.49 TOP 6 4 95.49 C7 C5 95.49 BOT 4 7 94.67 C5 C8 94.67 TOP 7 4 94.67 C8 C5 94.67 BOT 4 8 93.03 C5 C9 93.03 TOP 8 4 93.03 C9 C5 93.03 BOT 4 9 93.03 C5 C10 93.03 TOP 9 4 93.03 C10 C5 93.03 BOT 4 10 94.26 C5 C11 94.26 TOP 10 4 94.26 C11 C5 94.26 BOT 5 6 97.56 C6 C7 97.56 TOP 6 5 97.56 C7 C6 97.56 BOT 5 7 94.31 C6 C8 94.31 TOP 7 5 94.31 C8 C6 94.31 BOT 5 8 92.68 C6 C9 92.68 TOP 8 5 92.68 C9 C6 92.68 BOT 5 9 92.68 C6 C10 92.68 TOP 9 5 92.68 C10 C6 92.68 BOT 5 10 94.72 C6 C11 94.72 TOP 10 5 94.72 C11 C6 94.72 BOT 6 7 95.93 C7 C8 95.93 TOP 7 6 95.93 C8 C7 95.93 BOT 6 8 95.12 C7 C9 95.12 TOP 8 6 95.12 C9 C7 95.12 BOT 6 9 95.12 C7 C10 95.12 TOP 9 6 95.12 C10 C7 95.12 BOT 6 10 96.34 C7 C11 96.34 TOP 10 6 96.34 C11 C7 96.34 BOT 7 8 93.09 C8 C9 93.09 TOP 8 7 93.09 C9 C8 93.09 BOT 7 9 94.31 C8 C10 94.31 TOP 9 7 94.31 C10 C8 94.31 BOT 7 10 95.53 C8 C11 95.53 TOP 10 7 95.53 C11 C8 95.53 BOT 8 9 97.56 C9 C10 97.56 TOP 9 8 97.56 C10 C9 97.56 BOT 8 10 93.90 C9 C11 93.90 TOP 10 8 93.90 C11 C9 93.90 BOT 9 10 94.72 C10 C11 94.72 TOP 10 9 94.72 C11 C10 94.72 AVG 0 C1 * 95.86 AVG 1 C2 * 95.78 AVG 2 C3 * 96.15 AVG 3 C4 * 93.85 AVG 4 C5 * 95.33 AVG 5 C6 * 94.01 AVG 6 C7 * 95.92 AVG 7 C8 * 94.70 AVG 8 C9 * 93.39 AVG 9 C10 * 93.59 AVG 10 C11 * 94.82 TOT TOT * 94.86 CLUSTAL W (1.83) multiple sequence alignment C1 ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCAACTGG C2 ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCGCTGG C3 ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCGCTGG C4 ATGAATGACTCATTTGGAGATTTCAATGCCACACAAACGGCGCCCAGTGG C5 ATGAATGACTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCGCTGG C6 ATGAACGATTCATTTGGAGATTTCAATGCCACACAAACGGCGCCCACTGG C7 ATGAACGATTCATTTGGAGATTTTAATGCCACACAAACTGCGCCCGCTGG C8 ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCACTGG C9 ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGACCGCTGG C10 ATGAATGATTCGTTTGGAGATTTCAATGCCATACAAACTGCGACCGCTGG C11 ATGAACGATTCATTTGGAGATTTCAACGCCACACAAACGGCGCCCACGGG ***** ** **.*********** ** **** ****** ***.*.. ** C1 AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC C2 AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC C3 AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC C4 AGCCGCCAGTTCTCAAAAGGGAGAAGGAATAGCGCCCCTGGTGGTGAAAC C5 AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC C6 AGCAGCCAGCAATCAGAAGGGAGAGGGAATAGTTCCACTGGTGATAAAGC C7 AGCGGCCAGCAATCAGAAGGGAGAGGGAATAGTGCCGCTGGTGATTAAGC C8 AGCCGCCAGCAATCAAAAGGGAGAGGGAATAGTACCATTGGTGGTAAAGC C9 AGCCGCCAGCAATCAAAAGGGAGAGGGAATTGTGCCATTGGTCATTAAGC C10 AGCCGCCAGCAATCAAAAGGGAGAGGGAATTGTGCCATTGGTAATAAAGC C11 AGCAGCCAGCAATCAGAAGGGAGAGGGAATAGTGCCACTGGTGGTGAAGC *** ***** :.***.********.*****:* ** **** .* **.* C1 AGATTGTGGACGCCCCAGAGGGAAACATCGAGTTGTTCGGCATGCAGTAC C2 AGATTGTGGACGCCCCGGAGGGAAACATCGAGTTGTTCGGCATGCAGTAC C3 AGATTGTGGACGCCCCGGAGGGAAACATCGAGTTGTTCGGCATGCAGTAC C4 AGATTGTGGACGCCCCGGAGGGAAACATCGAGATGTTCGGCATGCAGTAC C5 AGATCGTGGACGCCCCGGAGGGCAACATCGAGTTGTTCGGCATGCAGTAC C6 AAGTTGTGGATGCCCCCGAGGGCAACATCGAGCTGTTCGGCATGCAATAT C7 AGATTGTGGATGCCCCCGAGGGCAACATCGAGTTGTTTGGCATGCAATAT C8 AAATTGTGGATGCCCCAGAGGGAAACATTGAGCTGTTCGGCATGCAATAT C9 AGATTGTGGATGCGCCAGAGGGAAACATCGAGTTGTTTGGCATGCAATAT C10 AGATTGTGGATGCGCCGGAGGGAAACATCGAGTTGTTCGGCATGCAATAT C11 AGATTGTGGATGCCCCGGAGGGCAACATCGAGATGTTCGGCATGCAATAC *..* ***** ** ** *****.***** *** **** ********.** C1 GCCATGGCATGTGTTGTGGCCATAGTGCGGAACGTGGAGACTTCCTCGAC C2 GCCATGGCCTGTGTTGTGGCCATAGTGCGAAACGTGGAGACTTCCTCGAC C3 GCCATGGCCTGTGTTGTGGCCATAGTGCGAAACGTGGAGACTTCCTCAAC C4 GCAATGGCCTGTGTTGTGGCCATAGTGCGGAACATCGAGACTTCCTCGAC C5 GCGATGGCCTGTGTTGTGGCCATAGTGCGGAACATCGAGACTTCCTCGAC C6 GCCATGGTCTGTGTGGTGGGCATAGTGCGCAACGTCGAGACCTCCTCGAC C7 GCGATGGCCTGTGTGGTGGGCATAGTGCGAAATGTCGAGACTTCCTCAAC C8 GCCATGGCCTGTGTGGTGGGCATTGTGCGAAACATCGAGACTTCCTCGAC C9 GCAATGGCCTGTGTGGTGGCCATAGTGCGAAATATCGAGACTTCCTCGAC C10 GCCATGGCCTGTGTGGTGGCCATAGTGCGAAACATCGAGACCTCATCGAC C11 GGCATGGCCTGTGTGGTGGCCATAGTGCGAAACATCGAGACTTCCTCGAC * **** .***** **** ***:***** ** .* ***** **.**.** C1 GAAGATCACCTACACCCTGGAGGATCATAGCGGCAGGATCGATGCGCACT C2 GAAGATCACCTATACACTGGAGGATCATAGCGGCAGGATCGATGCGCACT C3 GAAGATCACCTATACACTGGAGGACCATAGCGGCAGGATCGATGCGCACT C4 AAAGATTACCTACGCCCTGGAGGATCATAGCGGCAGAATCGATGCGCACT C5 CAAGATCACCTACACGCTGGAGGATCATAGCGGCAGAATCGATGCGCACT C6 GAAGATTACCTACACCGTGGAGGATCACAGTGGCAGGATCGATGCGCACT C7 GAAGATTACTTACACCCTGGAGGATCACAGTGGCAGGATCGATGCGCACT C8 AAAGATTACCTACACCCTAGAGGATCACAGTGGTAGGATCGATGCACACT C9 CAAGATTACTTACACCCTGGAGGATCACAGTGGCCGGATGGATGCCCATT C10 CAAGATCACTTACACCCTGGAGGATCACAGTGGCCGAATCGATGCACATT C11 GAAGATTACCTACACCCTGGAGGACCACAGCGGCAGGATCGATGCGCACT ***** ** ** .* *.***** ** ** ** .*.** ***** ** * C1 ACTGGCTTGAGGAGGGCGACGCTCTCAAGGCACCCGAAGTAATGGTCAAC C2 ACTGGCTGGAGGAGGGCGACGCTCTCAAGGCACCCGAGGTCATGGTCAAC C3 ACTGGCTGGAGGAGGGCGACGCTCTCAAGGCACCCGAGGTCATGGTCAAC C4 ACTGGTTGGAGGAGGGCGACGCTCTGAAGGCACCCGAAGTCATGATCAAC C5 ACTGGCTGGAAGAGGGCGACGCTCTGAAGGCACCCGAAGTCATGGTCAAC C6 ACTGGCTGGAGGAGGGCGACGCGCTGAAGGCCCCCGAGGTCATGGTCAAC C7 ATTGGCTAGAAGAAGGCGACGCCCTGAAGGCCCCCGAAGTCATGGTCAAC C8 ATTGGCTGGAGGAGGGCGACGCCCTGAAGGCGCCCGAAGTGATGGTCAAT C9 ATTGGCTGGAGGAGGGCGATGCTCTGAAGGCCCCCGAAGTCATGCTCAAT C10 ATTGGCTGGAGGAGGGCGATGCTCTGAAGGCCCCCGAGGTCATGCTCAAT C11 ATTGGTTGGAGGAGGGCGACGCCCTCAAGGCCCCCGAGGTCATGCTGAAC * *** * **.**.***** ** ** ***** *****.** *** * ** C1 AACTACGTGAAGGTCTACGGCACCACCCGGTCGCAAGGCGGTTCCAAAAC C2 AACTACGTGAAGGTCTACGGCACCACCCGGTCGCAAGGCGGTTCCAAAAC C3 AACTACGTGAAGGTCTACGGCACCACCCGGTCGCAAGGCGGTTCCAAAAC C4 AACTACGTAAAGGTCTACGGCACCACCCGATCGCAAGGAGGTTCTAAAAC C5 AACTACGTGAAGGTCTACGGCACCACCAGATCGCAAGGCGGCTCTAAGAC C6 AACTATGTTAAGGTCTACGGCACCACGCGATCGCAGGGGGGTCAGAAAAC C7 AACTATGTGAAGGTCTATGGCACCACACGATCGCAGGGGGGGCAGAAAAC C8 AACTATGTAAAGGTCTATGGCACTACGCGTTCACAAGCGGGCCAGAAAAC C9 AACTATGTGAAAGTGTATGGAACCACGCGATCGCAGGGAGGTCAGAAAAC C10 AACTATGTGAAGGTCTATGGCACAACGCGATCTCAGGCAGGTCAGAAAAC C11 AACTACGTGAAGGTCTATGGCACCACGCGATCGCAGGCGGGCCAGAAGAC ***** ** **.** ** **.** ** .* ** **.* ** . **.** C1 CCTAATGATCTTCAAGCTACTGCCCGTTTTGGATCCCAACGAGGTGTGCA C2 CCTAATGATATTCAAGCTACTGCCCGTCTTGGATCCCAACGAGGTGTGCA C3 CCTAATGATATTCAAGCTACTGCCCGTCTTGGATCCCAACGAGGTGTGCA C4 CCTAATGATCTTCAAGTTACTGCCTGTTTTGGATCCCAACGAGGTCTGCA C5 CCTGATGATCTTCAAGCTGCTGCCTGTTCTCGATCCCAACGAGGTGTGCA C6 CCTGATGGTCTTCAAGCTGCTGCCCGTGCTGGACCCCAACGAGGTGTGCA C7 ACTGATGGTCTTCAAGCTGCTGCCCGTTTTGGACCCCAACGAGGTGTGCA C8 CCTGATGGTCTTTAAACTCCTGCCCATTCTGGATCCCAATGAGGTGTGCA C9 CCTGATGGTGTTCAAACTGCTGCCCGTTTTGGATCCCAACGAGGTGTGCA C10 GCTGATGGTCTTCAAATTGCTACCCATTTTGGATCCCAACGAGGTGTGCA C11 CCTAATGGTCTTCAAACTGCTGCCCGTTTTGGACCCAAACGAGCTGTGCA **.***.* ** **. * **.** .* * ** **.** *** * **** C1 CCCACCTGCTGGAAGTACTCAATGCCCGCTACAGGGCCGAGGACTACCAG C2 CCCACCTGCTGGAAGTACTCAATGCCCGCTACAGGGCCGAGGACTACCAG C3 CGCACCTGCTGGAAGTACTCAATGCCCGCTACAGGGCCGAGGACTACCAG C4 CCCACCTGCTGGAAGTACTCAATGCCCGTTACAGGGCCGAGGACTACCAG C5 CCCACCTGCTGGAAGCACTCAATGCCCGCTACAGGGCCGAGGACTACCAG C6 CCCATCTCCTGGAGGTGCTCAATGCCCGCTACAGGGCCGAGGACTACAAG C7 CCCATCTCCTGGAGGTGCTCAATGCCCGCTACAGGGCCGAGGATTACCAG C8 CCCATCTTCTTGAAGTTCTAAATGCCCGCTACAGGGCCGAGGATTACCAG C9 CACATCTCCTAGAAGCTCTCAATGCCCGCTATAGGGCAGAGGATTACCAG C10 CCCATCTCCTGGAAGCTCTCAATGCCCGCTATAGGGCAGAGGACTACCAG C11 CCCATCTCCTAGAAGTGCTCAATGCGCGCTACAGGGCCGAGGATTACCAG * ** ** ** **.* **.***** ** ** *****.***** ***.** C1 AGCAAGGGTGGAGCTGGAGCTGGTGCAGGGGCTTCTTCCGGCTCAGGCTC C2 AGCAAGGGTGGAGCTGGAGCTGGTGCAGGGGCTTCTTCCGGCTCAGGCTC C3 AGCAAGGGTGGAGCTGGAGCTGGTGCAGGCGCTTCTTCCGGCTCAGGCTC C4 AGTAAGGGTGGAGCTGGT------GCAGGCGCTTCCTCCGGCTCCGGCTC C5 AGCAAGGGTGGAGCTGGTGGTGGTGCAGGGGCTTCTTCCGGCTCAGGCCC C6 AACAAGGGGGGATCTGGT------GCAGTGGCTTCATCCGGCTCTGGCTC C7 AACAAGGGGGGATCTGGT------GCAGTGGCTTCTTCAGGCTCCGGCTC C8 AGCAAAGGTGGATCTGGC------GCTGGAGCTTCTTCTGGAGGTGGCTC C9 AACAAGGGAGGATCTTCG------GGAGTGGCTCCTTCTGGCACCGGCTC C10 AACAAGGGAGGATCCTCA------GCAGTTGCTCCGTCGGGCTCCGGCTC C11 AACAAGGGCGGATCTGGC------GCAGTGGCTTCTTCCGGCTCCGGCTC *. **.** *** * * :* *** * ** **. *** * C1 CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTCAGTGGGCTGG C2 CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTCAGTGGGCTAG C3 CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTTAGTGGGCTAG C4 CATAGCTGATTTCACAGCCTCCCAGAGCTCGGCCATTGTCAGTGGACTGG C5 CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTCAGTGGACTGG C6 CATAGCCGACTTCACCACCTCCCAGAGCTCGGCCATTGTGAGTGGGCTGG C7 CATAGCCGATTTTACCGCCTCCCAGAGCTCAGCCATTGTGAGTGGGCTGG C8 CATATCCGATTTCACCGCCTCCCAGAGCACGGCTATTGTTAGTGGGCTTG C9 CATATCCGATTTCACCGCCTCTCAGAGCTCGGCCATCGTCAGTGGGCTGG C10 CATATCCGATTTCACAGCCTCCCAGAGCTCGGCCATCGTCAGTGGGCTGG C11 CATAGCTGACTTCACCGCCTCCCAGAGCTCGGCCATTGTAAGTGGGCTGG **** * ** ** **..**** ******:*.** ** ** *****.** * C1 AGCCCAAGCAGCAGGCCGTATTCCAGGCCATCAAGAGCAATGTTTCCGAG C2 ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAA C3 ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAA C4 AGCCCAAGCAGCAGGCCGTTTTCCAGGCTATCAAGATCAATGTTTCCGAG C5 AGCCCAAGCAGCAGGCCGTGTTCCAGGCCATCAAGAGCAATGTTTCCGAG C6 ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTCTCCGAG C7 ATCCCAAGCAGCAGGCTGTCTTCCAAGCCATTAAGAGCAATGTCTCCGAG C8 ATCCCAAGCAGCAGGCCGTTTTCCAGGCCATTAAGAGCAATGTTTCCGAG C9 ATCCCAAGCAGCAGGCAGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAG C10 ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAG C11 ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTCTCCGAG * ************** ** *****.** ** **** ****** *****. C1 GAGGGCATCTCCCGCAAGGAACTGAAAGCCAAATTCTCCCACATCAGCGA C2 GAGGGCATCTCCCGCAAGCAACTGAAAGCCAAATTCTCCCACATCAGCGA C3 GAGGGCATCTCTCGCAAGGAACTGAAAGCCAAATTCTCCCACATCAGCGA C4 GAGGGCATCTCCCGCAAGGAGCTGAAAGCCAAATTTTCCCATATCAGCGA C5 GAGGGCATCTCCCGCAAGGAGCTGAAAGCCAAATTCTCCCACATCAGCGA C6 GAGGGCATCTCGCGCAAGGAGCTGAAAGCCAAGTTCTCACACATCAGCGA C7 GAGGGTATCTCGCGCAAGGAGCTGAAAGCCAAGTTCTCACACATCAGCGA C8 GAGGGTATTTCCCGTAAGGAGCTAAAAGCGAAGTTCTCTCATATTAGCGA C9 GAGGGCATCTCTCGCAAGGAACTAAAGGCCAAGTTCTCCCACATCAGCGA C10 GAGGGCATCTCCCGCAAGGAACTCAAAGCCAAATTCTCTCACATCAGCGA C11 GAGGGCATCTCCCGCAAGGAACTGAAAGCCAAGTTCTCGCACATCAGTGA ***** ** ** ** *** *.** **.** **.** ** ** ** ** ** C1 CTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAGGGACACATTT C2 CTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAGGGACACATTT C3 TTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAGGGACACATTT C4 CTCTGAGTTGACCAACATTCTGGACTTTATGATATCTGAGGGACACATTT C5 CTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAAGGACACATTT C6 TTCGGAACTGACCAACATTCTGGACTTCATGATTTCCGAGGGGCACATTT C7 CTCGGAGTTGACCAACATTCTGGACTTCATGATTTCCGAGGGACACATTT C8 TTCTGAGTTGACCAACATTTTGGACTTTATGATTTCCGAGGGACACATTT C9 CTCGGAGTTGACCAATATTGTGGACTTCATGATTTCCGAGGGTCATATAT C10 CTCCGAGTTGACCAATATTGTGGACTTCATGATTTCCGAGGGACATATTT C11 CTCGGAGTTGACCAACATTCTGGACTTTATGATTTCCGAAGGACACATTT ** **. ******* *** ******* *****:** **.** ** **:* C1 ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------ C2 ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------ C3 ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------ C4 ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------ C5 ATTCCAGCATTGACGCAGACCACTTTATTTGCACAATG------ C6 ATTCCAGCATTGATGCTGATCACTTTATCTGCACCATG------ C7 ATTCCAGCATTGATGCAGATCATTTCATATGCACCATG------ C8 ACTCCAGCATTGATGCGGATCATTTTATTTGCACAATG------ C9 ACTCCAGCATTGATGCCGATCACTTTATTTGCACTATG------ C10 ACTCCAGCATTGATGCCGATCACTTCATTTGCACTATG------ C11 ACTCCAGCATTGATGCTGATCATTTTATTTGCACAATG------ * *********** ** ** ** ** ** ***** *** >C1 ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCAACTGG AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC AGATTGTGGACGCCCCAGAGGGAAACATCGAGTTGTTCGGCATGCAGTAC GCCATGGCATGTGTTGTGGCCATAGTGCGGAACGTGGAGACTTCCTCGAC GAAGATCACCTACACCCTGGAGGATCATAGCGGCAGGATCGATGCGCACT ACTGGCTTGAGGAGGGCGACGCTCTCAAGGCACCCGAAGTAATGGTCAAC AACTACGTGAAGGTCTACGGCACCACCCGGTCGCAAGGCGGTTCCAAAAC CCTAATGATCTTCAAGCTACTGCCCGTTTTGGATCCCAACGAGGTGTGCA CCCACCTGCTGGAAGTACTCAATGCCCGCTACAGGGCCGAGGACTACCAG AGCAAGGGTGGAGCTGGAGCTGGTGCAGGGGCTTCTTCCGGCTCAGGCTC CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTCAGTGGGCTGG AGCCCAAGCAGCAGGCCGTATTCCAGGCCATCAAGAGCAATGTTTCCGAG GAGGGCATCTCCCGCAAGGAACTGAAAGCCAAATTCTCCCACATCAGCGA CTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAGGGACACATTT ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------ >C2 ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCGCTGG AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC AGATTGTGGACGCCCCGGAGGGAAACATCGAGTTGTTCGGCATGCAGTAC GCCATGGCCTGTGTTGTGGCCATAGTGCGAAACGTGGAGACTTCCTCGAC GAAGATCACCTATACACTGGAGGATCATAGCGGCAGGATCGATGCGCACT ACTGGCTGGAGGAGGGCGACGCTCTCAAGGCACCCGAGGTCATGGTCAAC AACTACGTGAAGGTCTACGGCACCACCCGGTCGCAAGGCGGTTCCAAAAC CCTAATGATATTCAAGCTACTGCCCGTCTTGGATCCCAACGAGGTGTGCA CCCACCTGCTGGAAGTACTCAATGCCCGCTACAGGGCCGAGGACTACCAG AGCAAGGGTGGAGCTGGAGCTGGTGCAGGGGCTTCTTCCGGCTCAGGCTC CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTCAGTGGGCTAG ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAA GAGGGCATCTCCCGCAAGCAACTGAAAGCCAAATTCTCCCACATCAGCGA CTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAGGGACACATTT ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------ >C3 ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCGCTGG AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC AGATTGTGGACGCCCCGGAGGGAAACATCGAGTTGTTCGGCATGCAGTAC GCCATGGCCTGTGTTGTGGCCATAGTGCGAAACGTGGAGACTTCCTCAAC GAAGATCACCTATACACTGGAGGACCATAGCGGCAGGATCGATGCGCACT ACTGGCTGGAGGAGGGCGACGCTCTCAAGGCACCCGAGGTCATGGTCAAC AACTACGTGAAGGTCTACGGCACCACCCGGTCGCAAGGCGGTTCCAAAAC CCTAATGATATTCAAGCTACTGCCCGTCTTGGATCCCAACGAGGTGTGCA CGCACCTGCTGGAAGTACTCAATGCCCGCTACAGGGCCGAGGACTACCAG AGCAAGGGTGGAGCTGGAGCTGGTGCAGGCGCTTCTTCCGGCTCAGGCTC CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTTAGTGGGCTAG ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAA GAGGGCATCTCTCGCAAGGAACTGAAAGCCAAATTCTCCCACATCAGCGA TTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAGGGACACATTT ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------ >C4 ATGAATGACTCATTTGGAGATTTCAATGCCACACAAACGGCGCCCAGTGG AGCCGCCAGTTCTCAAAAGGGAGAAGGAATAGCGCCCCTGGTGGTGAAAC AGATTGTGGACGCCCCGGAGGGAAACATCGAGATGTTCGGCATGCAGTAC GCAATGGCCTGTGTTGTGGCCATAGTGCGGAACATCGAGACTTCCTCGAC AAAGATTACCTACGCCCTGGAGGATCATAGCGGCAGAATCGATGCGCACT ACTGGTTGGAGGAGGGCGACGCTCTGAAGGCACCCGAAGTCATGATCAAC AACTACGTAAAGGTCTACGGCACCACCCGATCGCAAGGAGGTTCTAAAAC CCTAATGATCTTCAAGTTACTGCCTGTTTTGGATCCCAACGAGGTCTGCA CCCACCTGCTGGAAGTACTCAATGCCCGTTACAGGGCCGAGGACTACCAG AGTAAGGGTGGAGCTGGT------GCAGGCGCTTCCTCCGGCTCCGGCTC CATAGCTGATTTCACAGCCTCCCAGAGCTCGGCCATTGTCAGTGGACTGG AGCCCAAGCAGCAGGCCGTTTTCCAGGCTATCAAGATCAATGTTTCCGAG GAGGGCATCTCCCGCAAGGAGCTGAAAGCCAAATTTTCCCATATCAGCGA CTCTGAGTTGACCAACATTCTGGACTTTATGATATCTGAGGGACACATTT ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------ >C5 ATGAATGACTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCGCTGG AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC AGATCGTGGACGCCCCGGAGGGCAACATCGAGTTGTTCGGCATGCAGTAC GCGATGGCCTGTGTTGTGGCCATAGTGCGGAACATCGAGACTTCCTCGAC CAAGATCACCTACACGCTGGAGGATCATAGCGGCAGAATCGATGCGCACT ACTGGCTGGAAGAGGGCGACGCTCTGAAGGCACCCGAAGTCATGGTCAAC AACTACGTGAAGGTCTACGGCACCACCAGATCGCAAGGCGGCTCTAAGAC CCTGATGATCTTCAAGCTGCTGCCTGTTCTCGATCCCAACGAGGTGTGCA CCCACCTGCTGGAAGCACTCAATGCCCGCTACAGGGCCGAGGACTACCAG AGCAAGGGTGGAGCTGGTGGTGGTGCAGGGGCTTCTTCCGGCTCAGGCCC CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTCAGTGGACTGG AGCCCAAGCAGCAGGCCGTGTTCCAGGCCATCAAGAGCAATGTTTCCGAG GAGGGCATCTCCCGCAAGGAGCTGAAAGCCAAATTCTCCCACATCAGCGA CTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAAGGACACATTT ATTCCAGCATTGACGCAGACCACTTTATTTGCACAATG------ >C6 ATGAACGATTCATTTGGAGATTTCAATGCCACACAAACGGCGCCCACTGG AGCAGCCAGCAATCAGAAGGGAGAGGGAATAGTTCCACTGGTGATAAAGC AAGTTGTGGATGCCCCCGAGGGCAACATCGAGCTGTTCGGCATGCAATAT GCCATGGTCTGTGTGGTGGGCATAGTGCGCAACGTCGAGACCTCCTCGAC GAAGATTACCTACACCGTGGAGGATCACAGTGGCAGGATCGATGCGCACT ACTGGCTGGAGGAGGGCGACGCGCTGAAGGCCCCCGAGGTCATGGTCAAC AACTATGTTAAGGTCTACGGCACCACGCGATCGCAGGGGGGTCAGAAAAC CCTGATGGTCTTCAAGCTGCTGCCCGTGCTGGACCCCAACGAGGTGTGCA CCCATCTCCTGGAGGTGCTCAATGCCCGCTACAGGGCCGAGGACTACAAG AACAAGGGGGGATCTGGT------GCAGTGGCTTCATCCGGCTCTGGCTC CATAGCCGACTTCACCACCTCCCAGAGCTCGGCCATTGTGAGTGGGCTGG ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTCTCCGAG GAGGGCATCTCGCGCAAGGAGCTGAAAGCCAAGTTCTCACACATCAGCGA TTCGGAACTGACCAACATTCTGGACTTCATGATTTCCGAGGGGCACATTT ATTCCAGCATTGATGCTGATCACTTTATCTGCACCATG------ >C7 ATGAACGATTCATTTGGAGATTTTAATGCCACACAAACTGCGCCCGCTGG AGCGGCCAGCAATCAGAAGGGAGAGGGAATAGTGCCGCTGGTGATTAAGC AGATTGTGGATGCCCCCGAGGGCAACATCGAGTTGTTTGGCATGCAATAT GCGATGGCCTGTGTGGTGGGCATAGTGCGAAATGTCGAGACTTCCTCAAC GAAGATTACTTACACCCTGGAGGATCACAGTGGCAGGATCGATGCGCACT ATTGGCTAGAAGAAGGCGACGCCCTGAAGGCCCCCGAAGTCATGGTCAAC AACTATGTGAAGGTCTATGGCACCACACGATCGCAGGGGGGGCAGAAAAC ACTGATGGTCTTCAAGCTGCTGCCCGTTTTGGACCCCAACGAGGTGTGCA CCCATCTCCTGGAGGTGCTCAATGCCCGCTACAGGGCCGAGGATTACCAG AACAAGGGGGGATCTGGT------GCAGTGGCTTCTTCAGGCTCCGGCTC CATAGCCGATTTTACCGCCTCCCAGAGCTCAGCCATTGTGAGTGGGCTGG ATCCCAAGCAGCAGGCTGTCTTCCAAGCCATTAAGAGCAATGTCTCCGAG GAGGGTATCTCGCGCAAGGAGCTGAAAGCCAAGTTCTCACACATCAGCGA CTCGGAGTTGACCAACATTCTGGACTTCATGATTTCCGAGGGACACATTT ATTCCAGCATTGATGCAGATCATTTCATATGCACCATG------ >C8 ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCACTGG AGCCGCCAGCAATCAAAAGGGAGAGGGAATAGTACCATTGGTGGTAAAGC AAATTGTGGATGCCCCAGAGGGAAACATTGAGCTGTTCGGCATGCAATAT GCCATGGCCTGTGTGGTGGGCATTGTGCGAAACATCGAGACTTCCTCGAC AAAGATTACCTACACCCTAGAGGATCACAGTGGTAGGATCGATGCACACT ATTGGCTGGAGGAGGGCGACGCCCTGAAGGCGCCCGAAGTGATGGTCAAT AACTATGTAAAGGTCTATGGCACTACGCGTTCACAAGCGGGCCAGAAAAC CCTGATGGTCTTTAAACTCCTGCCCATTCTGGATCCCAATGAGGTGTGCA CCCATCTTCTTGAAGTTCTAAATGCCCGCTACAGGGCCGAGGATTACCAG AGCAAAGGTGGATCTGGC------GCTGGAGCTTCTTCTGGAGGTGGCTC CATATCCGATTTCACCGCCTCCCAGAGCACGGCTATTGTTAGTGGGCTTG ATCCCAAGCAGCAGGCCGTTTTCCAGGCCATTAAGAGCAATGTTTCCGAG GAGGGTATTTCCCGTAAGGAGCTAAAAGCGAAGTTCTCTCATATTAGCGA TTCTGAGTTGACCAACATTTTGGACTTTATGATTTCCGAGGGACACATTT ACTCCAGCATTGATGCGGATCATTTTATTTGCACAATG------ >C9 ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGACCGCTGG AGCCGCCAGCAATCAAAAGGGAGAGGGAATTGTGCCATTGGTCATTAAGC AGATTGTGGATGCGCCAGAGGGAAACATCGAGTTGTTTGGCATGCAATAT GCAATGGCCTGTGTGGTGGCCATAGTGCGAAATATCGAGACTTCCTCGAC CAAGATTACTTACACCCTGGAGGATCACAGTGGCCGGATGGATGCCCATT ATTGGCTGGAGGAGGGCGATGCTCTGAAGGCCCCCGAAGTCATGCTCAAT AACTATGTGAAAGTGTATGGAACCACGCGATCGCAGGGAGGTCAGAAAAC CCTGATGGTGTTCAAACTGCTGCCCGTTTTGGATCCCAACGAGGTGTGCA CACATCTCCTAGAAGCTCTCAATGCCCGCTATAGGGCAGAGGATTACCAG AACAAGGGAGGATCTTCG------GGAGTGGCTCCTTCTGGCACCGGCTC CATATCCGATTTCACCGCCTCTCAGAGCTCGGCCATCGTCAGTGGGCTGG ATCCCAAGCAGCAGGCAGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAG GAGGGCATCTCTCGCAAGGAACTAAAGGCCAAGTTCTCCCACATCAGCGA CTCGGAGTTGACCAATATTGTGGACTTCATGATTTCCGAGGGTCATATAT ACTCCAGCATTGATGCCGATCACTTTATTTGCACTATG------ >C10 ATGAATGATTCGTTTGGAGATTTCAATGCCATACAAACTGCGACCGCTGG AGCCGCCAGCAATCAAAAGGGAGAGGGAATTGTGCCATTGGTAATAAAGC AGATTGTGGATGCGCCGGAGGGAAACATCGAGTTGTTCGGCATGCAATAT GCCATGGCCTGTGTGGTGGCCATAGTGCGAAACATCGAGACCTCATCGAC CAAGATCACTTACACCCTGGAGGATCACAGTGGCCGAATCGATGCACATT ATTGGCTGGAGGAGGGCGATGCTCTGAAGGCCCCCGAGGTCATGCTCAAT AACTATGTGAAGGTCTATGGCACAACGCGATCTCAGGCAGGTCAGAAAAC GCTGATGGTCTTCAAATTGCTACCCATTTTGGATCCCAACGAGGTGTGCA CCCATCTCCTGGAAGCTCTCAATGCCCGCTATAGGGCAGAGGACTACCAG AACAAGGGAGGATCCTCA------GCAGTTGCTCCGTCGGGCTCCGGCTC CATATCCGATTTCACAGCCTCCCAGAGCTCGGCCATCGTCAGTGGGCTGG ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAG GAGGGCATCTCCCGCAAGGAACTCAAAGCCAAATTCTCTCACATCAGCGA CTCCGAGTTGACCAATATTGTGGACTTCATGATTTCCGAGGGACATATTT ACTCCAGCATTGATGCCGATCACTTCATTTGCACTATG------ >C11 ATGAACGATTCATTTGGAGATTTCAACGCCACACAAACGGCGCCCACGGG AGCAGCCAGCAATCAGAAGGGAGAGGGAATAGTGCCACTGGTGGTGAAGC AGATTGTGGATGCCCCGGAGGGCAACATCGAGATGTTCGGCATGCAATAC GGCATGGCCTGTGTGGTGGCCATAGTGCGAAACATCGAGACTTCCTCGAC GAAGATTACCTACACCCTGGAGGACCACAGCGGCAGGATCGATGCGCACT ATTGGTTGGAGGAGGGCGACGCCCTCAAGGCCCCCGAGGTCATGCTGAAC AACTACGTGAAGGTCTATGGCACCACGCGATCGCAGGCGGGCCAGAAGAC CCTAATGGTCTTCAAACTGCTGCCCGTTTTGGACCCAAACGAGCTGTGCA CCCATCTCCTAGAAGTGCTCAATGCGCGCTACAGGGCCGAGGATTACCAG AACAAGGGCGGATCTGGC------GCAGTGGCTTCTTCCGGCTCCGGCTC CATAGCTGACTTCACCGCCTCCCAGAGCTCGGCCATTGTAAGTGGGCTGG ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTCTCCGAG GAGGGCATCTCCCGCAAGGAACTGAAAGCCAAGTTCTCGCACATCAGTGA CTCGGAGTTGACCAACATTCTGGACTTTATGATTTCCGAAGGACACATTT ACTCCAGCATTGATGCTGATCATTTTATTTGCACAATG------ >C1 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >C2 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKQLKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >C3 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >C4 MNDSFGDFNATQTAPSGAASSQKGEGIAPLVVKQIVDAPEGNIEMFGMQY AMACVVAIVRNIETSSTKITYALEDHSGRIDAHYWLEEGDALKAPEVMIN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGooAGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKINVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >C5 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEALNARYRAEDYQ SKGGAGGGAGASSGSGPIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >C6 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVIKQVVDAPEGNIELFGMQY AMVCVVGIVRNVETSSTKITYTVEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYK NKGGSGooAVASSGSGSIADFTTSQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >C7 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY AMACVVGIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ NKGGSGooAVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >C8 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVGIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEVLNARYRAEDYQ SKGGSGooAGASSGGGSISDFTASQSTAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >C9 MNDSFGDFNATQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY AMACVVAIVRNIETSSTKITYTLEDHSGRMDAHYWLEEGDALKAPEVMLN NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEALNARYRAEDYQ NKGGSSooGVAPSGTGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTM >C10 MNDSFGDFNAIQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEALNARYRAEDYQ NKGGSSooAVAPSGSGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTM >C11 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIEMFGMQY GMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN NYVKVYGTTRSQAGQKTLMVFKLLPVLDPNELCTHLLEVLNARYRAEDYQ NKGGSGooAVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 11 taxa and 744 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Taxon 7 -> C7 Taxon 8 -> C8 Taxon 9 -> C9 Taxon 10 -> C10 Taxon 11 -> C11 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1480931203 Setting output file names to "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 755635333 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 3876820848 Seed = 443303352 Swapseed = 1480931203 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 38 unique site patterns Division 2 has 23 unique site patterns Division 3 has 139 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -4062.451739 -- -24.640631 Chain 2 -- -4035.833440 -- -24.640631 Chain 3 -- -4030.071980 -- -24.640631 Chain 4 -- -4073.578775 -- -24.640631 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -4094.748191 -- -24.640631 Chain 2 -- -4011.260000 -- -24.640631 Chain 3 -- -3960.086474 -- -24.640631 Chain 4 -- -3988.481343 -- -24.640631 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-4062.452] (-4035.833) (-4030.072) (-4073.579) * [-4094.748] (-4011.260) (-3960.086) (-3988.481) 500 -- [-2947.959] (-2972.009) (-3006.112) (-2993.814) * (-2962.444) (-2966.932) (-2984.023) [-2957.094] -- 0:33:19 1000 -- [-2864.626] (-2935.507) (-2958.084) (-2960.161) * (-2920.204) (-2894.959) (-2911.782) [-2878.448] -- 0:16:39 1500 -- [-2828.542] (-2940.318) (-2910.761) (-2892.451) * (-2845.616) [-2843.492] (-2888.836) (-2857.284) -- 0:11:05 2000 -- (-2833.907) (-2901.009) (-2862.478) [-2861.148] * (-2838.884) (-2811.529) [-2851.481] (-2832.878) -- 0:16:38 2500 -- (-2824.310) (-2868.187) (-2856.277) [-2829.401] * (-2827.388) (-2815.700) (-2827.951) [-2817.581] -- 0:13:18 3000 -- [-2816.474] (-2821.044) (-2839.865) (-2821.105) * (-2827.768) (-2817.163) (-2829.684) [-2810.235] -- 0:11:04 3500 -- (-2813.397) (-2819.876) (-2827.429) [-2824.754] * (-2827.015) (-2814.719) [-2811.661] (-2812.744) -- 0:09:29 4000 -- (-2821.495) (-2815.991) (-2831.156) [-2815.614] * (-2815.927) [-2814.515] (-2813.697) (-2826.693) -- 0:12:27 4500 -- (-2816.450) (-2818.913) (-2826.742) [-2813.803] * (-2823.365) (-2810.075) (-2809.371) [-2810.780] -- 0:11:03 5000 -- (-2823.291) [-2819.840] (-2815.399) (-2808.334) * (-2821.487) (-2811.435) (-2820.245) [-2806.594] -- 0:09:57 Average standard deviation of split frequencies: 0.072524 5500 -- (-2816.164) [-2813.177] (-2824.808) (-2819.883) * [-2810.469] (-2823.847) (-2816.801) (-2816.744) -- 0:09:02 6000 -- (-2824.205) (-2806.795) (-2812.645) [-2817.481] * (-2824.691) (-2820.353) [-2817.650] (-2813.988) -- 0:11:02 6500 -- (-2814.388) (-2814.127) (-2821.828) [-2816.932] * (-2818.772) (-2816.193) [-2814.478] (-2810.242) -- 0:10:11 7000 -- (-2815.311) [-2817.023] (-2830.949) (-2815.772) * (-2820.603) [-2813.628] (-2815.574) (-2821.042) -- 0:09:27 7500 -- (-2817.595) (-2832.011) (-2825.453) [-2809.825] * (-2815.049) (-2812.267) (-2815.688) [-2812.741] -- 0:08:49 8000 -- (-2809.060) (-2823.474) (-2827.879) [-2807.643] * (-2810.342) (-2823.273) [-2817.520] (-2815.055) -- 0:10:20 8500 -- [-2812.495] (-2817.779) (-2820.277) (-2815.296) * (-2817.047) (-2815.532) (-2821.913) [-2817.562] -- 0:09:43 9000 -- (-2814.234) (-2821.825) [-2814.398] (-2822.439) * (-2819.020) (-2819.195) [-2811.262] (-2816.356) -- 0:09:10 9500 -- (-2816.085) (-2827.586) [-2812.399] (-2824.362) * (-2814.057) (-2816.305) (-2813.738) [-2818.094] -- 0:08:41 10000 -- (-2827.150) (-2819.545) (-2813.697) [-2812.789] * (-2823.575) [-2816.948] (-2811.932) (-2815.401) -- 0:09:54 Average standard deviation of split frequencies: 0.022097 10500 -- [-2819.883] (-2815.643) (-2817.398) (-2812.343) * (-2818.933) (-2816.659) (-2814.245) [-2813.727] -- 0:09:25 11000 -- (-2823.909) (-2818.826) (-2813.408) [-2809.590] * (-2821.395) [-2815.958] (-2816.863) (-2810.362) -- 0:08:59 11500 -- (-2815.972) (-2819.205) [-2809.565] (-2808.927) * [-2823.788] (-2817.117) (-2818.560) (-2811.154) -- 0:08:35 12000 -- [-2812.098] (-2813.458) (-2809.493) (-2809.781) * (-2812.248) (-2812.363) [-2814.725] (-2819.967) -- 0:09:36 12500 -- (-2828.230) (-2810.331) [-2817.632] (-2813.647) * [-2811.942] (-2819.182) (-2817.739) (-2817.272) -- 0:09:13 13000 -- (-2810.557) (-2811.628) (-2815.216) [-2820.077] * [-2811.177] (-2821.134) (-2812.993) (-2822.717) -- 0:08:51 13500 -- (-2818.568) (-2821.409) (-2818.144) [-2808.095] * (-2813.328) (-2816.290) (-2820.119) [-2813.655] -- 0:08:31 14000 -- (-2819.125) (-2817.516) [-2812.134] (-2817.916) * (-2814.264) (-2809.569) (-2817.203) [-2814.888] -- 0:09:23 14500 -- (-2808.566) (-2815.246) [-2811.977] (-2820.667) * [-2809.266] (-2816.784) (-2813.427) (-2818.244) -- 0:09:03 15000 -- (-2812.606) (-2818.033) (-2824.032) [-2817.889] * (-2821.061) [-2818.444] (-2812.868) (-2813.852) -- 0:08:45 Average standard deviation of split frequencies: 0.026189 15500 -- (-2813.900) [-2815.783] (-2816.523) (-2824.308) * (-2825.936) (-2816.632) (-2816.656) [-2812.397] -- 0:09:31 16000 -- (-2815.751) (-2825.930) [-2808.960] (-2819.692) * [-2815.624] (-2816.777) (-2825.911) (-2813.706) -- 0:09:13 16500 -- (-2818.509) (-2820.178) (-2816.961) [-2813.034] * (-2830.415) [-2817.123] (-2822.297) (-2822.698) -- 0:08:56 17000 -- (-2822.757) (-2816.132) [-2813.181] (-2834.644) * (-2821.349) (-2812.804) (-2822.427) [-2810.719] -- 0:08:40 17500 -- [-2817.621] (-2826.529) (-2811.742) (-2827.804) * (-2812.621) (-2821.484) (-2827.576) [-2813.710] -- 0:09:21 18000 -- (-2819.393) [-2822.389] (-2808.670) (-2817.344) * (-2823.335) (-2819.310) [-2809.957] (-2810.858) -- 0:09:05 18500 -- (-2813.606) (-2814.791) [-2818.841] (-2823.807) * (-2812.858) [-2806.277] (-2817.068) (-2823.325) -- 0:08:50 19000 -- (-2817.597) (-2813.064) [-2819.098] (-2815.426) * (-2814.951) (-2817.506) (-2824.048) [-2818.898] -- 0:08:36 19500 -- (-2828.365) (-2810.777) [-2817.113] (-2822.473) * (-2815.855) [-2815.284] (-2815.647) (-2820.653) -- 0:09:13 20000 -- [-2820.910] (-2827.859) (-2814.653) (-2807.773) * (-2813.073) [-2823.503] (-2819.297) (-2812.065) -- 0:08:59 Average standard deviation of split frequencies: 0.018248 20500 -- [-2821.934] (-2809.766) (-2815.613) (-2822.086) * (-2817.409) (-2822.154) (-2815.347) [-2822.669] -- 0:08:45 21000 -- (-2820.882) [-2813.508] (-2821.495) (-2817.011) * (-2809.421) [-2814.766] (-2828.221) (-2826.307) -- 0:08:32 21500 -- [-2815.118] (-2815.132) (-2822.096) (-2816.028) * (-2820.244) [-2823.756] (-2826.283) (-2819.278) -- 0:09:06 22000 -- (-2816.789) (-2812.843) [-2812.359] (-2817.615) * [-2810.728] (-2813.837) (-2813.687) (-2817.103) -- 0:08:53 22500 -- (-2821.037) (-2818.393) (-2815.302) [-2808.099] * [-2815.188] (-2822.176) (-2814.614) (-2811.871) -- 0:08:41 23000 -- (-2815.436) (-2820.162) [-2812.460] (-2816.570) * [-2809.440] (-2811.277) (-2813.988) (-2820.887) -- 0:08:29 23500 -- (-2818.173) (-2809.765) [-2817.746] (-2809.622) * (-2812.845) (-2817.215) [-2820.452] (-2819.297) -- 0:09:00 24000 -- (-2814.397) [-2812.520] (-2821.681) (-2815.512) * [-2818.544] (-2816.197) (-2810.548) (-2820.801) -- 0:08:48 24500 -- [-2814.089] (-2818.914) (-2833.948) (-2823.987) * (-2819.757) (-2818.486) (-2821.226) [-2821.209] -- 0:08:37 25000 -- (-2811.429) [-2818.368] (-2817.778) (-2824.858) * (-2816.552) (-2818.494) (-2812.379) [-2822.770] -- 0:08:26 Average standard deviation of split frequencies: 0.014505 25500 -- [-2816.312] (-2826.863) (-2823.260) (-2814.807) * (-2815.350) (-2818.503) (-2820.517) [-2812.999] -- 0:08:55 26000 -- (-2816.507) (-2817.104) [-2816.122] (-2815.494) * (-2828.412) [-2808.464] (-2821.534) (-2829.694) -- 0:08:44 26500 -- (-2815.737) (-2815.364) [-2820.048] (-2812.915) * (-2816.513) [-2819.656] (-2822.273) (-2806.959) -- 0:08:34 27000 -- (-2814.257) [-2811.670] (-2813.525) (-2815.869) * (-2818.406) (-2815.850) (-2823.155) [-2816.858] -- 0:08:24 27500 -- [-2816.428] (-2812.824) (-2822.498) (-2809.580) * (-2818.921) [-2818.999] (-2807.821) (-2825.087) -- 0:08:50 28000 -- (-2817.232) [-2815.838] (-2812.228) (-2812.904) * (-2810.619) (-2814.279) [-2817.377] (-2821.438) -- 0:08:40 28500 -- (-2809.910) (-2823.229) (-2820.854) [-2812.234] * (-2819.691) (-2818.654) [-2811.211] (-2818.212) -- 0:08:31 29000 -- [-2811.428] (-2821.660) (-2819.537) (-2821.911) * [-2817.553] (-2819.339) (-2819.081) (-2817.443) -- 0:08:22 29500 -- (-2817.521) (-2820.102) [-2818.257] (-2812.608) * (-2823.436) [-2811.539] (-2814.799) (-2816.351) -- 0:08:46 30000 -- [-2815.906] (-2822.567) (-2814.858) (-2823.643) * [-2815.135] (-2822.574) (-2817.071) (-2823.309) -- 0:08:37 Average standard deviation of split frequencies: 0.011956 30500 -- (-2820.959) [-2809.780] (-2816.506) (-2812.166) * (-2831.026) (-2820.216) (-2814.142) [-2810.840] -- 0:08:28 31000 -- (-2816.261) (-2812.812) [-2817.578] (-2805.514) * [-2813.243] (-2823.653) (-2812.047) (-2817.262) -- 0:08:20 31500 -- (-2813.092) [-2808.697] (-2819.858) (-2810.109) * (-2817.876) (-2815.306) [-2813.396] (-2815.848) -- 0:08:42 32000 -- (-2823.797) (-2813.552) (-2819.756) [-2812.237] * [-2814.208] (-2826.205) (-2812.900) (-2819.243) -- 0:08:34 32500 -- (-2825.983) [-2813.967] (-2832.824) (-2813.448) * (-2818.204) [-2810.072] (-2815.866) (-2823.557) -- 0:08:26 33000 -- (-2817.259) (-2811.903) (-2819.323) [-2814.534] * (-2820.827) (-2813.218) [-2813.044] (-2824.144) -- 0:08:18 33500 -- (-2813.888) [-2807.859] (-2825.965) (-2813.148) * [-2817.382] (-2818.111) (-2812.165) (-2817.394) -- 0:08:39 34000 -- [-2814.253] (-2813.058) (-2810.343) (-2818.473) * [-2810.040] (-2819.129) (-2813.225) (-2812.799) -- 0:08:31 34500 -- (-2813.299) [-2821.353] (-2818.564) (-2813.987) * [-2811.918] (-2816.706) (-2812.213) (-2819.365) -- 0:08:23 35000 -- (-2815.567) [-2814.363] (-2818.493) (-2814.345) * (-2809.637) [-2816.449] (-2818.089) (-2813.948) -- 0:08:43 Average standard deviation of split frequencies: 0.013095 35500 -- (-2826.608) [-2812.513] (-2827.613) (-2813.129) * (-2817.323) (-2808.630) (-2811.041) [-2812.187] -- 0:08:36 36000 -- [-2813.434] (-2823.783) (-2818.526) (-2816.083) * [-2818.169] (-2814.299) (-2811.656) (-2818.106) -- 0:08:28 36500 -- (-2828.387) (-2816.283) (-2824.977) [-2817.695] * [-2814.921] (-2818.807) (-2824.412) (-2821.256) -- 0:08:21 37000 -- (-2819.614) (-2808.680) (-2825.191) [-2817.441] * (-2808.297) (-2827.791) (-2828.258) [-2818.908] -- 0:08:40 37500 -- (-2823.939) (-2816.378) [-2816.336] (-2829.711) * (-2818.342) (-2819.936) [-2814.376] (-2814.569) -- 0:08:33 38000 -- (-2824.113) [-2814.685] (-2814.962) (-2822.347) * (-2820.033) (-2823.732) (-2812.985) [-2815.085] -- 0:08:26 38500 -- (-2823.352) (-2821.697) (-2822.514) [-2822.304] * (-2812.013) (-2822.550) [-2813.375] (-2827.258) -- 0:08:19 39000 -- (-2814.580) (-2824.570) (-2812.941) [-2810.338] * (-2819.308) (-2814.153) (-2814.806) [-2816.725] -- 0:08:37 39500 -- (-2822.174) (-2812.440) (-2817.051) [-2822.396] * [-2814.617] (-2816.966) (-2817.646) (-2814.077) -- 0:08:30 40000 -- (-2822.635) [-2812.221] (-2821.543) (-2820.806) * (-2815.711) (-2810.919) (-2822.776) [-2814.060] -- 0:08:23 Average standard deviation of split frequencies: 0.017388 40500 -- (-2814.983) (-2813.770) (-2823.250) [-2815.468] * (-2807.068) [-2817.046] (-2823.734) (-2821.075) -- 0:08:17 41000 -- (-2832.758) [-2809.153] (-2823.679) (-2821.317) * [-2807.538] (-2808.602) (-2826.136) (-2808.251) -- 0:08:34 41500 -- (-2820.101) (-2813.394) [-2813.910] (-2825.790) * [-2813.948] (-2817.402) (-2817.205) (-2823.623) -- 0:08:28 42000 -- (-2811.658) [-2819.139] (-2822.815) (-2818.010) * (-2820.386) (-2818.050) [-2815.888] (-2820.596) -- 0:08:21 42500 -- (-2821.027) [-2819.628] (-2820.839) (-2809.573) * (-2813.481) (-2815.989) (-2821.931) [-2818.746] -- 0:08:15 43000 -- (-2823.784) (-2821.243) [-2809.977] (-2819.067) * (-2817.948) [-2809.503] (-2824.747) (-2811.200) -- 0:08:31 43500 -- (-2813.944) (-2815.453) (-2818.704) [-2808.175] * (-2813.242) (-2822.184) (-2821.814) [-2821.695] -- 0:08:25 44000 -- [-2814.829] (-2820.079) (-2810.904) (-2823.919) * (-2816.654) [-2811.114] (-2819.046) (-2818.900) -- 0:08:19 44500 -- (-2813.701) [-2820.585] (-2819.316) (-2819.092) * (-2814.984) [-2809.155] (-2823.860) (-2814.619) -- 0:08:13 45000 -- (-2824.794) [-2815.389] (-2814.355) (-2820.011) * [-2818.235] (-2820.921) (-2828.264) (-2816.702) -- 0:08:29 Average standard deviation of split frequencies: 0.019471 45500 -- (-2822.990) [-2814.637] (-2816.385) (-2821.676) * (-2812.805) [-2814.876] (-2822.489) (-2827.816) -- 0:08:23 46000 -- (-2811.593) (-2814.807) [-2813.187] (-2815.913) * (-2824.462) (-2813.448) [-2810.700] (-2810.751) -- 0:08:17 46500 -- [-2810.615] (-2815.677) (-2811.186) (-2824.655) * (-2818.315) (-2812.145) [-2812.385] (-2814.959) -- 0:08:12 47000 -- (-2817.243) (-2822.575) (-2818.133) [-2819.259] * [-2821.562] (-2823.751) (-2814.604) (-2814.968) -- 0:08:26 47500 -- (-2818.656) (-2817.098) (-2813.353) [-2825.039] * (-2824.695) (-2826.459) (-2826.670) [-2811.836] -- 0:08:21 48000 -- (-2822.422) [-2810.178] (-2813.032) (-2812.976) * (-2819.217) (-2824.591) [-2813.978] (-2823.432) -- 0:08:15 48500 -- (-2822.276) (-2816.331) (-2812.956) [-2812.910] * [-2813.943] (-2832.719) (-2815.364) (-2825.490) -- 0:08:10 49000 -- [-2814.898] (-2827.535) (-2813.115) (-2810.001) * (-2820.989) (-2814.486) (-2810.043) [-2811.235] -- 0:08:24 49500 -- (-2813.796) (-2818.910) (-2817.066) [-2819.506] * (-2824.391) (-2814.949) (-2820.961) [-2818.748] -- 0:08:19 50000 -- (-2820.681) (-2819.051) (-2816.605) [-2814.851] * (-2818.654) (-2816.014) (-2821.752) [-2810.676] -- 0:08:13 Average standard deviation of split frequencies: 0.020676 50500 -- (-2827.349) (-2829.451) [-2818.061] (-2812.142) * [-2825.051] (-2830.295) (-2822.426) (-2807.399) -- 0:08:08 51000 -- [-2823.840] (-2817.792) (-2819.946) (-2822.197) * [-2814.368] (-2818.491) (-2811.343) (-2811.742) -- 0:08:22 51500 -- [-2815.234] (-2814.748) (-2825.938) (-2821.298) * (-2821.765) (-2827.395) [-2815.655] (-2809.132) -- 0:08:17 52000 -- [-2817.921] (-2822.436) (-2818.496) (-2822.274) * (-2813.804) (-2819.443) (-2810.498) [-2809.118] -- 0:08:12 52500 -- [-2816.161] (-2821.818) (-2814.048) (-2820.462) * (-2817.519) [-2823.229] (-2811.157) (-2810.508) -- 0:08:25 53000 -- [-2811.962] (-2813.705) (-2807.750) (-2816.618) * [-2817.857] (-2813.265) (-2826.928) (-2819.339) -- 0:08:20 53500 -- (-2808.412) (-2822.159) (-2816.230) [-2814.188] * [-2813.928] (-2816.297) (-2818.465) (-2827.629) -- 0:08:15 54000 -- [-2814.353] (-2817.220) (-2810.219) (-2816.769) * [-2823.652] (-2812.777) (-2826.018) (-2814.990) -- 0:08:10 54500 -- [-2811.405] (-2817.877) (-2812.912) (-2814.984) * (-2814.789) (-2808.459) (-2822.919) [-2821.154] -- 0:08:23 55000 -- (-2819.466) [-2817.947] (-2814.353) (-2817.984) * (-2815.712) [-2822.573] (-2818.887) (-2810.181) -- 0:08:18 Average standard deviation of split frequencies: 0.019642 55500 -- (-2815.953) (-2815.407) [-2816.108] (-2815.000) * (-2816.028) [-2819.388] (-2818.154) (-2817.475) -- 0:08:13 56000 -- (-2823.839) (-2821.227) (-2824.783) [-2817.275] * [-2815.519] (-2817.131) (-2824.253) (-2816.471) -- 0:08:08 56500 -- (-2815.933) (-2821.705) [-2812.349] (-2824.872) * [-2823.386] (-2812.988) (-2816.087) (-2820.212) -- 0:08:20 57000 -- (-2810.461) (-2819.004) [-2811.404] (-2824.455) * (-2808.009) [-2812.079] (-2811.673) (-2816.019) -- 0:08:16 57500 -- (-2823.076) (-2818.791) (-2814.280) [-2813.339] * [-2813.198] (-2816.633) (-2810.283) (-2812.663) -- 0:08:11 58000 -- (-2814.775) (-2811.982) (-2811.693) [-2817.709] * (-2814.052) (-2820.031) (-2812.564) [-2810.613] -- 0:08:07 58500 -- [-2821.510] (-2819.142) (-2812.971) (-2809.239) * (-2815.533) (-2817.395) (-2822.382) [-2821.685] -- 0:08:18 59000 -- (-2827.961) (-2813.297) (-2819.397) [-2818.077] * (-2815.407) (-2813.827) [-2812.879] (-2815.973) -- 0:08:14 59500 -- [-2824.688] (-2820.958) (-2814.438) (-2813.828) * (-2817.786) (-2815.654) [-2823.013] (-2825.063) -- 0:08:10 60000 -- (-2811.916) (-2813.063) (-2820.500) [-2818.895] * (-2817.685) (-2813.265) [-2822.018] (-2819.608) -- 0:08:05 Average standard deviation of split frequencies: 0.011224 60500 -- [-2811.024] (-2818.748) (-2820.512) (-2816.442) * (-2816.301) [-2817.056] (-2814.452) (-2825.098) -- 0:08:16 61000 -- (-2821.905) (-2824.273) [-2812.966] (-2819.658) * (-2823.702) (-2819.631) [-2813.042] (-2816.097) -- 0:08:12 61500 -- (-2819.708) (-2816.605) (-2820.341) [-2814.383] * (-2827.840) (-2815.489) (-2824.320) [-2815.600] -- 0:08:08 62000 -- (-2823.956) (-2812.239) [-2809.392] (-2820.898) * (-2815.078) (-2825.351) (-2815.142) [-2808.451] -- 0:08:04 62500 -- (-2821.939) [-2812.434] (-2809.387) (-2826.937) * [-2821.324] (-2818.307) (-2815.310) (-2812.163) -- 0:08:15 63000 -- [-2819.754] (-2818.319) (-2817.088) (-2815.459) * (-2817.234) (-2831.090) [-2820.150] (-2814.585) -- 0:08:10 63500 -- [-2817.567] (-2816.055) (-2811.197) (-2813.664) * (-2813.580) (-2814.592) [-2806.519] (-2820.411) -- 0:08:06 64000 -- (-2821.009) (-2821.555) [-2816.506] (-2824.477) * [-2820.178] (-2812.039) (-2825.207) (-2818.946) -- 0:08:02 64500 -- [-2812.763] (-2820.628) (-2814.619) (-2824.009) * (-2817.786) [-2815.193] (-2819.544) (-2821.645) -- 0:08:13 65000 -- (-2820.054) [-2815.658] (-2816.673) (-2821.321) * (-2822.765) (-2810.848) (-2823.885) [-2806.490] -- 0:08:09 Average standard deviation of split frequencies: 0.011904 65500 -- (-2826.076) [-2813.067] (-2822.244) (-2811.837) * [-2815.257] (-2821.438) (-2826.998) (-2812.079) -- 0:08:05 66000 -- (-2818.976) (-2816.116) (-2822.726) [-2819.938] * (-2821.207) (-2818.426) (-2821.042) [-2812.222] -- 0:08:01 66500 -- (-2818.163) (-2817.052) [-2822.430] (-2822.894) * [-2811.307] (-2815.352) (-2816.525) (-2818.430) -- 0:08:11 67000 -- [-2812.269] (-2813.866) (-2817.026) (-2824.434) * (-2820.678) (-2817.314) (-2818.975) [-2816.272] -- 0:08:07 67500 -- (-2814.551) [-2819.679] (-2813.035) (-2826.703) * [-2816.652] (-2808.584) (-2820.528) (-2821.688) -- 0:08:03 68000 -- (-2813.304) (-2826.972) [-2816.398] (-2832.102) * [-2813.017] (-2815.108) (-2826.684) (-2820.142) -- 0:07:59 68500 -- [-2813.144] (-2816.057) (-2821.328) (-2830.002) * (-2817.853) (-2817.132) [-2809.059] (-2814.204) -- 0:08:09 69000 -- (-2815.978) [-2815.670] (-2819.753) (-2822.861) * (-2822.171) (-2818.935) [-2810.711] (-2817.000) -- 0:08:05 69500 -- (-2819.472) (-2814.590) [-2819.010] (-2817.938) * (-2816.646) (-2813.628) (-2815.538) [-2818.873] -- 0:08:01 70000 -- [-2822.166] (-2820.377) (-2818.645) (-2819.055) * [-2816.034] (-2816.534) (-2819.734) (-2817.898) -- 0:08:11 Average standard deviation of split frequencies: 0.008894 70500 -- (-2838.936) [-2816.154] (-2819.647) (-2821.846) * (-2817.463) [-2811.500] (-2824.339) (-2822.087) -- 0:08:07 71000 -- (-2812.513) [-2810.546] (-2827.681) (-2814.622) * [-2813.101] (-2816.160) (-2816.545) (-2814.426) -- 0:08:04 71500 -- (-2808.688) (-2810.663) (-2811.366) [-2813.533] * (-2814.763) (-2825.983) (-2814.699) [-2818.147] -- 0:08:00 72000 -- (-2816.908) (-2809.637) [-2823.729] (-2827.261) * (-2823.121) (-2825.332) [-2817.411] (-2818.463) -- 0:08:09 72500 -- (-2812.795) (-2812.920) [-2819.212] (-2817.431) * (-2808.627) (-2817.945) (-2814.471) [-2811.131] -- 0:08:06 73000 -- (-2815.092) (-2821.403) (-2832.471) [-2811.523] * (-2821.863) (-2817.021) (-2821.086) [-2809.876] -- 0:08:02 73500 -- [-2813.430] (-2810.278) (-2829.167) (-2808.244) * (-2820.093) [-2821.588] (-2819.198) (-2806.864) -- 0:07:59 74000 -- (-2820.268) [-2807.486] (-2820.083) (-2825.678) * (-2816.078) [-2826.936] (-2821.848) (-2813.237) -- 0:08:08 74500 -- (-2821.829) (-2816.819) [-2807.153] (-2821.523) * (-2811.450) [-2816.467] (-2813.781) (-2818.703) -- 0:08:04 75000 -- [-2817.346] (-2816.962) (-2823.487) (-2815.291) * (-2821.063) [-2812.216] (-2812.434) (-2823.610) -- 0:08:00 Average standard deviation of split frequencies: 0.008270 75500 -- (-2814.107) [-2811.124] (-2821.838) (-2829.627) * (-2817.996) (-2823.733) (-2816.243) [-2823.726] -- 0:07:57 76000 -- [-2812.943] (-2816.068) (-2818.841) (-2816.247) * (-2819.014) [-2822.383] (-2809.580) (-2811.789) -- 0:08:06 76500 -- (-2813.966) [-2817.149] (-2816.481) (-2813.227) * (-2816.942) [-2816.983] (-2810.314) (-2809.586) -- 0:08:02 77000 -- (-2818.818) (-2814.324) [-2825.299] (-2812.488) * (-2811.672) (-2813.163) (-2820.423) [-2817.968] -- 0:07:59 77500 -- [-2814.043] (-2820.082) (-2825.609) (-2823.296) * (-2817.704) (-2813.142) (-2827.677) [-2814.758] -- 0:07:56 78000 -- (-2815.690) (-2827.402) (-2825.524) [-2818.046] * (-2817.753) [-2813.020] (-2817.958) (-2815.030) -- 0:08:04 78500 -- (-2827.239) (-2816.815) (-2824.061) [-2812.439] * (-2817.548) (-2816.633) (-2828.134) [-2810.014] -- 0:08:01 79000 -- (-2816.515) [-2812.352] (-2833.342) (-2812.543) * (-2811.057) (-2817.192) (-2817.992) [-2814.441] -- 0:07:57 79500 -- (-2822.148) (-2819.023) [-2815.343] (-2818.537) * (-2809.338) (-2818.146) [-2817.079] (-2821.666) -- 0:07:54 80000 -- (-2814.540) (-2821.302) (-2818.648) [-2818.230] * (-2815.076) (-2820.126) (-2817.278) [-2816.513] -- 0:08:02 Average standard deviation of split frequencies: 0.007142 80500 -- (-2818.345) (-2813.302) (-2831.546) [-2812.751] * [-2809.482] (-2819.026) (-2811.157) (-2826.884) -- 0:07:59 81000 -- (-2819.662) (-2816.184) (-2814.780) [-2819.961] * (-2820.705) (-2821.650) (-2819.089) [-2821.313] -- 0:07:56 81500 -- [-2809.574] (-2818.364) (-2813.274) (-2812.321) * (-2825.190) (-2813.109) (-2815.385) [-2815.251] -- 0:07:53 82000 -- (-2815.015) [-2812.487] (-2812.823) (-2824.726) * (-2814.010) (-2819.590) (-2824.160) [-2811.739] -- 0:08:01 82500 -- (-2811.907) (-2824.906) (-2816.561) [-2816.630] * (-2819.836) (-2820.289) (-2818.522) [-2813.143] -- 0:07:58 83000 -- [-2819.245] (-2818.300) (-2812.192) (-2811.903) * (-2810.097) (-2819.229) (-2810.995) [-2808.960] -- 0:07:55 83500 -- (-2827.302) (-2819.866) [-2814.256] (-2820.552) * (-2818.358) (-2813.829) (-2814.259) [-2809.418] -- 0:07:51 84000 -- (-2814.186) (-2819.124) [-2814.320] (-2814.969) * (-2816.156) (-2825.961) (-2821.451) [-2812.922] -- 0:07:59 84500 -- (-2824.270) [-2811.758] (-2818.497) (-2816.707) * (-2818.232) (-2813.772) [-2823.955] (-2815.857) -- 0:07:56 85000 -- (-2833.761) [-2809.591] (-2813.935) (-2821.779) * (-2820.148) (-2817.667) (-2819.031) [-2811.187] -- 0:07:53 Average standard deviation of split frequencies: 0.008527 85500 -- [-2817.278] (-2817.816) (-2806.362) (-2812.031) * (-2817.793) [-2815.219] (-2827.138) (-2812.229) -- 0:07:50 86000 -- (-2818.401) [-2811.258] (-2816.632) (-2818.510) * (-2820.347) (-2810.196) [-2814.330] (-2809.427) -- 0:07:58 86500 -- (-2809.082) [-2816.108] (-2819.606) (-2815.416) * (-2827.329) [-2817.596] (-2814.649) (-2810.112) -- 0:07:55 87000 -- (-2819.705) [-2820.676] (-2814.373) (-2834.581) * (-2824.518) (-2818.679) (-2817.865) [-2809.969] -- 0:07:52 87500 -- [-2813.960] (-2822.076) (-2814.511) (-2819.060) * (-2827.231) (-2817.427) (-2828.741) [-2811.100] -- 0:07:59 88000 -- [-2810.882] (-2817.097) (-2819.002) (-2811.370) * (-2807.592) (-2817.417) (-2818.589) [-2808.404] -- 0:07:56 88500 -- (-2812.962) [-2817.498] (-2822.222) (-2817.153) * [-2816.103] (-2821.662) (-2823.434) (-2812.965) -- 0:07:53 89000 -- [-2811.708] (-2821.529) (-2813.838) (-2812.487) * (-2816.587) [-2819.692] (-2811.397) (-2818.616) -- 0:07:50 89500 -- [-2817.409] (-2824.158) (-2820.651) (-2811.585) * [-2826.017] (-2812.538) (-2827.201) (-2819.078) -- 0:07:58 90000 -- (-2814.007) (-2820.459) [-2818.904] (-2818.311) * (-2819.601) (-2818.888) (-2822.748) [-2819.660] -- 0:07:55 Average standard deviation of split frequencies: 0.008088 90500 -- (-2817.253) [-2816.729] (-2816.083) (-2821.939) * (-2819.921) [-2818.938] (-2834.012) (-2821.873) -- 0:07:52 91000 -- (-2823.080) (-2818.036) [-2815.322] (-2814.762) * (-2821.044) (-2809.742) [-2817.530] (-2812.272) -- 0:07:49 91500 -- (-2820.318) (-2816.356) [-2812.188] (-2813.070) * [-2816.234] (-2818.780) (-2829.369) (-2819.876) -- 0:07:56 92000 -- (-2819.726) (-2822.228) [-2820.277] (-2816.271) * (-2811.262) (-2813.151) [-2818.101] (-2817.537) -- 0:07:53 92500 -- (-2817.459) [-2814.762] (-2814.778) (-2826.006) * (-2817.161) (-2813.588) [-2819.111] (-2814.584) -- 0:07:50 93000 -- (-2819.112) [-2817.912] (-2814.512) (-2814.954) * [-2814.118] (-2819.425) (-2822.936) (-2823.756) -- 0:07:48 93500 -- [-2809.073] (-2820.776) (-2812.640) (-2812.106) * [-2825.345] (-2816.547) (-2820.132) (-2821.897) -- 0:07:55 94000 -- (-2818.888) (-2806.924) [-2812.420] (-2818.902) * (-2822.893) (-2807.269) [-2817.844] (-2813.373) -- 0:07:52 94500 -- [-2811.417] (-2812.199) (-2812.857) (-2816.854) * (-2811.711) (-2808.552) [-2806.858] (-2820.224) -- 0:07:49 95000 -- (-2810.457) (-2819.919) (-2817.677) [-2809.563] * (-2812.907) [-2813.787] (-2815.827) (-2817.012) -- 0:07:46 Average standard deviation of split frequencies: 0.008184 95500 -- [-2815.147] (-2820.011) (-2814.119) (-2818.032) * [-2812.979] (-2813.730) (-2818.201) (-2820.914) -- 0:07:53 96000 -- (-2815.786) [-2820.964] (-2810.518) (-2820.106) * (-2820.891) (-2814.458) [-2824.048] (-2817.943) -- 0:07:50 96500 -- (-2815.722) (-2819.174) [-2815.061] (-2821.025) * [-2820.884] (-2817.597) (-2812.431) (-2814.816) -- 0:07:48 97000 -- (-2820.877) [-2816.262] (-2824.825) (-2819.683) * [-2819.989] (-2817.809) (-2819.993) (-2828.998) -- 0:07:45 97500 -- (-2825.229) [-2823.085] (-2817.778) (-2814.226) * (-2818.244) (-2819.161) [-2813.572] (-2820.939) -- 0:07:52 98000 -- (-2825.135) [-2814.046] (-2815.036) (-2820.314) * [-2818.626] (-2822.020) (-2825.635) (-2827.593) -- 0:07:49 98500 -- (-2819.205) (-2816.496) [-2818.758] (-2819.226) * (-2812.589) [-2811.319] (-2826.015) (-2812.662) -- 0:07:46 99000 -- (-2821.267) (-2814.138) [-2816.697] (-2829.138) * (-2817.734) (-2817.125) (-2823.886) [-2817.072] -- 0:07:44 99500 -- [-2814.018] (-2820.797) (-2827.609) (-2834.903) * (-2816.870) (-2819.106) [-2812.959] (-2817.529) -- 0:07:50 100000 -- (-2814.995) (-2832.061) (-2813.374) [-2812.390] * (-2816.993) (-2826.884) [-2816.138] (-2815.260) -- 0:07:47 Average standard deviation of split frequencies: 0.007805 100500 -- (-2823.725) [-2819.397] (-2813.948) (-2819.239) * (-2825.206) (-2818.638) [-2815.489] (-2812.287) -- 0:07:45 101000 -- (-2815.821) (-2824.990) [-2810.015] (-2814.132) * (-2819.815) (-2811.579) (-2818.855) [-2817.471] -- 0:07:42 101500 -- [-2813.960] (-2823.582) (-2815.012) (-2811.984) * (-2816.891) [-2810.309] (-2816.023) (-2818.761) -- 0:07:49 102000 -- (-2816.896) [-2818.276] (-2815.298) (-2825.411) * (-2815.060) (-2813.655) (-2818.931) [-2813.798] -- 0:07:46 102500 -- (-2824.237) (-2821.307) [-2812.640] (-2814.514) * (-2814.657) [-2811.140] (-2813.106) (-2814.838) -- 0:07:44 103000 -- (-2821.675) (-2823.524) [-2814.755] (-2816.521) * (-2813.963) [-2808.693] (-2818.932) (-2811.952) -- 0:07:41 103500 -- (-2814.876) [-2821.372] (-2820.127) (-2814.836) * (-2821.193) (-2826.377) (-2820.800) [-2819.402] -- 0:07:47 104000 -- (-2820.665) (-2809.649) (-2820.056) [-2815.763] * [-2813.027] (-2820.597) (-2819.288) (-2814.661) -- 0:07:45 104500 -- (-2819.295) [-2818.145] (-2828.452) (-2814.220) * (-2813.415) (-2823.167) (-2827.144) [-2813.182] -- 0:07:42 105000 -- (-2827.174) (-2823.002) (-2821.433) [-2816.261] * (-2815.788) (-2812.950) [-2822.885] (-2810.306) -- 0:07:40 Average standard deviation of split frequencies: 0.008400 105500 -- (-2812.587) [-2816.582] (-2821.821) (-2813.292) * (-2819.385) [-2810.970] (-2823.881) (-2806.961) -- 0:07:46 106000 -- (-2827.479) [-2821.101] (-2822.393) (-2815.386) * [-2815.224] (-2822.370) (-2812.751) (-2827.262) -- 0:07:43 106500 -- (-2812.030) [-2823.600] (-2827.954) (-2815.988) * [-2814.286] (-2813.609) (-2824.384) (-2818.842) -- 0:07:41 107000 -- (-2818.309) (-2809.581) (-2814.094) [-2818.609] * (-2818.663) (-2821.638) (-2814.643) [-2812.125] -- 0:07:47 107500 -- (-2817.312) (-2813.613) [-2815.976] (-2819.819) * (-2818.604) [-2812.852] (-2821.461) (-2820.214) -- 0:07:44 108000 -- (-2818.734) (-2816.606) [-2814.381] (-2822.011) * [-2814.421] (-2814.981) (-2817.324) (-2817.198) -- 0:07:42 108500 -- (-2807.213) [-2815.678] (-2809.373) (-2827.492) * [-2818.270] (-2812.762) (-2824.370) (-2811.674) -- 0:07:40 109000 -- (-2818.777) (-2810.983) [-2818.233] (-2829.266) * (-2814.299) (-2817.434) (-2818.174) [-2819.158] -- 0:07:45 109500 -- (-2823.591) (-2814.862) [-2821.078] (-2828.564) * [-2812.741] (-2816.789) (-2815.988) (-2816.694) -- 0:07:43 110000 -- (-2831.645) (-2812.673) [-2813.308] (-2819.450) * (-2816.448) (-2818.722) (-2829.247) [-2812.207] -- 0:07:41 Average standard deviation of split frequencies: 0.006626 110500 -- (-2810.159) (-2818.680) [-2806.082] (-2828.895) * [-2819.140] (-2815.880) (-2820.614) (-2813.271) -- 0:07:38 111000 -- (-2811.522) (-2808.698) (-2818.166) [-2811.606] * (-2821.019) (-2817.231) (-2815.764) [-2821.284] -- 0:07:44 111500 -- (-2824.295) (-2825.477) [-2816.428] (-2825.571) * (-2816.513) [-2817.450] (-2818.385) (-2820.018) -- 0:07:42 112000 -- (-2817.873) [-2817.055] (-2816.514) (-2817.815) * (-2817.961) (-2820.321) [-2815.856] (-2809.288) -- 0:07:39 112500 -- (-2813.848) [-2816.020] (-2815.261) (-2812.828) * (-2820.025) [-2809.239] (-2819.193) (-2817.030) -- 0:07:37 113000 -- [-2820.555] (-2817.209) (-2811.426) (-2814.550) * (-2819.722) (-2822.438) [-2813.953] (-2813.321) -- 0:07:43 113500 -- (-2820.022) (-2818.941) [-2813.479] (-2821.301) * [-2807.470] (-2817.891) (-2816.710) (-2829.059) -- 0:07:40 114000 -- (-2813.930) [-2813.690] (-2812.971) (-2816.937) * (-2817.051) (-2811.262) [-2815.804] (-2816.180) -- 0:07:38 114500 -- (-2820.511) (-2818.998) (-2810.591) [-2827.176] * (-2812.746) (-2817.141) [-2821.650] (-2815.556) -- 0:07:36 115000 -- (-2816.922) [-2810.303] (-2816.930) (-2817.532) * (-2817.404) [-2813.572] (-2825.303) (-2822.298) -- 0:07:41 Average standard deviation of split frequencies: 0.005418 115500 -- (-2814.792) (-2821.352) (-2816.098) [-2818.487] * (-2819.516) (-2817.081) [-2809.016] (-2821.529) -- 0:07:39 116000 -- (-2817.122) (-2820.515) (-2813.621) [-2813.731] * (-2814.803) (-2815.552) [-2816.513] (-2824.160) -- 0:07:37 116500 -- (-2820.216) [-2811.692] (-2819.226) (-2817.173) * (-2818.602) (-2816.683) [-2815.938] (-2820.731) -- 0:07:35 117000 -- [-2812.183] (-2825.593) (-2817.094) (-2811.185) * (-2819.518) (-2823.296) (-2815.044) [-2822.562] -- 0:07:40 117500 -- (-2812.933) [-2811.738] (-2822.498) (-2819.851) * (-2810.647) (-2816.518) [-2815.473] (-2820.966) -- 0:07:38 118000 -- (-2817.036) [-2813.505] (-2815.986) (-2819.604) * (-2815.208) (-2824.218) [-2817.097] (-2815.651) -- 0:07:35 118500 -- (-2819.742) (-2818.418) (-2819.712) [-2815.775] * (-2823.400) (-2813.673) (-2817.144) [-2823.106] -- 0:07:33 119000 -- (-2817.864) (-2825.011) [-2813.507] (-2816.678) * [-2810.698] (-2820.349) (-2817.297) (-2832.502) -- 0:07:39 119500 -- [-2822.719] (-2826.707) (-2820.021) (-2817.498) * (-2814.612) (-2817.998) (-2822.400) [-2823.487] -- 0:07:36 120000 -- (-2820.078) [-2812.590] (-2823.549) (-2815.837) * (-2811.834) [-2809.592] (-2823.622) (-2812.801) -- 0:07:34 Average standard deviation of split frequencies: 0.006077 120500 -- (-2819.424) (-2822.908) (-2821.653) [-2817.304] * (-2818.171) (-2812.428) [-2820.817] (-2810.859) -- 0:07:32 121000 -- [-2808.382] (-2807.290) (-2824.482) (-2811.847) * (-2825.073) (-2815.044) [-2816.965] (-2821.241) -- 0:07:37 121500 -- (-2812.911) [-2812.692] (-2820.438) (-2821.506) * [-2812.312] (-2824.030) (-2836.453) (-2819.300) -- 0:07:35 122000 -- (-2810.633) [-2815.289] (-2817.391) (-2823.896) * (-2815.330) (-2823.258) (-2818.593) [-2817.703] -- 0:07:33 122500 -- [-2812.145] (-2817.467) (-2813.276) (-2824.694) * (-2817.593) (-2826.518) [-2810.538] (-2813.844) -- 0:07:31 123000 -- (-2821.764) (-2829.560) [-2814.102] (-2822.600) * [-2812.308] (-2825.119) (-2820.577) (-2814.813) -- 0:07:36 123500 -- (-2822.372) (-2813.341) [-2818.985] (-2815.692) * (-2819.683) (-2832.396) [-2822.436] (-2813.262) -- 0:07:34 124000 -- (-2817.645) [-2813.930] (-2816.404) (-2832.339) * (-2819.176) (-2825.803) (-2830.559) [-2816.266] -- 0:07:32 124500 -- (-2814.511) (-2816.281) [-2813.875] (-2821.378) * (-2817.652) (-2817.894) [-2806.048] (-2813.090) -- 0:07:37 125000 -- [-2823.165] (-2820.677) (-2812.560) (-2819.955) * (-2816.835) (-2813.453) (-2815.338) [-2818.170] -- 0:07:34 Average standard deviation of split frequencies: 0.007898 125500 -- (-2818.805) [-2810.824] (-2818.733) (-2819.837) * (-2820.012) (-2813.059) [-2810.586] (-2816.816) -- 0:07:32 126000 -- (-2817.961) [-2820.346] (-2814.358) (-2819.500) * (-2823.460) (-2818.687) (-2811.103) [-2814.681] -- 0:07:30 126500 -- [-2814.835] (-2816.386) (-2816.141) (-2816.296) * (-2822.917) (-2817.687) [-2811.835] (-2827.902) -- 0:07:35 127000 -- [-2808.313] (-2823.813) (-2819.245) (-2812.454) * (-2814.808) [-2813.542] (-2811.177) (-2816.921) -- 0:07:33 127500 -- [-2821.601] (-2822.137) (-2810.596) (-2818.760) * (-2819.001) (-2815.229) [-2814.676] (-2810.629) -- 0:07:31 128000 -- (-2830.337) (-2822.190) [-2817.401] (-2809.230) * (-2818.099) (-2813.413) (-2811.968) [-2809.294] -- 0:07:29 128500 -- (-2815.005) [-2814.734] (-2822.946) (-2814.475) * (-2812.795) (-2817.517) (-2817.239) [-2823.203] -- 0:07:34 129000 -- [-2812.468] (-2822.133) (-2816.183) (-2818.915) * (-2810.894) [-2808.628] (-2821.692) (-2811.619) -- 0:07:32 129500 -- (-2821.912) [-2818.202] (-2819.306) (-2819.164) * (-2807.980) (-2816.989) [-2813.483] (-2824.850) -- 0:07:30 130000 -- (-2817.150) (-2828.667) [-2816.166] (-2812.063) * (-2813.279) [-2817.694] (-2808.398) (-2820.447) -- 0:07:28 Average standard deviation of split frequencies: 0.008819 130500 -- (-2817.325) (-2828.045) (-2827.938) [-2816.107] * [-2813.721] (-2813.419) (-2820.943) (-2815.207) -- 0:07:33 131000 -- (-2822.403) [-2818.880] (-2819.025) (-2809.998) * [-2825.136] (-2818.531) (-2815.385) (-2819.168) -- 0:07:31 131500 -- (-2819.800) (-2823.805) [-2814.232] (-2808.329) * [-2819.457] (-2815.756) (-2833.886) (-2817.436) -- 0:07:29 132000 -- (-2814.345) (-2815.204) [-2818.585] (-2816.112) * (-2821.462) (-2820.695) (-2820.625) [-2813.437] -- 0:07:27 132500 -- (-2814.768) (-2817.765) (-2817.655) [-2814.745] * [-2820.759] (-2820.000) (-2832.149) (-2818.743) -- 0:07:31 133000 -- (-2813.637) (-2816.611) [-2817.223] (-2823.920) * (-2820.546) (-2819.454) (-2821.894) [-2821.591] -- 0:07:29 133500 -- [-2805.984] (-2823.135) (-2820.896) (-2812.506) * [-2812.410] (-2814.615) (-2815.723) (-2813.761) -- 0:07:27 134000 -- (-2814.204) [-2806.931] (-2826.853) (-2821.712) * [-2817.169] (-2809.562) (-2819.167) (-2816.063) -- 0:07:25 134500 -- [-2819.092] (-2814.616) (-2826.059) (-2827.519) * (-2827.195) [-2811.285] (-2822.161) (-2814.724) -- 0:07:30 135000 -- (-2818.995) [-2813.660] (-2816.179) (-2817.500) * [-2817.567] (-2814.159) (-2818.523) (-2813.396) -- 0:07:28 Average standard deviation of split frequencies: 0.009628 135500 -- (-2823.171) (-2812.674) [-2811.455] (-2823.681) * (-2817.699) (-2821.597) [-2810.735] (-2814.044) -- 0:07:26 136000 -- (-2825.898) [-2814.986] (-2816.592) (-2811.219) * (-2824.257) (-2815.886) [-2814.285] (-2823.728) -- 0:07:24 136500 -- (-2812.093) (-2829.171) (-2820.567) [-2818.349] * (-2825.354) (-2819.879) (-2817.207) [-2811.666] -- 0:07:29 137000 -- (-2812.608) (-2819.781) (-2819.401) [-2808.709] * (-2815.509) (-2821.269) (-2811.813) [-2811.919] -- 0:07:27 137500 -- (-2811.985) [-2815.075] (-2840.670) (-2805.585) * (-2808.526) (-2817.715) [-2819.426] (-2823.787) -- 0:07:25 138000 -- [-2818.372] (-2809.587) (-2826.172) (-2821.128) * [-2817.223] (-2821.723) (-2807.271) (-2816.922) -- 0:07:23 138500 -- (-2820.123) [-2809.801] (-2816.855) (-2816.063) * (-2823.538) (-2810.730) [-2811.940] (-2822.495) -- 0:07:27 139000 -- (-2817.053) [-2814.815] (-2818.566) (-2825.500) * (-2817.989) [-2812.007] (-2818.077) (-2819.790) -- 0:07:25 139500 -- [-2815.056] (-2818.882) (-2818.736) (-2826.276) * (-2817.886) (-2812.671) (-2817.246) [-2818.753] -- 0:07:24 140000 -- (-2810.193) (-2819.602) (-2811.955) [-2819.975] * [-2817.307] (-2808.705) (-2820.488) (-2812.481) -- 0:07:22 Average standard deviation of split frequencies: 0.012660 140500 -- (-2817.228) [-2815.725] (-2821.090) (-2819.856) * (-2828.613) (-2816.944) (-2812.260) [-2808.453] -- 0:07:26 141000 -- (-2816.145) (-2817.446) (-2817.881) [-2814.755] * (-2820.860) (-2808.811) [-2818.314] (-2814.828) -- 0:07:24 141500 -- (-2819.603) (-2832.564) (-2815.746) [-2810.072] * [-2812.387] (-2819.370) (-2819.462) (-2818.319) -- 0:07:22 142000 -- (-2823.451) (-2837.562) [-2818.139] (-2807.758) * (-2820.639) (-2820.324) (-2813.952) [-2818.015] -- 0:07:27 142500 -- (-2827.977) (-2812.779) (-2819.064) [-2811.952] * [-2810.012] (-2805.191) (-2818.109) (-2807.986) -- 0:07:25 143000 -- [-2818.631] (-2821.771) (-2825.311) (-2807.136) * [-2816.170] (-2809.452) (-2818.020) (-2815.111) -- 0:07:23 143500 -- (-2819.344) [-2817.942] (-2824.761) (-2811.007) * (-2819.928) (-2812.986) (-2812.024) [-2819.571] -- 0:07:21 144000 -- (-2810.978) (-2825.575) [-2814.121] (-2820.083) * (-2825.138) (-2818.162) (-2819.341) [-2810.141] -- 0:07:25 144500 -- (-2823.309) [-2813.919] (-2817.729) (-2828.719) * (-2813.253) (-2818.999) (-2816.787) [-2825.595] -- 0:07:24 145000 -- (-2820.030) (-2815.764) [-2814.196] (-2826.883) * (-2814.103) (-2818.792) [-2817.494] (-2825.223) -- 0:07:22 Average standard deviation of split frequencies: 0.012556 145500 -- [-2816.879] (-2822.493) (-2812.647) (-2820.797) * (-2818.131) (-2826.039) [-2818.512] (-2815.254) -- 0:07:20 146000 -- (-2824.430) (-2826.774) (-2814.375) [-2817.479] * (-2811.397) (-2810.917) (-2822.614) [-2817.700] -- 0:07:24 146500 -- [-2813.009] (-2816.711) (-2815.966) (-2824.208) * (-2808.038) (-2822.997) (-2816.056) [-2816.534] -- 0:07:22 147000 -- (-2811.858) (-2811.362) [-2811.181] (-2830.120) * (-2825.787) (-2814.531) [-2810.684] (-2815.357) -- 0:07:21 147500 -- (-2817.438) (-2815.646) [-2812.510] (-2811.952) * (-2818.147) (-2821.695) [-2814.420] (-2813.994) -- 0:07:19 148000 -- [-2813.164] (-2823.482) (-2818.286) (-2810.532) * (-2824.322) [-2815.062] (-2817.571) (-2813.763) -- 0:07:23 148500 -- (-2822.420) (-2821.686) [-2807.187] (-2819.602) * (-2824.295) (-2815.831) (-2817.068) [-2813.576] -- 0:07:21 149000 -- (-2820.580) (-2824.030) [-2808.772] (-2816.953) * (-2814.890) (-2821.161) (-2827.019) [-2819.675] -- 0:07:19 149500 -- (-2821.266) (-2824.094) [-2809.834] (-2812.039) * [-2806.638] (-2811.917) (-2821.463) (-2813.443) -- 0:07:18 150000 -- (-2816.747) (-2817.064) [-2809.893] (-2823.514) * (-2815.494) (-2813.197) (-2831.738) [-2811.546] -- 0:07:21 Average standard deviation of split frequencies: 0.011125 150500 -- (-2819.243) (-2809.955) [-2816.723] (-2823.157) * (-2810.366) (-2813.223) (-2823.549) [-2811.322] -- 0:07:20 151000 -- (-2820.198) [-2811.742] (-2817.185) (-2824.671) * (-2813.346) (-2812.178) [-2828.878] (-2812.356) -- 0:07:18 151500 -- (-2823.773) (-2817.564) (-2821.942) [-2820.082] * (-2814.590) (-2821.202) (-2821.124) [-2810.029] -- 0:07:16 152000 -- (-2810.922) [-2818.087] (-2814.793) (-2824.446) * (-2814.395) (-2821.456) [-2822.923] (-2822.522) -- 0:07:20 152500 -- (-2826.216) (-2821.701) [-2813.782] (-2823.032) * (-2813.969) (-2816.234) [-2812.398] (-2819.258) -- 0:07:19 153000 -- (-2819.560) (-2823.566) (-2819.280) [-2813.933] * (-2810.051) (-2815.472) (-2810.725) [-2815.642] -- 0:07:17 153500 -- [-2813.832] (-2814.340) (-2811.855) (-2830.759) * (-2816.889) (-2819.547) [-2817.257] (-2816.922) -- 0:07:15 154000 -- (-2812.719) (-2820.176) (-2820.198) [-2814.599] * (-2815.403) (-2814.782) [-2821.045] (-2819.806) -- 0:07:19 154500 -- (-2819.384) (-2816.047) [-2810.855] (-2823.848) * [-2808.828] (-2830.933) (-2811.710) (-2817.510) -- 0:07:17 155000 -- (-2820.506) [-2819.358] (-2822.536) (-2821.286) * (-2810.177) (-2818.418) [-2811.637] (-2816.371) -- 0:07:16 Average standard deviation of split frequencies: 0.008730 155500 -- (-2814.395) [-2810.922] (-2816.807) (-2810.119) * (-2812.392) [-2812.462] (-2817.558) (-2816.135) -- 0:07:19 156000 -- (-2827.459) (-2825.965) [-2819.456] (-2824.614) * (-2818.283) (-2810.617) [-2812.908] (-2825.558) -- 0:07:18 156500 -- (-2813.551) (-2819.519) (-2819.156) [-2821.766] * (-2817.995) (-2816.006) (-2822.685) [-2815.670] -- 0:07:16 157000 -- (-2815.389) [-2807.561] (-2810.715) (-2820.251) * (-2818.298) (-2811.251) (-2820.712) [-2813.873] -- 0:07:14 157500 -- (-2821.864) (-2817.756) (-2817.487) [-2815.542] * (-2834.505) (-2824.037) (-2826.321) [-2818.092] -- 0:07:18 158000 -- (-2812.132) (-2819.003) (-2823.477) [-2815.314] * (-2827.273) (-2818.836) (-2810.174) [-2811.111] -- 0:07:16 158500 -- (-2814.479) (-2823.989) (-2818.231) [-2816.274] * [-2814.483] (-2825.372) (-2818.583) (-2815.684) -- 0:07:15 159000 -- [-2810.737] (-2818.543) (-2818.778) (-2824.283) * (-2828.365) [-2809.088] (-2820.792) (-2821.571) -- 0:07:13 159500 -- (-2824.627) [-2811.496] (-2815.617) (-2813.236) * [-2813.245] (-2813.320) (-2816.858) (-2819.115) -- 0:07:17 160000 -- (-2809.426) [-2818.824] (-2812.891) (-2823.971) * (-2817.966) [-2819.495] (-2813.546) (-2830.809) -- 0:07:15 Average standard deviation of split frequencies: 0.006194 160500 -- (-2821.286) [-2811.146] (-2820.557) (-2824.646) * (-2810.150) [-2815.223] (-2817.764) (-2812.862) -- 0:07:14 161000 -- [-2811.799] (-2817.292) (-2814.874) (-2825.940) * (-2823.681) (-2810.059) (-2821.444) [-2815.427] -- 0:07:12 161500 -- (-2819.541) [-2811.751] (-2814.801) (-2823.228) * [-2810.982] (-2810.987) (-2810.183) (-2817.971) -- 0:07:16 162000 -- (-2829.363) (-2812.924) [-2827.429] (-2823.805) * [-2813.128] (-2817.884) (-2812.212) (-2810.214) -- 0:07:14 162500 -- (-2821.329) (-2814.499) (-2824.273) [-2817.544] * [-2817.379] (-2821.729) (-2818.300) (-2819.263) -- 0:07:12 163000 -- (-2821.291) (-2816.664) (-2813.816) [-2811.342] * [-2813.202] (-2813.716) (-2823.959) (-2826.717) -- 0:07:11 163500 -- (-2833.964) (-2816.670) (-2820.294) [-2813.076] * (-2810.961) (-2817.029) (-2825.259) [-2818.936] -- 0:07:14 164000 -- (-2825.167) (-2816.664) [-2816.710] (-2817.945) * (-2819.243) (-2821.078) [-2807.605] (-2809.322) -- 0:07:13 164500 -- (-2821.786) [-2815.951] (-2816.180) (-2818.287) * (-2815.751) (-2816.054) (-2831.280) [-2809.443] -- 0:07:11 165000 -- [-2816.903] (-2817.022) (-2817.966) (-2814.299) * [-2815.709] (-2818.125) (-2815.444) (-2808.036) -- 0:07:10 Average standard deviation of split frequencies: 0.003786 165500 -- [-2820.265] (-2814.678) (-2818.867) (-2818.933) * [-2810.726] (-2813.188) (-2824.475) (-2819.457) -- 0:07:13 166000 -- [-2817.755] (-2829.394) (-2820.874) (-2809.002) * (-2821.411) (-2812.187) [-2817.132] (-2820.986) -- 0:07:12 166500 -- (-2827.863) (-2823.872) [-2822.721] (-2815.546) * (-2817.403) (-2813.392) [-2814.436] (-2823.200) -- 0:07:10 167000 -- (-2822.936) [-2819.085] (-2824.790) (-2816.188) * (-2819.143) (-2821.570) [-2811.837] (-2819.415) -- 0:07:08 167500 -- (-2814.079) [-2811.809] (-2815.974) (-2815.654) * [-2816.250] (-2810.294) (-2815.664) (-2821.941) -- 0:07:12 168000 -- [-2820.974] (-2817.461) (-2815.279) (-2819.944) * (-2814.083) [-2821.399] (-2804.088) (-2820.381) -- 0:07:10 168500 -- (-2813.153) (-2819.457) [-2812.540] (-2820.140) * (-2814.773) (-2810.254) [-2811.956] (-2819.395) -- 0:07:09 169000 -- (-2811.327) (-2822.672) [-2813.366] (-2821.940) * (-2813.759) (-2820.860) [-2810.809] (-2820.291) -- 0:07:07 169500 -- (-2812.418) (-2811.427) [-2811.366] (-2828.977) * (-2812.072) (-2815.002) [-2813.294] (-2813.244) -- 0:07:11 170000 -- (-2824.846) (-2812.673) [-2815.635] (-2834.068) * [-2815.305] (-2822.046) (-2811.644) (-2819.629) -- 0:07:09 Average standard deviation of split frequencies: 0.003990 170500 -- (-2814.058) (-2824.661) (-2820.997) [-2810.994] * (-2825.693) (-2822.847) [-2811.916] (-2816.593) -- 0:07:08 171000 -- [-2815.368] (-2818.722) (-2815.335) (-2820.089) * (-2831.868) (-2817.932) [-2814.828] (-2816.016) -- 0:07:06 171500 -- [-2816.233] (-2827.035) (-2811.033) (-2813.094) * (-2826.326) (-2819.523) [-2815.857] (-2815.513) -- 0:07:09 172000 -- [-2822.363] (-2823.785) (-2822.643) (-2808.558) * (-2812.893) [-2818.772] (-2813.821) (-2819.279) -- 0:07:08 172500 -- (-2822.400) [-2813.641] (-2819.346) (-2810.121) * (-2820.345) (-2817.904) (-2819.767) [-2824.498] -- 0:07:06 173000 -- [-2817.030] (-2818.469) (-2813.984) (-2818.667) * (-2817.504) (-2815.293) [-2814.524] (-2821.385) -- 0:07:05 173500 -- (-2814.456) (-2814.653) (-2823.448) [-2818.134] * [-2813.299] (-2813.882) (-2810.571) (-2821.174) -- 0:07:08 174000 -- [-2812.897] (-2811.840) (-2813.833) (-2823.343) * (-2815.103) (-2826.538) [-2815.835] (-2816.517) -- 0:07:07 174500 -- (-2814.816) (-2820.689) (-2822.409) [-2818.006] * (-2817.144) [-2817.641] (-2814.893) (-2817.510) -- 0:07:05 175000 -- (-2814.796) (-2809.198) (-2820.447) [-2824.135] * [-2818.102] (-2813.488) (-2812.301) (-2818.630) -- 0:07:08 Average standard deviation of split frequencies: 0.005654 175500 -- [-2816.905] (-2817.588) (-2812.043) (-2815.067) * (-2821.235) [-2812.544] (-2821.859) (-2813.002) -- 0:07:07 176000 -- (-2814.469) (-2825.786) [-2814.551] (-2821.067) * (-2821.037) [-2812.988] (-2811.830) (-2813.744) -- 0:07:06 176500 -- (-2820.020) (-2824.262) (-2814.348) [-2823.885] * (-2820.665) (-2815.580) (-2818.250) [-2811.470] -- 0:07:04 177000 -- [-2810.601] (-2815.931) (-2824.689) (-2817.164) * (-2818.416) (-2815.784) [-2819.339] (-2812.613) -- 0:07:07 177500 -- (-2821.164) (-2817.882) [-2814.122] (-2809.893) * (-2818.156) (-2825.334) (-2815.217) [-2813.632] -- 0:07:06 178000 -- (-2822.404) (-2825.129) [-2815.224] (-2817.461) * (-2822.695) [-2815.741] (-2810.850) (-2818.183) -- 0:07:04 178500 -- [-2808.910] (-2821.392) (-2809.833) (-2813.742) * (-2812.831) (-2823.677) [-2808.632] (-2816.388) -- 0:07:03 179000 -- (-2817.160) (-2819.388) (-2820.428) [-2813.593] * (-2819.546) [-2817.635] (-2817.572) (-2829.690) -- 0:07:06 179500 -- (-2837.465) (-2819.281) (-2817.501) [-2814.212] * (-2811.071) [-2818.737] (-2818.771) (-2819.270) -- 0:07:05 180000 -- [-2815.483] (-2827.028) (-2819.689) (-2817.636) * (-2811.698) (-2819.999) [-2809.288] (-2821.511) -- 0:07:03 Average standard deviation of split frequencies: 0.005798 180500 -- [-2813.284] (-2820.366) (-2815.372) (-2818.956) * [-2811.968] (-2820.877) (-2813.087) (-2813.264) -- 0:07:02 181000 -- (-2816.010) [-2818.273] (-2815.155) (-2810.977) * (-2817.986) (-2817.944) [-2825.306] (-2818.695) -- 0:07:05 181500 -- (-2811.721) (-2813.166) [-2816.238] (-2820.323) * (-2810.784) [-2816.351] (-2812.609) (-2816.927) -- 0:07:03 182000 -- (-2822.220) (-2815.188) (-2828.234) [-2813.295] * [-2812.359] (-2824.734) (-2814.494) (-2819.328) -- 0:07:02 182500 -- [-2815.079] (-2813.684) (-2815.616) (-2813.974) * (-2819.139) [-2810.177] (-2817.099) (-2816.987) -- 0:07:01 183000 -- (-2810.765) (-2822.482) (-2822.178) [-2817.124] * (-2818.873) [-2814.404] (-2819.378) (-2817.909) -- 0:07:04 183500 -- (-2815.602) (-2821.567) (-2812.106) [-2816.109] * (-2815.310) (-2820.217) [-2809.987] (-2820.255) -- 0:07:02 184000 -- (-2821.987) (-2820.366) (-2817.439) [-2817.190] * (-2816.324) [-2825.043] (-2811.375) (-2820.376) -- 0:07:01 184500 -- [-2810.240] (-2817.713) (-2819.375) (-2814.804) * (-2819.019) (-2820.441) (-2834.643) [-2811.373] -- 0:06:59 185000 -- (-2816.118) (-2820.212) (-2821.275) [-2815.249] * [-2810.514] (-2824.674) (-2834.764) (-2815.996) -- 0:07:02 Average standard deviation of split frequencies: 0.004224 185500 -- (-2820.360) [-2811.020] (-2816.852) (-2815.750) * [-2817.941] (-2818.288) (-2823.516) (-2817.380) -- 0:07:01 186000 -- (-2815.671) (-2815.116) (-2818.570) [-2813.871] * (-2817.051) [-2812.977] (-2815.219) (-2818.690) -- 0:07:00 186500 -- (-2820.961) (-2815.777) (-2816.207) [-2815.657] * [-2815.351] (-2810.027) (-2819.739) (-2819.206) -- 0:06:58 187000 -- (-2816.225) [-2816.324] (-2822.198) (-2815.436) * (-2817.499) [-2816.686] (-2813.895) (-2814.310) -- 0:07:01 187500 -- (-2815.128) [-2809.208] (-2815.759) (-2819.524) * (-2831.716) (-2821.491) [-2812.314] (-2813.981) -- 0:07:00 188000 -- [-2810.586] (-2818.613) (-2815.167) (-2818.577) * (-2831.960) [-2819.155] (-2815.515) (-2814.166) -- 0:06:58 188500 -- (-2813.029) (-2811.436) [-2821.557] (-2816.906) * (-2818.744) (-2810.909) (-2819.834) [-2816.984] -- 0:06:57 189000 -- (-2817.880) (-2812.275) (-2818.495) [-2815.929] * (-2819.658) [-2812.571] (-2817.481) (-2814.323) -- 0:07:00 189500 -- [-2815.915] (-2820.691) (-2818.205) (-2813.482) * (-2828.236) (-2813.723) (-2815.286) [-2814.342] -- 0:06:59 190000 -- (-2813.710) (-2816.345) (-2815.438) [-2820.448] * (-2833.022) (-2816.890) [-2817.143] (-2816.669) -- 0:06:57 Average standard deviation of split frequencies: 0.003846 190500 -- (-2817.722) [-2816.027] (-2813.833) (-2818.487) * [-2815.197] (-2819.230) (-2820.135) (-2812.798) -- 0:07:00 191000 -- (-2819.048) (-2831.590) (-2813.989) [-2827.851] * (-2820.292) [-2813.051] (-2823.384) (-2809.420) -- 0:06:59 191500 -- (-2821.415) (-2820.669) [-2811.566] (-2821.393) * (-2817.553) [-2816.665] (-2813.959) (-2812.532) -- 0:06:57 192000 -- (-2813.739) (-2818.037) [-2814.622] (-2816.783) * [-2821.478] (-2814.757) (-2820.688) (-2819.573) -- 0:06:56 192500 -- [-2817.223] (-2811.334) (-2814.105) (-2814.884) * (-2815.433) (-2815.392) [-2821.968] (-2820.717) -- 0:06:59 193000 -- (-2833.737) (-2812.912) (-2822.653) [-2816.301] * (-2819.776) [-2810.456] (-2824.361) (-2814.711) -- 0:06:58 193500 -- [-2812.017] (-2816.238) (-2816.901) (-2811.414) * (-2814.775) [-2819.792] (-2828.223) (-2816.891) -- 0:06:56 194000 -- (-2818.223) (-2817.144) [-2825.592] (-2822.026) * [-2815.066] (-2817.369) (-2816.598) (-2811.815) -- 0:06:55 194500 -- (-2819.682) [-2813.398] (-2821.951) (-2820.195) * (-2817.488) (-2828.902) [-2818.490] (-2817.691) -- 0:06:58 195000 -- [-2812.998] (-2809.803) (-2826.420) (-2822.044) * (-2818.381) (-2819.733) (-2826.445) [-2812.843] -- 0:06:56 Average standard deviation of split frequencies: 0.005879 195500 -- (-2812.636) [-2813.638] (-2820.715) (-2820.442) * [-2811.264] (-2828.756) (-2830.385) (-2815.492) -- 0:06:55 196000 -- [-2814.028] (-2819.969) (-2812.784) (-2823.403) * (-2822.991) (-2827.729) [-2824.872] (-2814.199) -- 0:06:54 196500 -- (-2816.888) (-2816.969) [-2817.424] (-2810.379) * [-2820.688] (-2820.032) (-2821.081) (-2813.679) -- 0:06:57 197000 -- (-2818.441) [-2816.097] (-2819.436) (-2823.605) * (-2824.672) (-2815.884) [-2822.231] (-2819.544) -- 0:06:55 197500 -- (-2824.100) (-2814.004) [-2814.209] (-2823.648) * [-2815.500] (-2822.640) (-2821.473) (-2820.440) -- 0:06:54 198000 -- (-2814.803) (-2822.977) (-2825.042) [-2812.134] * (-2815.298) (-2825.023) (-2826.178) [-2810.882] -- 0:06:53 198500 -- (-2819.146) (-2810.835) (-2813.907) [-2816.759] * (-2818.196) (-2822.391) (-2827.523) [-2815.150] -- 0:06:55 199000 -- (-2814.824) (-2817.112) [-2819.086] (-2815.095) * [-2811.304] (-2837.607) (-2819.928) (-2812.100) -- 0:06:54 199500 -- (-2823.318) (-2819.698) (-2813.369) [-2816.560] * (-2812.563) (-2822.087) (-2816.830) [-2818.160] -- 0:06:53 200000 -- (-2829.486) [-2822.133] (-2832.397) (-2821.647) * (-2820.879) (-2817.683) [-2808.517] (-2813.397) -- 0:06:52 Average standard deviation of split frequencies: 0.006003 200500 -- (-2826.724) (-2830.135) [-2813.651] (-2811.889) * (-2817.025) [-2814.961] (-2820.902) (-2815.674) -- 0:06:54 201000 -- (-2825.279) (-2822.702) [-2820.977] (-2817.120) * (-2816.603) (-2816.201) (-2820.436) [-2816.286] -- 0:06:53 201500 -- (-2818.053) (-2821.051) [-2818.319] (-2818.463) * [-2812.184] (-2816.773) (-2818.727) (-2816.080) -- 0:06:52 202000 -- (-2814.366) (-2817.051) [-2812.555] (-2819.367) * (-2819.481) (-2820.332) [-2812.249] (-2814.472) -- 0:06:54 202500 -- (-2817.614) (-2818.672) (-2810.543) [-2817.122] * (-2820.448) [-2811.479] (-2818.829) (-2814.395) -- 0:06:53 203000 -- (-2819.080) (-2821.618) (-2812.462) [-2813.774] * (-2819.419) (-2830.370) [-2813.229] (-2811.388) -- 0:06:52 203500 -- (-2821.131) (-2820.894) [-2819.953] (-2817.304) * (-2819.912) [-2822.308] (-2820.062) (-2819.381) -- 0:06:50 204000 -- (-2822.677) (-2814.852) [-2814.875] (-2811.818) * (-2810.882) (-2826.172) (-2823.589) [-2818.599] -- 0:06:53 204500 -- [-2813.576] (-2817.665) (-2822.357) (-2810.223) * (-2819.790) [-2816.008] (-2823.584) (-2827.433) -- 0:06:52 205000 -- [-2807.654] (-2818.717) (-2813.769) (-2824.733) * (-2813.599) (-2814.744) [-2814.028] (-2820.577) -- 0:06:51 Average standard deviation of split frequencies: 0.007374 205500 -- (-2818.526) [-2820.463] (-2820.366) (-2809.732) * (-2819.415) [-2814.313] (-2817.747) (-2822.530) -- 0:06:49 206000 -- (-2818.299) [-2813.292] (-2811.117) (-2816.248) * (-2816.212) [-2804.699] (-2821.232) (-2816.603) -- 0:06:52 206500 -- [-2814.129] (-2820.533) (-2816.535) (-2821.970) * (-2818.961) [-2809.762] (-2811.939) (-2817.573) -- 0:06:51 207000 -- (-2817.613) (-2823.499) (-2814.695) [-2810.832] * [-2816.326] (-2815.885) (-2821.666) (-2815.605) -- 0:06:49 207500 -- (-2815.292) (-2821.308) (-2816.604) [-2817.849] * (-2826.647) [-2814.052] (-2813.740) (-2818.241) -- 0:06:48 208000 -- (-2824.670) (-2821.938) (-2819.967) [-2817.634] * (-2817.164) [-2815.703] (-2816.189) (-2810.041) -- 0:06:51 208500 -- (-2823.316) (-2818.155) (-2813.918) [-2809.004] * [-2810.637] (-2813.963) (-2820.165) (-2809.971) -- 0:06:49 209000 -- [-2814.045] (-2816.412) (-2812.613) (-2810.167) * [-2813.033] (-2815.107) (-2817.739) (-2814.469) -- 0:06:48 209500 -- (-2819.090) (-2822.658) [-2818.739] (-2812.123) * (-2815.460) (-2810.130) (-2816.161) [-2819.282] -- 0:06:47 210000 -- [-2819.947] (-2822.253) (-2817.599) (-2813.494) * [-2809.069] (-2827.689) (-2815.001) (-2817.099) -- 0:06:50 Average standard deviation of split frequencies: 0.006713 210500 -- (-2820.455) (-2809.373) (-2814.121) [-2818.785] * (-2820.410) (-2819.753) [-2814.155] (-2817.134) -- 0:06:48 211000 -- (-2821.409) [-2805.300] (-2817.856) (-2818.276) * [-2819.785] (-2814.596) (-2811.058) (-2818.515) -- 0:06:47 211500 -- (-2815.195) (-2812.122) (-2821.035) [-2812.854] * [-2822.501] (-2818.751) (-2817.526) (-2841.606) -- 0:06:50 212000 -- (-2823.473) [-2808.911] (-2822.110) (-2823.178) * (-2817.492) [-2815.571] (-2823.718) (-2826.382) -- 0:06:48 212500 -- (-2812.680) (-2813.638) [-2810.995] (-2819.219) * (-2819.915) [-2815.447] (-2817.792) (-2817.461) -- 0:06:47 213000 -- (-2811.410) (-2829.471) [-2812.862] (-2824.331) * [-2816.405] (-2809.988) (-2819.054) (-2817.236) -- 0:06:46 213500 -- (-2816.918) (-2823.940) [-2806.808] (-2823.297) * [-2813.995] (-2818.087) (-2815.754) (-2817.117) -- 0:06:48 214000 -- (-2817.475) (-2815.812) (-2817.979) [-2814.919] * (-2815.639) (-2816.605) [-2811.038] (-2819.830) -- 0:06:47 214500 -- (-2814.933) [-2814.061] (-2818.826) (-2821.041) * [-2814.990] (-2817.158) (-2818.146) (-2812.396) -- 0:06:46 215000 -- (-2814.987) (-2818.091) (-2814.293) [-2815.020] * [-2812.140] (-2823.747) (-2815.519) (-2821.487) -- 0:06:45 Average standard deviation of split frequencies: 0.007517 215500 -- (-2815.738) (-2818.580) [-2814.514] (-2823.815) * (-2814.175) (-2818.658) [-2813.684] (-2814.665) -- 0:06:47 216000 -- [-2810.413] (-2811.754) (-2821.521) (-2817.154) * (-2818.854) [-2822.028] (-2818.274) (-2811.085) -- 0:06:46 216500 -- (-2811.242) (-2812.619) (-2818.270) [-2814.097] * (-2815.490) (-2822.463) (-2824.875) [-2817.486] -- 0:06:45 217000 -- [-2818.418] (-2813.757) (-2817.463) (-2817.238) * (-2822.974) [-2819.261] (-2821.627) (-2816.942) -- 0:06:44 217500 -- [-2808.208] (-2813.516) (-2822.387) (-2808.236) * [-2813.804] (-2819.875) (-2809.834) (-2813.278) -- 0:06:46 218000 -- (-2818.328) [-2815.149] (-2817.118) (-2818.999) * (-2812.723) (-2807.001) [-2810.024] (-2828.264) -- 0:06:45 218500 -- (-2812.032) (-2810.600) [-2812.141] (-2821.649) * [-2810.853] (-2812.383) (-2815.954) (-2817.150) -- 0:06:44 219000 -- (-2816.186) [-2817.899] (-2810.664) (-2818.442) * (-2808.612) (-2816.653) (-2811.452) [-2813.853] -- 0:06:42 219500 -- (-2824.183) (-2810.580) [-2809.819] (-2816.615) * [-2816.606] (-2818.013) (-2816.412) (-2817.868) -- 0:06:45 220000 -- (-2818.839) (-2819.250) [-2821.048] (-2813.769) * (-2821.786) (-2809.935) (-2815.634) [-2817.246] -- 0:06:44 Average standard deviation of split frequencies: 0.007358 220500 -- (-2815.450) (-2822.251) (-2812.331) [-2814.735] * (-2824.887) [-2811.007] (-2819.314) (-2817.034) -- 0:06:43 221000 -- (-2826.714) (-2807.465) [-2811.485] (-2813.659) * (-2817.169) [-2816.105] (-2812.363) (-2820.572) -- 0:06:41 221500 -- (-2819.872) [-2817.670] (-2816.989) (-2814.713) * (-2815.308) (-2822.856) (-2823.068) [-2809.984] -- 0:06:44 222000 -- (-2819.383) (-2813.895) (-2821.879) [-2818.648] * (-2815.419) (-2823.582) [-2810.786] (-2810.658) -- 0:06:43 222500 -- [-2819.208] (-2823.073) (-2822.554) (-2820.071) * [-2812.902] (-2810.961) (-2816.345) (-2821.574) -- 0:06:41 223000 -- (-2815.005) (-2824.598) [-2824.490] (-2819.925) * (-2819.088) (-2813.795) [-2821.389] (-2824.387) -- 0:06:40 223500 -- [-2811.266] (-2822.340) (-2819.878) (-2813.700) * (-2816.736) (-2827.234) (-2817.285) [-2815.495] -- 0:06:43 224000 -- [-2812.047] (-2818.212) (-2825.294) (-2829.499) * [-2812.986] (-2817.664) (-2816.086) (-2812.784) -- 0:06:41 224500 -- (-2823.077) (-2825.304) (-2814.183) [-2822.131] * (-2824.814) [-2816.268] (-2810.439) (-2818.938) -- 0:06:40 225000 -- (-2813.872) (-2817.886) [-2811.927] (-2813.434) * (-2823.234) (-2821.941) (-2816.083) [-2811.863] -- 0:06:39 Average standard deviation of split frequencies: 0.007185 225500 -- [-2806.545] (-2817.641) (-2817.092) (-2816.248) * (-2813.969) (-2816.390) (-2822.983) [-2819.560] -- 0:06:41 226000 -- (-2819.531) (-2813.293) [-2807.277] (-2822.567) * [-2814.376] (-2824.690) (-2821.020) (-2814.312) -- 0:06:40 226500 -- (-2815.835) (-2816.223) [-2820.751] (-2816.275) * [-2812.362] (-2820.048) (-2814.578) (-2820.338) -- 0:06:39 227000 -- (-2808.326) (-2813.633) [-2813.630] (-2819.246) * (-2824.705) (-2815.797) (-2821.417) [-2822.408] -- 0:06:38 227500 -- (-2821.714) (-2811.479) [-2808.996] (-2816.704) * (-2815.501) (-2819.928) (-2816.334) [-2818.006] -- 0:06:40 228000 -- (-2820.165) (-2823.086) (-2813.863) [-2809.693] * [-2820.777] (-2812.644) (-2811.985) (-2820.087) -- 0:06:39 228500 -- (-2820.102) [-2818.131] (-2822.548) (-2819.055) * [-2814.451] (-2818.755) (-2822.669) (-2818.255) -- 0:06:38 229000 -- (-2821.370) (-2831.153) (-2826.274) [-2818.957] * (-2812.597) (-2819.829) (-2826.001) [-2819.446] -- 0:06:37 229500 -- (-2815.815) [-2817.696] (-2824.739) (-2809.485) * (-2817.676) (-2827.683) [-2816.494] (-2815.716) -- 0:06:39 230000 -- (-2813.330) [-2813.916] (-2828.674) (-2821.097) * (-2817.239) (-2815.088) (-2820.161) [-2812.586] -- 0:06:38 Average standard deviation of split frequencies: 0.008856 230500 -- [-2816.780] (-2818.993) (-2827.333) (-2815.718) * (-2831.867) [-2817.306] (-2814.021) (-2821.249) -- 0:06:37 231000 -- (-2820.063) [-2812.121] (-2809.946) (-2818.783) * (-2824.041) [-2816.960] (-2809.996) (-2814.321) -- 0:06:36 231500 -- (-2816.295) (-2814.778) [-2809.047] (-2831.631) * (-2822.288) [-2815.958] (-2808.747) (-2815.430) -- 0:06:38 232000 -- [-2811.168] (-2813.514) (-2816.084) (-2822.522) * (-2818.704) (-2820.046) (-2815.303) [-2815.154] -- 0:06:37 232500 -- (-2822.270) (-2820.737) (-2817.457) [-2825.372] * (-2816.080) (-2819.173) [-2808.250] (-2814.582) -- 0:06:36 233000 -- (-2816.037) (-2818.377) (-2815.606) [-2811.715] * (-2820.635) (-2816.885) [-2815.275] (-2816.739) -- 0:06:35 233500 -- [-2816.463] (-2816.452) (-2820.374) (-2818.303) * (-2813.837) [-2812.791] (-2813.725) (-2824.255) -- 0:06:37 234000 -- [-2818.969] (-2823.158) (-2820.507) (-2814.399) * (-2819.437) [-2818.269] (-2815.540) (-2823.249) -- 0:06:36 234500 -- (-2816.363) (-2816.304) [-2815.162] (-2823.129) * [-2807.553] (-2830.043) (-2820.050) (-2817.938) -- 0:06:34 235000 -- (-2818.928) (-2811.545) [-2819.513] (-2817.417) * (-2812.282) (-2816.465) [-2812.894] (-2816.094) -- 0:06:33 Average standard deviation of split frequencies: 0.008878 235500 -- (-2817.286) [-2809.703] (-2816.995) (-2815.253) * [-2815.720] (-2812.777) (-2824.856) (-2818.605) -- 0:06:36 236000 -- (-2815.804) [-2810.435] (-2815.974) (-2813.778) * [-2813.984] (-2813.269) (-2828.296) (-2816.494) -- 0:06:34 236500 -- (-2816.105) (-2815.011) [-2822.657] (-2815.058) * (-2813.010) [-2808.956] (-2820.378) (-2812.480) -- 0:06:33 237000 -- [-2813.125] (-2822.025) (-2816.811) (-2821.897) * [-2822.942] (-2813.203) (-2815.712) (-2828.336) -- 0:06:35 237500 -- [-2815.002] (-2837.380) (-2812.892) (-2813.045) * (-2814.710) [-2815.733] (-2813.632) (-2819.497) -- 0:06:34 238000 -- [-2810.153] (-2822.512) (-2809.116) (-2836.811) * (-2814.081) (-2811.005) [-2809.426] (-2816.545) -- 0:06:33 238500 -- [-2817.039] (-2815.886) (-2812.377) (-2820.862) * [-2813.825] (-2817.210) (-2815.346) (-2824.588) -- 0:06:32 239000 -- (-2821.831) (-2814.896) [-2805.752] (-2818.915) * (-2820.114) [-2810.017] (-2816.680) (-2813.954) -- 0:06:34 239500 -- (-2827.868) [-2822.721] (-2815.107) (-2812.797) * (-2822.874) [-2814.849] (-2815.510) (-2822.494) -- 0:06:33 240000 -- [-2818.360] (-2813.827) (-2818.414) (-2816.584) * (-2821.126) (-2819.466) (-2831.705) [-2814.500] -- 0:06:32 Average standard deviation of split frequencies: 0.006964 240500 -- (-2819.877) (-2822.731) (-2817.752) [-2826.312] * (-2811.685) [-2819.485] (-2834.870) (-2823.957) -- 0:06:34 241000 -- (-2819.267) [-2822.385] (-2812.918) (-2820.026) * (-2820.866) [-2813.277] (-2818.121) (-2809.994) -- 0:06:33 241500 -- (-2811.168) [-2813.111] (-2822.782) (-2819.880) * (-2818.787) [-2812.808] (-2820.262) (-2820.965) -- 0:06:32 242000 -- (-2815.140) (-2815.189) [-2822.904] (-2815.847) * [-2814.429] (-2810.779) (-2825.999) (-2827.265) -- 0:06:31 242500 -- (-2818.821) [-2810.445] (-2815.084) (-2818.282) * (-2828.031) (-2813.698) (-2811.725) [-2813.456] -- 0:06:33 243000 -- (-2823.872) (-2822.720) [-2810.408] (-2819.271) * (-2816.813) (-2819.588) [-2811.780] (-2824.342) -- 0:06:32 243500 -- (-2823.580) (-2820.005) (-2816.064) [-2818.346] * (-2826.921) [-2822.295] (-2816.910) (-2820.719) -- 0:06:31 244000 -- (-2810.109) (-2819.551) (-2810.217) [-2813.465] * (-2831.990) (-2817.839) [-2817.298] (-2821.565) -- 0:06:30 244500 -- (-2815.673) (-2811.125) (-2812.395) [-2812.678] * (-2823.088) (-2832.480) [-2818.513] (-2816.012) -- 0:06:32 245000 -- (-2811.980) (-2819.195) [-2814.413] (-2810.725) * (-2820.112) (-2815.627) (-2820.697) [-2813.529] -- 0:06:31 Average standard deviation of split frequencies: 0.007665 245500 -- (-2811.884) (-2816.531) [-2807.448] (-2811.065) * (-2821.725) [-2813.672] (-2823.428) (-2815.398) -- 0:06:30 246000 -- (-2819.443) (-2813.101) [-2816.483] (-2809.199) * (-2822.888) (-2814.248) [-2816.258] (-2813.860) -- 0:06:29 246500 -- (-2822.122) (-2817.354) (-2810.997) [-2814.164] * [-2820.263] (-2821.853) (-2821.462) (-2809.943) -- 0:06:31 247000 -- (-2812.303) [-2818.030] (-2815.119) (-2824.110) * (-2816.749) (-2820.375) (-2824.539) [-2815.789] -- 0:06:30 247500 -- (-2817.320) [-2808.059] (-2814.261) (-2815.199) * (-2819.167) [-2814.794] (-2820.767) (-2813.119) -- 0:06:29 248000 -- (-2812.603) [-2809.573] (-2817.103) (-2824.086) * (-2821.672) [-2812.076] (-2819.403) (-2816.764) -- 0:06:28 248500 -- (-2814.391) (-2816.884) [-2816.096] (-2820.777) * [-2814.529] (-2819.165) (-2815.404) (-2816.244) -- 0:06:30 249000 -- (-2812.666) [-2819.356] (-2814.073) (-2817.782) * [-2809.760] (-2817.664) (-2819.354) (-2821.719) -- 0:06:29 249500 -- (-2811.275) (-2820.268) (-2825.523) [-2814.069] * [-2807.321] (-2817.840) (-2816.485) (-2829.008) -- 0:06:28 250000 -- [-2811.072] (-2818.609) (-2818.009) (-2814.794) * (-2818.754) [-2809.892] (-2819.247) (-2822.713) -- 0:06:29 Average standard deviation of split frequencies: 0.006269 250500 -- [-2812.438] (-2825.344) (-2821.853) (-2817.579) * (-2809.085) [-2815.645] (-2818.251) (-2821.431) -- 0:06:28 251000 -- (-2814.981) (-2825.455) [-2816.399] (-2819.966) * (-2816.956) [-2810.057] (-2814.126) (-2816.565) -- 0:06:27 251500 -- (-2818.583) (-2813.130) (-2812.722) [-2819.086] * (-2817.905) (-2811.960) (-2821.282) [-2820.731] -- 0:06:26 252000 -- (-2812.073) (-2812.871) [-2814.605] (-2810.421) * (-2821.416) (-2815.716) (-2821.080) [-2817.466] -- 0:06:28 252500 -- (-2823.911) [-2818.414] (-2823.842) (-2812.196) * (-2820.199) (-2819.607) [-2822.876] (-2823.216) -- 0:06:27 253000 -- (-2809.957) (-2817.731) [-2823.484] (-2825.147) * (-2821.016) [-2814.545] (-2815.186) (-2821.668) -- 0:06:26 253500 -- (-2821.300) (-2817.249) [-2819.396] (-2820.700) * [-2814.273] (-2828.356) (-2816.335) (-2824.682) -- 0:06:28 254000 -- [-2809.553] (-2827.230) (-2818.548) (-2811.961) * (-2810.980) (-2822.388) [-2808.332] (-2818.913) -- 0:06:27 254500 -- (-2813.090) [-2818.558] (-2825.070) (-2813.210) * (-2819.787) (-2809.384) [-2808.565] (-2820.338) -- 0:06:26 255000 -- (-2816.226) (-2823.581) [-2818.575] (-2821.986) * (-2818.071) (-2818.478) (-2818.151) [-2813.685] -- 0:06:25 Average standard deviation of split frequencies: 0.007366 255500 -- (-2813.783) (-2815.641) (-2814.231) [-2814.063] * (-2815.634) [-2813.323] (-2820.928) (-2821.574) -- 0:06:27 256000 -- (-2821.671) (-2812.156) [-2817.113] (-2815.188) * (-2816.913) (-2808.806) [-2816.771] (-2811.199) -- 0:06:26 256500 -- [-2813.641] (-2816.836) (-2814.761) (-2812.662) * (-2824.440) (-2818.621) [-2814.023] (-2828.001) -- 0:06:25 257000 -- (-2816.093) (-2820.460) (-2817.668) [-2816.087] * (-2827.370) [-2814.568] (-2816.199) (-2811.716) -- 0:06:24 257500 -- [-2818.432] (-2820.342) (-2813.094) (-2811.562) * (-2833.966) (-2809.623) [-2813.304] (-2822.255) -- 0:06:26 258000 -- (-2815.884) (-2817.562) (-2815.517) [-2809.669] * (-2817.509) [-2811.933] (-2811.796) (-2818.930) -- 0:06:25 258500 -- (-2817.320) (-2817.738) (-2811.190) [-2808.638] * (-2833.508) (-2825.436) [-2813.578] (-2811.769) -- 0:06:24 259000 -- (-2813.467) [-2818.909] (-2812.968) (-2821.184) * (-2831.510) [-2821.318] (-2817.259) (-2809.433) -- 0:06:26 259500 -- (-2819.508) [-2815.214] (-2823.646) (-2815.441) * (-2823.453) [-2814.104] (-2810.436) (-2813.536) -- 0:06:25 260000 -- [-2826.145] (-2819.217) (-2814.223) (-2821.048) * (-2822.977) [-2811.123] (-2814.603) (-2818.349) -- 0:06:24 Average standard deviation of split frequencies: 0.007234 260500 -- (-2823.745) (-2815.673) [-2815.675] (-2813.998) * (-2819.671) [-2813.705] (-2816.484) (-2820.783) -- 0:06:23 261000 -- (-2827.906) [-2813.684] (-2817.253) (-2813.954) * (-2826.669) [-2816.307] (-2824.615) (-2820.997) -- 0:06:25 261500 -- (-2819.621) (-2809.727) [-2820.987] (-2811.182) * (-2818.396) (-2816.421) (-2816.857) [-2815.824] -- 0:06:24 262000 -- [-2817.512] (-2820.300) (-2814.122) (-2812.557) * [-2815.892] (-2816.953) (-2825.838) (-2819.131) -- 0:06:23 262500 -- (-2816.077) [-2807.506] (-2812.114) (-2812.831) * (-2812.591) (-2816.801) [-2814.431] (-2813.322) -- 0:06:22 263000 -- (-2817.539) (-2818.665) (-2813.867) [-2818.017] * [-2815.217] (-2820.383) (-2815.855) (-2812.974) -- 0:06:23 263500 -- (-2817.050) (-2810.255) (-2819.018) [-2816.045] * (-2822.209) (-2809.010) (-2820.178) [-2810.245] -- 0:06:22 264000 -- (-2823.416) (-2823.958) (-2817.644) [-2812.987] * (-2818.890) (-2811.252) [-2822.381] (-2811.897) -- 0:06:21 264500 -- (-2821.869) (-2819.936) [-2829.765] (-2818.800) * (-2824.549) (-2813.625) (-2817.236) [-2813.916] -- 0:06:20 265000 -- (-2817.699) (-2821.828) [-2815.427] (-2815.564) * (-2820.313) (-2819.966) (-2822.461) [-2821.633] -- 0:06:22 Average standard deviation of split frequencies: 0.007089 265500 -- (-2816.057) (-2816.488) [-2811.668] (-2817.657) * (-2814.916) [-2818.958] (-2818.248) (-2826.738) -- 0:06:21 266000 -- (-2812.888) (-2816.565) [-2810.109] (-2816.799) * [-2817.298] (-2815.604) (-2815.299) (-2828.193) -- 0:06:20 266500 -- (-2815.557) (-2821.981) (-2818.004) [-2809.554] * (-2818.909) (-2816.705) [-2821.120] (-2820.178) -- 0:06:19 267000 -- (-2828.194) (-2810.239) (-2811.201) [-2817.549] * (-2814.791) [-2817.793] (-2817.713) (-2814.745) -- 0:06:21 267500 -- (-2819.398) (-2817.880) (-2823.941) [-2813.143] * (-2816.687) (-2818.121) [-2808.101] (-2813.001) -- 0:06:20 268000 -- (-2814.302) (-2810.593) (-2832.786) [-2813.849] * (-2828.299) (-2820.883) [-2813.504] (-2814.541) -- 0:06:19 268500 -- (-2819.982) (-2817.560) [-2819.747] (-2821.282) * (-2817.475) (-2815.604) [-2813.855] (-2815.875) -- 0:06:18 269000 -- (-2825.008) [-2814.209] (-2828.839) (-2820.188) * (-2822.480) (-2819.953) [-2810.133] (-2824.651) -- 0:06:20 269500 -- [-2810.079] (-2821.838) (-2817.681) (-2812.853) * (-2816.128) (-2819.666) (-2817.468) [-2813.740] -- 0:06:19 270000 -- [-2816.774] (-2816.268) (-2814.981) (-2815.475) * (-2820.346) (-2826.751) [-2810.971] (-2807.389) -- 0:06:18 Average standard deviation of split frequencies: 0.009095 270500 -- (-2826.230) (-2817.652) (-2818.109) [-2815.472] * [-2822.505] (-2819.919) (-2812.136) (-2812.854) -- 0:06:20 271000 -- (-2819.901) (-2819.805) [-2809.257] (-2816.055) * (-2822.613) (-2823.419) (-2821.560) [-2810.518] -- 0:06:19 271500 -- (-2820.690) [-2818.053] (-2816.448) (-2819.649) * (-2817.229) (-2821.019) (-2815.554) [-2815.092] -- 0:06:18 272000 -- (-2819.987) [-2813.415] (-2820.097) (-2811.076) * (-2827.172) (-2810.011) [-2813.062] (-2827.872) -- 0:06:17 272500 -- [-2821.883] (-2816.397) (-2821.602) (-2817.863) * (-2821.355) (-2831.966) (-2819.140) [-2826.033] -- 0:06:19 273000 -- (-2823.957) [-2817.228] (-2815.905) (-2816.131) * [-2815.984] (-2818.392) (-2820.458) (-2820.051) -- 0:06:18 273500 -- (-2816.230) [-2813.297] (-2812.813) (-2817.047) * (-2819.912) (-2820.069) (-2815.488) [-2814.229] -- 0:06:17 274000 -- (-2819.600) [-2812.805] (-2825.243) (-2817.310) * (-2821.499) (-2824.208) (-2812.033) [-2810.502] -- 0:06:16 274500 -- [-2820.460] (-2805.986) (-2819.229) (-2816.186) * [-2809.665] (-2814.326) (-2809.555) (-2812.875) -- 0:06:17 275000 -- (-2811.943) (-2813.832) [-2810.823] (-2822.179) * (-2815.227) [-2818.159] (-2830.179) (-2818.224) -- 0:06:16 Average standard deviation of split frequencies: 0.010248 275500 -- [-2813.094] (-2815.468) (-2816.503) (-2810.447) * (-2813.230) (-2830.258) (-2810.305) [-2812.537] -- 0:06:16 276000 -- (-2819.734) (-2819.991) (-2815.070) [-2809.813] * (-2812.071) (-2822.439) [-2821.812] (-2811.141) -- 0:06:15 276500 -- (-2825.415) [-2814.423] (-2812.064) (-2815.552) * [-2809.083] (-2815.765) (-2811.322) (-2822.296) -- 0:06:16 277000 -- (-2821.506) [-2823.370] (-2819.246) (-2812.964) * (-2812.743) [-2807.847] (-2830.236) (-2826.894) -- 0:06:15 277500 -- (-2812.586) (-2828.423) (-2810.170) [-2811.686] * (-2813.527) [-2812.186] (-2823.612) (-2822.729) -- 0:06:14 278000 -- (-2823.022) [-2815.421] (-2809.526) (-2814.704) * [-2814.132] (-2810.645) (-2816.921) (-2818.042) -- 0:06:13 278500 -- (-2819.373) [-2820.858] (-2818.138) (-2820.527) * [-2813.341] (-2809.083) (-2813.927) (-2815.705) -- 0:06:15 279000 -- (-2822.336) (-2823.275) [-2811.979] (-2822.008) * (-2816.479) [-2811.795] (-2830.839) (-2838.303) -- 0:06:14 279500 -- [-2814.985] (-2816.482) (-2815.441) (-2825.098) * (-2823.759) (-2814.566) (-2819.868) [-2824.243] -- 0:06:13 280000 -- (-2813.867) (-2814.371) (-2820.825) [-2812.446] * (-2811.021) (-2824.393) (-2815.249) [-2812.550] -- 0:06:15 Average standard deviation of split frequencies: 0.010264 280500 -- (-2832.669) (-2814.088) (-2826.934) [-2808.325] * [-2814.077] (-2812.461) (-2824.156) (-2811.374) -- 0:06:14 281000 -- (-2811.366) (-2814.760) [-2813.699] (-2808.997) * (-2818.360) (-2823.066) (-2812.519) [-2815.924] -- 0:06:13 281500 -- (-2821.535) [-2810.730] (-2818.290) (-2812.166) * [-2814.602] (-2819.214) (-2823.046) (-2812.216) -- 0:06:12 282000 -- (-2831.700) (-2815.818) (-2810.809) [-2813.233] * (-2812.205) (-2817.786) (-2821.670) [-2815.950] -- 0:06:14 282500 -- (-2821.196) (-2813.179) (-2813.475) [-2821.107] * (-2827.130) [-2814.050] (-2819.354) (-2810.196) -- 0:06:13 283000 -- (-2822.979) (-2817.850) (-2812.313) [-2819.805] * [-2818.121] (-2821.949) (-2807.651) (-2817.033) -- 0:06:12 283500 -- (-2821.136) [-2813.000] (-2808.506) (-2821.483) * (-2811.279) (-2815.458) [-2813.043] (-2821.067) -- 0:06:11 284000 -- [-2812.015] (-2824.206) (-2818.548) (-2825.619) * (-2816.040) (-2817.886) (-2820.414) [-2812.287] -- 0:06:13 284500 -- (-2818.078) [-2815.174] (-2817.384) (-2822.404) * (-2831.902) [-2816.134] (-2816.201) (-2822.316) -- 0:06:12 285000 -- (-2817.330) [-2814.731] (-2815.504) (-2819.709) * (-2813.528) [-2815.710] (-2828.139) (-2819.891) -- 0:06:11 Average standard deviation of split frequencies: 0.009890 285500 -- [-2814.473] (-2810.583) (-2820.919) (-2820.809) * (-2815.391) (-2819.672) (-2822.663) [-2817.832] -- 0:06:12 286000 -- [-2807.435] (-2822.884) (-2810.028) (-2816.782) * [-2811.981] (-2823.399) (-2816.372) (-2816.686) -- 0:06:11 286500 -- (-2814.127) [-2809.858] (-2820.213) (-2811.454) * [-2816.692] (-2818.437) (-2819.965) (-2822.073) -- 0:06:11 287000 -- (-2812.844) (-2815.561) (-2821.583) [-2813.564] * (-2824.992) (-2820.815) (-2826.114) [-2816.884] -- 0:06:10 287500 -- [-2813.235] (-2816.124) (-2822.489) (-2816.174) * [-2811.497] (-2819.133) (-2817.121) (-2820.411) -- 0:06:11 288000 -- (-2813.011) (-2814.446) (-2822.177) [-2813.527] * (-2813.955) [-2816.086] (-2820.752) (-2822.653) -- 0:06:10 288500 -- (-2816.710) (-2817.694) [-2811.918] (-2816.644) * (-2833.883) [-2811.169] (-2823.603) (-2832.468) -- 0:06:09 289000 -- [-2813.430] (-2817.257) (-2815.894) (-2827.614) * [-2814.369] (-2825.010) (-2820.165) (-2820.840) -- 0:06:09 289500 -- [-2824.813] (-2813.916) (-2819.147) (-2822.915) * (-2822.630) (-2815.719) [-2816.337] (-2818.405) -- 0:06:10 290000 -- (-2828.513) [-2819.285] (-2816.247) (-2812.773) * (-2822.753) (-2820.683) (-2813.464) [-2818.932] -- 0:06:09 Average standard deviation of split frequencies: 0.009190 290500 -- (-2821.588) (-2815.830) [-2811.807] (-2818.615) * (-2818.755) [-2812.894] (-2812.216) (-2820.825) -- 0:06:08 291000 -- (-2816.951) (-2817.626) [-2812.990] (-2817.251) * (-2823.433) [-2818.754] (-2812.172) (-2824.347) -- 0:06:07 291500 -- (-2816.804) [-2812.651] (-2818.372) (-2816.117) * (-2811.540) [-2810.432] (-2810.995) (-2816.062) -- 0:06:09 292000 -- (-2820.412) (-2810.935) [-2826.899] (-2817.918) * (-2824.796) (-2815.976) [-2813.671] (-2818.336) -- 0:06:08 292500 -- (-2813.952) [-2812.810] (-2821.959) (-2805.371) * (-2812.502) (-2810.097) [-2811.534] (-2817.459) -- 0:06:07 293000 -- (-2814.437) [-2815.197] (-2817.132) (-2809.484) * (-2812.966) (-2821.884) (-2814.506) [-2813.711] -- 0:06:06 293500 -- (-2820.838) (-2812.573) (-2816.379) [-2810.738] * (-2815.141) [-2816.912] (-2811.287) (-2817.377) -- 0:06:08 294000 -- [-2812.906] (-2817.317) (-2822.776) (-2815.651) * [-2813.991] (-2823.198) (-2811.467) (-2820.926) -- 0:06:07 294500 -- (-2817.343) [-2814.285] (-2827.069) (-2814.537) * (-2815.827) (-2820.641) [-2820.308] (-2824.646) -- 0:06:06 295000 -- [-2814.799] (-2814.485) (-2824.419) (-2809.562) * (-2813.849) (-2817.341) [-2814.378] (-2822.664) -- 0:06:08 Average standard deviation of split frequencies: 0.009025 295500 -- (-2804.212) (-2817.277) (-2819.525) [-2820.917] * (-2819.912) [-2812.752] (-2820.721) (-2818.184) -- 0:06:07 296000 -- (-2813.148) [-2812.302] (-2815.297) (-2819.435) * (-2814.468) [-2808.497] (-2826.705) (-2826.968) -- 0:06:06 296500 -- [-2810.194] (-2819.403) (-2824.892) (-2820.433) * [-2819.516] (-2815.867) (-2815.657) (-2817.969) -- 0:06:05 297000 -- (-2818.214) [-2812.871] (-2815.108) (-2820.941) * (-2812.912) (-2820.157) (-2818.804) [-2821.009] -- 0:06:06 297500 -- [-2824.446] (-2816.189) (-2817.408) (-2819.083) * (-2813.727) (-2822.630) [-2808.189] (-2820.386) -- 0:06:06 298000 -- (-2826.919) (-2809.441) [-2817.448] (-2819.679) * [-2814.214] (-2819.548) (-2811.063) (-2832.239) -- 0:06:05 298500 -- (-2816.465) (-2820.861) (-2818.749) [-2814.479] * (-2819.756) [-2821.151] (-2818.911) (-2824.379) -- 0:06:04 299000 -- (-2809.579) (-2816.153) [-2814.288] (-2827.369) * (-2810.596) (-2815.164) (-2832.894) [-2820.192] -- 0:06:05 299500 -- (-2818.588) [-2815.073] (-2815.006) (-2814.726) * (-2815.214) [-2812.396] (-2815.211) (-2820.863) -- 0:06:04 300000 -- (-2813.991) [-2820.763] (-2813.965) (-2815.488) * (-2818.033) [-2807.773] (-2821.080) (-2823.816) -- 0:06:03 Average standard deviation of split frequencies: 0.008188 300500 -- (-2817.602) (-2811.298) (-2828.553) [-2818.303] * (-2822.305) (-2817.951) [-2810.816] (-2836.859) -- 0:06:05 301000 -- (-2818.404) [-2810.207] (-2817.957) (-2811.224) * (-2823.655) (-2813.113) [-2808.034] (-2817.404) -- 0:06:04 301500 -- [-2812.211] (-2820.062) (-2813.839) (-2815.565) * [-2812.258] (-2811.056) (-2819.480) (-2823.767) -- 0:06:03 302000 -- (-2819.561) [-2818.726] (-2811.269) (-2824.413) * [-2811.907] (-2811.817) (-2815.977) (-2823.955) -- 0:06:02 302500 -- (-2810.929) [-2821.568] (-2818.406) (-2824.302) * (-2808.836) (-2817.518) [-2816.758] (-2828.297) -- 0:06:04 303000 -- (-2817.066) (-2817.989) (-2815.282) [-2817.691] * (-2814.759) (-2817.736) (-2817.686) [-2816.049] -- 0:06:03 303500 -- (-2824.137) [-2816.111] (-2824.933) (-2818.538) * (-2828.394) (-2813.265) (-2818.151) [-2816.891] -- 0:06:02 304000 -- (-2823.951) [-2818.610] (-2816.684) (-2810.894) * (-2826.085) (-2820.045) [-2823.909] (-2821.319) -- 0:06:04 304500 -- (-2823.661) (-2817.139) (-2813.269) [-2819.116] * (-2808.479) [-2822.658] (-2824.794) (-2813.829) -- 0:06:03 305000 -- (-2830.727) (-2813.399) (-2817.825) [-2819.469] * (-2820.635) [-2815.255] (-2810.953) (-2825.373) -- 0:06:02 Average standard deviation of split frequencies: 0.007703 305500 -- (-2827.356) (-2817.807) [-2811.597] (-2819.930) * (-2826.961) (-2821.444) [-2807.147] (-2822.018) -- 0:06:01 306000 -- (-2829.281) (-2817.939) [-2817.587] (-2814.297) * (-2818.641) (-2816.091) [-2810.099] (-2821.778) -- 0:06:02 306500 -- [-2816.244] (-2820.138) (-2813.574) (-2815.905) * (-2818.773) (-2814.264) [-2816.866] (-2826.320) -- 0:06:02 307000 -- (-2813.602) (-2823.381) (-2821.784) [-2817.435] * (-2819.162) (-2814.248) [-2820.498] (-2819.496) -- 0:06:01 307500 -- [-2814.604] (-2823.607) (-2823.041) (-2812.699) * [-2817.794] (-2824.087) (-2810.762) (-2816.083) -- 0:06:00 308000 -- [-2812.970] (-2823.553) (-2819.569) (-2825.875) * (-2815.333) (-2816.033) [-2812.362] (-2820.095) -- 0:06:01 308500 -- (-2823.224) [-2812.415] (-2827.520) (-2812.503) * [-2817.187] (-2813.628) (-2818.372) (-2819.342) -- 0:06:00 309000 -- (-2821.787) [-2812.533] (-2826.594) (-2825.771) * (-2839.705) (-2812.489) [-2813.245] (-2816.098) -- 0:06:00 309500 -- (-2819.069) [-2820.976] (-2812.723) (-2837.297) * (-2827.098) [-2811.736] (-2817.927) (-2823.353) -- 0:06:01 310000 -- (-2815.922) [-2813.464] (-2817.712) (-2829.368) * [-2816.753] (-2812.294) (-2809.938) (-2813.016) -- 0:06:00 Average standard deviation of split frequencies: 0.008936 310500 -- (-2822.449) (-2814.665) [-2812.924] (-2820.494) * (-2819.832) (-2823.484) (-2813.676) [-2819.886] -- 0:05:59 311000 -- (-2817.712) (-2823.200) [-2808.289] (-2813.777) * [-2816.153] (-2815.630) (-2824.239) (-2816.456) -- 0:05:58 311500 -- (-2813.269) [-2817.485] (-2821.636) (-2814.213) * [-2814.138] (-2834.636) (-2812.737) (-2814.494) -- 0:06:00 312000 -- (-2822.122) [-2813.324] (-2817.533) (-2809.106) * [-2815.852] (-2823.842) (-2822.658) (-2821.543) -- 0:05:59 312500 -- (-2811.784) (-2825.152) [-2819.174] (-2825.562) * (-2820.895) (-2822.279) (-2806.983) [-2818.380] -- 0:05:58 313000 -- (-2813.365) (-2815.149) (-2821.800) [-2819.457] * (-2821.794) (-2834.606) [-2811.997] (-2820.522) -- 0:05:57 313500 -- (-2813.647) [-2810.453] (-2818.264) (-2827.614) * (-2818.415) (-2824.948) [-2814.597] (-2815.165) -- 0:05:59 314000 -- (-2817.226) (-2810.808) (-2822.522) [-2820.585] * (-2816.414) (-2826.738) [-2815.285] (-2820.316) -- 0:05:58 314500 -- [-2811.710] (-2814.974) (-2818.922) (-2830.509) * (-2815.879) (-2820.404) [-2809.749] (-2818.180) -- 0:05:57 315000 -- (-2816.536) [-2808.426] (-2819.854) (-2812.937) * (-2820.734) (-2819.581) [-2813.734] (-2814.438) -- 0:05:56 Average standard deviation of split frequencies: 0.009448 315500 -- (-2819.102) [-2813.716] (-2819.480) (-2818.921) * (-2825.614) (-2822.289) [-2817.311] (-2815.889) -- 0:05:57 316000 -- [-2818.320] (-2821.332) (-2822.150) (-2818.158) * (-2823.103) (-2820.898) (-2809.700) [-2811.620] -- 0:05:57 316500 -- (-2809.702) [-2820.217] (-2826.629) (-2816.433) * (-2821.891) [-2815.440] (-2814.404) (-2822.476) -- 0:05:56 317000 -- (-2817.907) (-2823.208) [-2808.589] (-2815.297) * [-2811.334] (-2813.723) (-2819.143) (-2815.815) -- 0:05:55 317500 -- (-2817.236) (-2814.185) [-2815.552] (-2812.251) * (-2814.634) [-2814.821] (-2821.497) (-2823.093) -- 0:05:56 318000 -- (-2822.181) (-2826.795) (-2819.831) [-2811.602] * (-2815.028) [-2815.432] (-2812.994) (-2811.233) -- 0:05:56 318500 -- (-2827.454) (-2824.982) (-2815.882) [-2811.722] * [-2812.987] (-2811.822) (-2830.848) (-2817.398) -- 0:05:55 319000 -- (-2824.448) (-2829.294) [-2815.016] (-2816.920) * (-2819.524) [-2808.020] (-2812.619) (-2811.170) -- 0:05:54 319500 -- (-2827.715) (-2823.402) (-2818.564) [-2811.705] * (-2811.185) (-2824.528) (-2818.987) [-2811.944] -- 0:05:55 320000 -- (-2821.100) [-2810.393] (-2816.216) (-2816.501) * (-2826.106) (-2819.535) [-2817.497] (-2813.089) -- 0:05:54 Average standard deviation of split frequencies: 0.008494 320500 -- (-2823.262) (-2813.366) (-2812.354) [-2806.094] * (-2821.278) (-2818.328) (-2816.699) [-2813.706] -- 0:05:54 321000 -- [-2820.369] (-2814.127) (-2810.732) (-2815.310) * (-2828.317) (-2818.512) (-2822.641) [-2820.454] -- 0:05:53 321500 -- [-2819.738] (-2818.237) (-2817.433) (-2818.174) * (-2817.306) (-2817.678) [-2815.883] (-2810.926) -- 0:05:54 322000 -- (-2818.942) [-2813.830] (-2819.274) (-2815.518) * (-2814.463) (-2822.823) (-2814.551) [-2811.090] -- 0:05:53 322500 -- [-2810.867] (-2817.949) (-2813.577) (-2815.169) * (-2820.093) (-2810.135) (-2810.103) [-2810.538] -- 0:05:52 323000 -- [-2809.172] (-2820.304) (-2818.814) (-2813.343) * (-2816.486) (-2812.864) (-2815.069) [-2807.419] -- 0:05:52 323500 -- (-2821.689) [-2812.900] (-2825.702) (-2831.715) * [-2810.974] (-2812.951) (-2813.584) (-2822.728) -- 0:05:53 324000 -- (-2821.118) (-2822.455) (-2815.642) [-2816.314] * (-2816.446) [-2812.009] (-2810.326) (-2816.939) -- 0:05:52 324500 -- (-2811.138) (-2822.149) [-2810.254] (-2822.001) * [-2819.922] (-2811.203) (-2816.434) (-2815.513) -- 0:05:53 325000 -- (-2820.393) (-2819.008) (-2814.865) [-2811.241] * [-2810.421] (-2827.715) (-2817.479) (-2814.813) -- 0:05:53 Average standard deviation of split frequencies: 0.008515 325500 -- (-2828.677) (-2814.428) (-2815.368) [-2812.096] * (-2811.972) [-2814.883] (-2826.101) (-2823.993) -- 0:05:52 326000 -- (-2826.771) [-2813.728] (-2823.540) (-2816.274) * (-2813.938) (-2816.409) [-2815.015] (-2818.598) -- 0:05:53 326500 -- (-2826.413) [-2818.080] (-2812.408) (-2814.192) * (-2824.941) (-2824.988) [-2819.486] (-2818.484) -- 0:05:52 327000 -- (-2824.403) [-2818.231] (-2817.695) (-2817.932) * (-2823.677) (-2818.186) (-2820.139) [-2808.654] -- 0:05:51 327500 -- (-2821.040) (-2818.357) (-2810.600) [-2810.830] * [-2813.313] (-2820.237) (-2811.520) (-2815.456) -- 0:05:51 328000 -- (-2819.590) (-2816.127) [-2818.733] (-2819.007) * (-2817.766) (-2814.055) (-2819.556) [-2812.997] -- 0:05:52 328500 -- [-2811.610] (-2813.963) (-2815.380) (-2819.222) * [-2813.335] (-2824.843) (-2812.291) (-2825.904) -- 0:05:51 329000 -- (-2819.016) (-2818.454) [-2813.235] (-2823.288) * (-2815.145) (-2812.195) [-2812.904] (-2813.436) -- 0:05:50 329500 -- (-2811.804) (-2825.459) [-2811.449] (-2815.637) * (-2823.792) (-2822.368) (-2815.673) [-2821.535] -- 0:05:50 330000 -- [-2817.717] (-2819.241) (-2820.483) (-2819.521) * (-2816.311) (-2823.717) (-2819.849) [-2816.068] -- 0:05:51 Average standard deviation of split frequencies: 0.009821 330500 -- (-2811.786) [-2817.299] (-2832.349) (-2825.352) * [-2811.663] (-2836.353) (-2817.263) (-2817.770) -- 0:05:50 331000 -- (-2812.266) (-2811.446) [-2819.225] (-2816.184) * [-2814.364] (-2818.007) (-2820.217) (-2813.080) -- 0:05:49 331500 -- [-2819.528] (-2820.494) (-2815.306) (-2812.156) * (-2815.535) (-2808.699) [-2820.190] (-2811.581) -- 0:05:50 332000 -- (-2820.546) (-2818.298) (-2817.597) [-2816.828] * (-2813.845) [-2822.974] (-2821.444) (-2829.083) -- 0:05:50 332500 -- (-2811.492) [-2814.319] (-2826.125) (-2819.758) * [-2808.207] (-2820.988) (-2810.300) (-2819.712) -- 0:05:49 333000 -- (-2830.744) (-2821.769) (-2818.273) [-2811.610] * [-2810.506] (-2820.848) (-2823.348) (-2813.953) -- 0:05:48 333500 -- (-2826.967) [-2819.130] (-2828.663) (-2814.335) * (-2807.970) (-2828.688) [-2816.816] (-2813.180) -- 0:05:49 334000 -- (-2823.326) [-2811.462] (-2826.612) (-2815.053) * (-2818.156) (-2819.418) [-2816.401] (-2816.222) -- 0:05:48 334500 -- [-2814.440] (-2810.252) (-2823.604) (-2824.158) * [-2817.881] (-2811.328) (-2819.143) (-2822.337) -- 0:05:48 335000 -- (-2815.932) (-2810.587) (-2828.184) [-2817.260] * [-2818.656] (-2818.510) (-2826.102) (-2812.995) -- 0:05:47 Average standard deviation of split frequencies: 0.009353 335500 -- (-2816.629) [-2813.680] (-2818.286) (-2821.526) * [-2824.100] (-2818.744) (-2820.937) (-2813.182) -- 0:05:48 336000 -- (-2815.118) [-2811.118] (-2817.485) (-2818.103) * (-2811.196) (-2808.601) (-2821.524) [-2813.529] -- 0:05:47 336500 -- (-2821.154) (-2818.289) (-2814.741) [-2817.168] * [-2813.937] (-2820.965) (-2817.687) (-2826.952) -- 0:05:47 337000 -- [-2818.196] (-2815.414) (-2821.796) (-2813.227) * [-2815.171] (-2817.030) (-2822.703) (-2820.626) -- 0:05:46 337500 -- [-2810.906] (-2819.919) (-2822.127) (-2825.299) * (-2822.455) (-2813.403) (-2831.464) [-2813.481] -- 0:05:47 338000 -- (-2818.636) [-2815.056] (-2815.452) (-2810.346) * (-2821.651) (-2820.185) (-2817.014) [-2809.641] -- 0:05:46 338500 -- [-2819.509] (-2810.631) (-2822.816) (-2822.015) * (-2818.416) (-2816.118) [-2811.471] (-2812.408) -- 0:05:45 339000 -- (-2812.571) [-2813.938] (-2815.410) (-2818.221) * (-2827.983) (-2809.949) (-2822.955) [-2815.688] -- 0:05:47 339500 -- (-2826.527) [-2816.576] (-2814.682) (-2825.307) * (-2816.086) (-2815.925) (-2829.474) [-2814.780] -- 0:05:46 340000 -- (-2833.289) [-2817.305] (-2817.385) (-2824.431) * (-2816.527) (-2819.611) [-2816.113] (-2823.231) -- 0:05:45 Average standard deviation of split frequencies: 0.009994 340500 -- (-2818.376) (-2808.985) [-2819.443] (-2816.719) * (-2819.705) (-2823.229) [-2816.392] (-2815.235) -- 0:05:44 341000 -- (-2818.898) (-2813.780) [-2808.187] (-2822.176) * (-2820.894) [-2818.767] (-2828.717) (-2817.822) -- 0:05:45 341500 -- [-2821.423] (-2812.845) (-2805.674) (-2815.152) * (-2814.314) (-2809.623) [-2814.156] (-2809.452) -- 0:05:45 342000 -- (-2818.936) (-2819.988) (-2807.557) [-2822.787] * [-2819.693] (-2815.830) (-2818.458) (-2815.374) -- 0:05:44 342500 -- [-2812.809] (-2817.419) (-2818.675) (-2815.875) * (-2816.440) [-2808.762] (-2824.404) (-2828.188) -- 0:05:43 343000 -- (-2816.264) (-2819.543) [-2808.362] (-2821.709) * [-2814.579] (-2813.586) (-2824.302) (-2827.910) -- 0:05:44 343500 -- (-2821.614) [-2811.930] (-2815.618) (-2818.884) * [-2818.667] (-2818.443) (-2817.078) (-2827.764) -- 0:05:44 344000 -- (-2815.160) (-2818.996) [-2812.108] (-2819.561) * [-2814.024] (-2817.181) (-2824.285) (-2818.882) -- 0:05:43 344500 -- (-2817.492) (-2816.177) (-2815.368) [-2822.176] * [-2819.234] (-2824.372) (-2821.021) (-2816.246) -- 0:05:44 345000 -- (-2823.402) (-2818.942) [-2814.341] (-2817.375) * (-2823.004) (-2815.044) [-2811.858] (-2818.933) -- 0:05:43 Average standard deviation of split frequencies: 0.009083 345500 -- [-2815.854] (-2811.209) (-2816.965) (-2818.703) * (-2812.422) (-2820.817) (-2816.277) [-2811.241] -- 0:05:42 346000 -- (-2815.604) (-2812.195) (-2813.707) [-2814.304] * (-2816.820) (-2820.167) [-2810.366] (-2812.302) -- 0:05:44 346500 -- [-2815.203] (-2809.639) (-2814.890) (-2832.072) * (-2820.985) (-2817.363) [-2812.934] (-2823.648) -- 0:05:43 347000 -- (-2809.895) [-2812.652] (-2820.163) (-2821.858) * (-2830.238) (-2823.731) [-2808.177] (-2817.993) -- 0:05:42 347500 -- (-2811.079) (-2820.272) [-2812.550] (-2817.623) * (-2817.592) [-2817.306] (-2813.709) (-2820.708) -- 0:05:41 348000 -- [-2812.508] (-2811.937) (-2823.374) (-2823.198) * (-2815.586) (-2810.843) (-2825.386) [-2814.863] -- 0:05:42 348500 -- (-2814.689) (-2817.431) (-2821.650) [-2810.250] * [-2809.434] (-2812.358) (-2834.541) (-2822.834) -- 0:05:42 349000 -- [-2817.817] (-2825.637) (-2823.526) (-2815.337) * (-2813.904) [-2811.769] (-2817.946) (-2822.972) -- 0:05:41 349500 -- (-2815.741) (-2812.653) (-2809.426) [-2820.358] * (-2827.361) (-2817.327) [-2816.431] (-2815.902) -- 0:05:40 350000 -- (-2817.580) (-2817.866) (-2819.739) [-2818.829] * (-2826.915) [-2814.594] (-2816.028) (-2818.709) -- 0:05:41 Average standard deviation of split frequencies: 0.007618 350500 -- [-2813.246] (-2813.512) (-2815.836) (-2825.198) * (-2816.386) (-2815.678) (-2808.420) [-2817.571] -- 0:05:40 351000 -- [-2815.058] (-2816.830) (-2820.402) (-2820.824) * (-2816.054) (-2814.250) (-2810.531) [-2813.073] -- 0:05:40 351500 -- (-2814.930) (-2814.383) (-2827.511) [-2827.293] * (-2819.262) (-2818.584) [-2812.723] (-2816.346) -- 0:05:39 352000 -- (-2828.227) [-2821.767] (-2828.772) (-2825.671) * (-2822.550) [-2818.553] (-2808.381) (-2817.795) -- 0:05:40 352500 -- (-2820.235) [-2813.416] (-2814.193) (-2825.085) * [-2812.770] (-2816.771) (-2819.263) (-2818.126) -- 0:05:39 353000 -- [-2814.848] (-2817.567) (-2828.027) (-2819.361) * (-2814.873) (-2828.567) [-2822.890] (-2818.001) -- 0:05:39 353500 -- (-2811.136) (-2814.976) (-2819.255) [-2812.215] * (-2818.759) (-2821.798) (-2818.480) [-2821.080] -- 0:05:40 354000 -- (-2818.083) (-2813.984) [-2814.750] (-2822.457) * (-2814.165) [-2813.957] (-2814.527) (-2821.455) -- 0:05:39 354500 -- (-2817.268) (-2817.423) [-2812.291] (-2815.962) * (-2811.029) (-2830.635) [-2812.981] (-2813.911) -- 0:05:38 355000 -- [-2815.753] (-2824.301) (-2817.617) (-2821.593) * (-2815.754) (-2819.480) [-2812.013] (-2819.102) -- 0:05:37 Average standard deviation of split frequencies: 0.008975 355500 -- [-2812.361] (-2812.556) (-2817.739) (-2814.619) * (-2816.709) (-2813.304) (-2815.070) [-2812.158] -- 0:05:39 356000 -- (-2821.044) (-2814.250) [-2808.612] (-2820.338) * (-2823.076) (-2811.895) (-2811.616) [-2811.304] -- 0:05:38 356500 -- (-2817.653) (-2812.630) [-2809.840] (-2813.973) * (-2816.395) [-2816.470] (-2809.095) (-2810.459) -- 0:05:37 357000 -- (-2823.239) [-2810.683] (-2811.724) (-2817.931) * [-2813.733] (-2816.654) (-2814.286) (-2817.923) -- 0:05:38 357500 -- (-2814.639) [-2818.126] (-2812.506) (-2815.850) * (-2806.925) (-2810.973) (-2820.239) [-2821.614] -- 0:05:37 358000 -- [-2809.906] (-2811.840) (-2819.989) (-2813.052) * (-2816.288) (-2824.182) [-2813.290] (-2819.970) -- 0:05:37 358500 -- (-2821.394) [-2808.067] (-2823.254) (-2819.996) * (-2816.478) [-2823.818] (-2812.580) (-2823.887) -- 0:05:36 359000 -- (-2817.032) (-2820.497) (-2816.921) [-2809.861] * [-2811.884] (-2815.099) (-2817.292) (-2818.344) -- 0:05:37 359500 -- (-2813.936) [-2816.853] (-2814.454) (-2823.333) * (-2815.553) (-2814.629) [-2816.125] (-2817.569) -- 0:05:36 360000 -- (-2814.162) (-2822.007) (-2810.890) [-2815.495] * (-2815.200) (-2814.189) (-2820.053) [-2816.994] -- 0:05:36 Average standard deviation of split frequencies: 0.008133 360500 -- (-2816.102) [-2816.808] (-2818.146) (-2816.326) * (-2818.088) (-2810.504) [-2811.333] (-2831.428) -- 0:05:35 361000 -- [-2812.229] (-2821.819) (-2817.305) (-2818.106) * (-2817.207) [-2814.806] (-2815.143) (-2822.115) -- 0:05:36 361500 -- [-2815.348] (-2824.628) (-2821.906) (-2813.134) * [-2812.354] (-2819.146) (-2813.658) (-2825.680) -- 0:05:35 362000 -- [-2824.335] (-2828.725) (-2824.192) (-2810.068) * [-2813.781] (-2822.086) (-2814.383) (-2813.892) -- 0:05:34 362500 -- (-2825.172) [-2816.804] (-2822.137) (-2820.151) * (-2818.853) (-2815.871) [-2817.183] (-2821.690) -- 0:05:34 363000 -- [-2814.604] (-2819.308) (-2816.229) (-2813.162) * (-2822.974) (-2822.570) (-2818.239) [-2812.236] -- 0:05:35 363500 -- (-2808.924) [-2817.338] (-2822.354) (-2817.475) * (-2812.786) (-2821.559) [-2812.835] (-2823.061) -- 0:05:34 364000 -- (-2810.012) (-2814.782) (-2810.331) [-2812.327] * [-2809.906] (-2818.249) (-2817.123) (-2831.537) -- 0:05:33 364500 -- (-2823.170) (-2819.740) [-2814.906] (-2819.290) * (-2813.741) [-2821.042] (-2813.778) (-2823.832) -- 0:05:33 365000 -- (-2819.570) [-2810.412] (-2820.764) (-2820.519) * [-2822.988] (-2821.139) (-2813.369) (-2814.646) -- 0:05:34 Average standard deviation of split frequencies: 0.008157 365500 -- (-2820.819) (-2821.095) [-2818.345] (-2824.999) * (-2820.458) (-2813.905) (-2809.616) [-2811.952] -- 0:05:33 366000 -- (-2817.884) (-2811.297) (-2824.639) [-2813.164] * (-2823.232) (-2816.116) (-2835.082) [-2810.418] -- 0:05:32 366500 -- (-2817.907) [-2807.510] (-2817.961) (-2820.558) * (-2816.965) (-2811.879) (-2810.412) [-2811.653] -- 0:05:33 367000 -- [-2810.420] (-2816.500) (-2810.686) (-2807.429) * (-2813.020) [-2819.433] (-2812.337) (-2823.182) -- 0:05:32 367500 -- [-2808.673] (-2815.110) (-2810.287) (-2817.706) * (-2827.018) [-2809.129] (-2810.699) (-2819.897) -- 0:05:32 368000 -- (-2812.372) (-2815.929) [-2814.534] (-2818.476) * (-2814.168) [-2811.730] (-2821.149) (-2815.606) -- 0:05:31 368500 -- (-2821.929) (-2811.485) (-2820.095) [-2811.266] * [-2821.117] (-2817.440) (-2818.460) (-2817.236) -- 0:05:32 369000 -- (-2811.990) (-2812.275) (-2822.131) [-2807.206] * (-2820.753) (-2813.387) [-2809.572] (-2813.816) -- 0:05:31 369500 -- (-2824.819) (-2813.454) [-2813.485] (-2810.095) * [-2815.859] (-2811.561) (-2824.916) (-2817.770) -- 0:05:31 370000 -- (-2814.742) (-2817.255) [-2815.063] (-2813.277) * (-2826.198) (-2821.707) (-2814.470) [-2824.211] -- 0:05:30 Average standard deviation of split frequencies: 0.008902 370500 -- [-2813.970] (-2815.182) (-2815.270) (-2810.924) * (-2818.319) (-2821.720) [-2814.886] (-2817.768) -- 0:05:31 371000 -- [-2809.387] (-2817.742) (-2828.815) (-2809.204) * (-2819.610) (-2816.816) (-2812.833) [-2817.056] -- 0:05:30 371500 -- (-2813.767) (-2823.880) (-2825.715) [-2807.408] * [-2824.119] (-2818.967) (-2815.450) (-2826.805) -- 0:05:29 372000 -- (-2807.297) (-2820.114) (-2819.653) [-2813.116] * [-2812.623] (-2829.099) (-2811.925) (-2820.404) -- 0:05:29 372500 -- (-2824.582) (-2817.544) (-2825.738) [-2815.755] * (-2814.524) (-2818.990) [-2808.120] (-2822.294) -- 0:05:30 373000 -- [-2806.593] (-2820.268) (-2820.917) (-2810.899) * (-2821.554) (-2816.123) [-2810.781] (-2822.968) -- 0:05:29 373500 -- (-2812.184) (-2829.453) [-2813.975] (-2817.796) * (-2822.926) (-2817.067) [-2816.317] (-2815.988) -- 0:05:28 374000 -- (-2817.768) (-2833.817) [-2807.688] (-2816.060) * (-2823.431) [-2821.347] (-2823.041) (-2813.887) -- 0:05:28 374500 -- (-2819.150) (-2819.892) (-2812.770) [-2809.811] * (-2811.761) [-2822.206] (-2825.356) (-2814.589) -- 0:05:29 375000 -- (-2820.360) [-2809.328] (-2818.479) (-2814.070) * [-2819.186] (-2816.199) (-2821.277) (-2810.396) -- 0:05:28 Average standard deviation of split frequencies: 0.009333 375500 -- (-2824.260) [-2812.723] (-2824.165) (-2814.866) * (-2820.420) (-2809.924) [-2814.460] (-2815.568) -- 0:05:27 376000 -- (-2815.282) (-2813.072) (-2819.778) [-2825.840] * (-2814.820) [-2814.471] (-2825.381) (-2817.240) -- 0:05:26 376500 -- (-2816.667) [-2814.666] (-2820.340) (-2826.273) * [-2815.008] (-2821.121) (-2817.013) (-2811.165) -- 0:05:27 377000 -- (-2826.508) [-2819.752] (-2831.531) (-2813.766) * (-2827.776) (-2820.073) (-2828.492) [-2808.201] -- 0:05:27 377500 -- (-2823.217) (-2812.698) [-2823.767] (-2828.090) * [-2821.331] (-2820.507) (-2816.696) (-2816.973) -- 0:05:26 378000 -- (-2815.277) (-2822.386) (-2812.106) [-2819.951] * [-2811.405] (-2813.512) (-2820.737) (-2815.387) -- 0:05:25 378500 -- (-2823.913) (-2815.701) [-2819.616] (-2819.098) * (-2813.407) [-2822.144] (-2812.896) (-2811.006) -- 0:05:26 379000 -- (-2816.635) [-2813.230] (-2809.973) (-2820.881) * (-2813.369) (-2812.640) (-2819.982) [-2813.980] -- 0:05:26 379500 -- (-2820.333) (-2815.228) [-2810.531] (-2820.275) * (-2810.373) [-2815.681] (-2810.835) (-2817.714) -- 0:05:25 380000 -- (-2833.668) (-2814.199) [-2809.638] (-2815.901) * [-2814.876] (-2822.383) (-2825.359) (-2813.606) -- 0:05:24 Average standard deviation of split frequencies: 0.008669 380500 -- (-2823.894) (-2824.332) [-2818.765] (-2818.943) * (-2819.290) [-2818.090] (-2825.591) (-2814.792) -- 0:05:25 381000 -- [-2814.986] (-2821.359) (-2816.598) (-2825.622) * (-2821.362) (-2813.234) [-2820.652] (-2816.209) -- 0:05:24 381500 -- [-2809.569] (-2818.774) (-2827.449) (-2812.379) * (-2818.735) (-2827.081) [-2810.657] (-2823.026) -- 0:05:24 382000 -- [-2812.463] (-2828.551) (-2816.933) (-2819.030) * (-2822.182) (-2811.938) [-2814.965] (-2820.935) -- 0:05:25 382500 -- [-2819.160] (-2822.549) (-2819.630) (-2823.319) * (-2823.715) (-2818.812) (-2817.129) [-2815.589] -- 0:05:24 383000 -- [-2811.415] (-2814.282) (-2832.575) (-2831.437) * (-2826.191) (-2806.607) [-2809.311] (-2820.604) -- 0:05:23 383500 -- [-2821.419] (-2816.539) (-2829.649) (-2819.823) * (-2820.902) (-2813.425) (-2810.782) [-2814.115] -- 0:05:23 384000 -- (-2817.490) [-2814.154] (-2830.441) (-2820.130) * (-2828.283) (-2811.787) (-2820.750) [-2813.520] -- 0:05:24 384500 -- [-2808.742] (-2824.166) (-2825.124) (-2831.953) * [-2819.572] (-2811.166) (-2823.905) (-2819.709) -- 0:05:23 385000 -- [-2816.761] (-2815.354) (-2819.323) (-2826.052) * (-2813.597) (-2822.930) [-2817.252] (-2822.533) -- 0:05:22 Average standard deviation of split frequencies: 0.008277 385500 -- (-2820.341) (-2820.049) [-2814.087] (-2812.252) * (-2814.134) [-2818.888] (-2810.962) (-2820.735) -- 0:05:21 386000 -- [-2810.413] (-2822.195) (-2815.369) (-2814.942) * (-2815.089) (-2821.603) [-2810.144] (-2816.321) -- 0:05:22 386500 -- (-2826.189) (-2818.164) [-2807.845] (-2816.264) * (-2819.529) [-2819.841] (-2815.992) (-2824.132) -- 0:05:22 387000 -- [-2810.514] (-2817.674) (-2811.502) (-2817.779) * (-2815.375) [-2819.991] (-2831.632) (-2812.138) -- 0:05:21 387500 -- (-2816.120) (-2821.644) [-2809.695] (-2817.891) * (-2817.352) (-2811.689) [-2812.655] (-2817.012) -- 0:05:22 388000 -- [-2810.396] (-2822.247) (-2812.503) (-2816.287) * (-2818.052) (-2815.894) [-2812.043] (-2819.063) -- 0:05:21 388500 -- [-2819.357] (-2821.083) (-2822.068) (-2814.009) * [-2817.153] (-2820.204) (-2815.031) (-2817.945) -- 0:05:21 389000 -- (-2820.037) (-2813.056) [-2809.492] (-2816.743) * [-2825.062] (-2821.782) (-2811.972) (-2814.471) -- 0:05:20 389500 -- (-2820.979) (-2819.775) (-2815.999) [-2809.313] * (-2812.170) (-2826.576) (-2809.939) [-2812.906] -- 0:05:21 390000 -- (-2823.106) (-2821.440) (-2819.630) [-2818.122] * (-2817.901) (-2814.122) (-2813.799) [-2812.120] -- 0:05:20 Average standard deviation of split frequencies: 0.008179 390500 -- (-2819.830) (-2814.455) [-2816.590] (-2810.936) * [-2819.269] (-2810.347) (-2828.049) (-2821.649) -- 0:05:19 391000 -- (-2809.385) (-2816.253) [-2816.387] (-2811.198) * (-2826.082) (-2807.235) (-2824.642) [-2813.494] -- 0:05:19 391500 -- [-2816.518] (-2820.877) (-2820.901) (-2819.783) * [-2808.419] (-2821.510) (-2813.679) (-2818.734) -- 0:05:20 392000 -- (-2818.543) (-2818.601) (-2820.749) [-2815.547] * (-2822.695) (-2813.523) (-2812.721) [-2812.299] -- 0:05:19 392500 -- (-2811.315) [-2811.553] (-2815.625) (-2818.723) * (-2820.807) (-2820.415) (-2832.538) [-2817.708] -- 0:05:18 393000 -- [-2813.825] (-2816.409) (-2828.686) (-2817.444) * (-2810.593) [-2813.067] (-2820.479) (-2826.082) -- 0:05:18 393500 -- (-2821.315) [-2816.848] (-2823.549) (-2819.205) * (-2822.756) (-2814.192) (-2822.341) [-2817.757] -- 0:05:19 394000 -- (-2815.559) (-2824.155) [-2813.458] (-2816.474) * (-2826.710) (-2821.418) [-2820.004] (-2818.521) -- 0:05:18 394500 -- (-2817.685) (-2820.219) (-2810.844) [-2814.159] * [-2817.349] (-2812.715) (-2826.791) (-2818.420) -- 0:05:17 395000 -- (-2826.549) (-2811.938) (-2816.299) [-2813.927] * (-2815.731) (-2814.463) [-2819.656] (-2826.331) -- 0:05:18 Average standard deviation of split frequencies: 0.008730 395500 -- [-2818.399] (-2824.489) (-2826.276) (-2812.998) * (-2824.763) (-2830.428) [-2811.475] (-2822.193) -- 0:05:17 396000 -- (-2815.328) [-2819.772] (-2816.096) (-2818.258) * (-2819.142) (-2828.917) [-2809.329] (-2818.181) -- 0:05:17 396500 -- (-2822.681) [-2815.782] (-2812.940) (-2818.484) * (-2820.823) (-2811.993) [-2807.427] (-2823.503) -- 0:05:16 397000 -- (-2816.999) (-2824.908) [-2808.143] (-2822.687) * [-2813.489] (-2813.340) (-2814.703) (-2815.301) -- 0:05:17 397500 -- [-2821.486] (-2810.861) (-2813.791) (-2821.218) * (-2821.594) [-2817.920] (-2819.264) (-2810.711) -- 0:05:16 398000 -- (-2822.864) (-2826.254) [-2818.824] (-2809.623) * (-2812.342) [-2818.675] (-2819.141) (-2817.165) -- 0:05:16 398500 -- (-2816.506) (-2811.616) (-2822.579) [-2812.266] * (-2813.835) (-2814.990) (-2817.543) [-2816.788] -- 0:05:15 399000 -- (-2810.634) (-2813.378) [-2811.873] (-2820.263) * (-2819.683) (-2813.116) (-2819.452) [-2813.224] -- 0:05:16 399500 -- (-2821.579) [-2811.240] (-2817.666) (-2826.991) * [-2808.899] (-2814.790) (-2816.797) (-2812.730) -- 0:05:15 400000 -- [-2812.718] (-2817.541) (-2813.092) (-2829.152) * (-2813.999) [-2817.791] (-2818.688) (-2824.788) -- 0:05:15 Average standard deviation of split frequencies: 0.008759 400500 -- (-2813.488) [-2819.652] (-2813.842) (-2816.173) * (-2815.842) (-2814.290) (-2814.911) [-2811.059] -- 0:05:15 401000 -- (-2820.439) (-2815.576) [-2808.085] (-2818.262) * (-2816.001) (-2812.884) (-2824.325) [-2817.875] -- 0:05:15 401500 -- [-2809.427] (-2819.150) (-2819.099) (-2821.799) * (-2822.002) (-2808.581) (-2817.509) [-2811.394] -- 0:05:14 402000 -- (-2817.330) (-2813.344) [-2813.176] (-2818.081) * (-2818.646) (-2815.910) [-2821.452] (-2820.953) -- 0:05:15 402500 -- [-2815.607] (-2817.565) (-2822.207) (-2807.041) * (-2823.477) (-2816.196) [-2817.183] (-2823.744) -- 0:05:14 403000 -- [-2817.223] (-2819.192) (-2823.352) (-2822.774) * (-2829.841) (-2817.112) (-2820.653) [-2810.891] -- 0:05:14 403500 -- (-2818.513) (-2813.836) (-2813.007) [-2811.565] * [-2814.251] (-2812.096) (-2824.013) (-2821.324) -- 0:05:13 404000 -- [-2817.998] (-2810.663) (-2824.489) (-2827.921) * (-2821.576) (-2819.236) [-2816.469] (-2819.528) -- 0:05:14 404500 -- [-2821.841] (-2819.663) (-2826.867) (-2815.981) * (-2817.649) (-2811.506) [-2819.500] (-2815.825) -- 0:05:13 405000 -- (-2823.332) [-2819.131] (-2820.240) (-2819.869) * (-2819.414) (-2811.252) [-2820.782] (-2812.945) -- 0:05:12 Average standard deviation of split frequencies: 0.007870 405500 -- (-2815.596) [-2815.087] (-2813.280) (-2824.153) * [-2817.936] (-2816.916) (-2817.807) (-2812.222) -- 0:05:12 406000 -- (-2817.985) (-2818.289) (-2818.899) [-2816.830] * (-2822.461) (-2813.442) (-2820.079) [-2818.690] -- 0:05:13 406500 -- [-2813.072] (-2822.418) (-2818.739) (-2816.520) * (-2821.282) [-2807.935] (-2813.768) (-2820.359) -- 0:05:12 407000 -- [-2811.793] (-2809.926) (-2815.653) (-2824.759) * (-2816.076) (-2822.003) [-2814.482] (-2830.032) -- 0:05:11 407500 -- [-2812.997] (-2816.655) (-2819.381) (-2817.104) * (-2820.714) (-2823.354) [-2811.657] (-2810.452) -- 0:05:11 408000 -- (-2821.078) (-2811.409) [-2807.927] (-2814.346) * (-2821.637) [-2819.223] (-2820.746) (-2811.481) -- 0:05:11 408500 -- (-2812.479) [-2819.705] (-2822.158) (-2832.753) * (-2819.511) [-2818.069] (-2816.019) (-2820.586) -- 0:05:11 409000 -- (-2817.133) [-2809.619] (-2829.735) (-2815.896) * (-2818.044) (-2820.145) (-2815.570) [-2821.954] -- 0:05:10 409500 -- (-2814.579) (-2820.274) [-2826.862] (-2817.123) * [-2811.325] (-2819.447) (-2820.752) (-2813.171) -- 0:05:10 410000 -- [-2822.004] (-2825.732) (-2812.922) (-2818.955) * (-2821.021) (-2819.351) (-2815.124) [-2816.076] -- 0:05:10 Average standard deviation of split frequencies: 0.007270 410500 -- (-2815.434) [-2815.289] (-2820.287) (-2824.957) * [-2810.786] (-2823.804) (-2824.770) (-2814.177) -- 0:05:10 411000 -- (-2814.321) (-2812.822) (-2819.417) [-2818.546] * (-2810.805) (-2821.867) (-2828.107) [-2811.579] -- 0:05:09 411500 -- (-2822.789) [-2818.131] (-2830.698) (-2816.420) * (-2814.514) (-2815.676) [-2819.745] (-2818.214) -- 0:05:08 412000 -- (-2819.067) (-2813.490) (-2822.419) [-2812.155] * (-2821.851) [-2813.033] (-2816.207) (-2814.334) -- 0:05:09 412500 -- (-2818.076) [-2810.144] (-2817.555) (-2817.765) * (-2827.816) [-2817.156] (-2823.964) (-2816.138) -- 0:05:09 413000 -- [-2817.425] (-2814.743) (-2826.553) (-2810.962) * (-2813.615) (-2814.868) [-2816.226] (-2823.958) -- 0:05:08 413500 -- [-2807.049] (-2825.664) (-2813.487) (-2817.671) * (-2819.448) [-2818.295] (-2811.718) (-2816.372) -- 0:05:07 414000 -- (-2812.369) [-2812.089] (-2816.345) (-2809.170) * (-2808.449) [-2813.810] (-2820.344) (-2812.901) -- 0:05:08 414500 -- (-2812.649) (-2821.420) [-2813.253] (-2815.120) * (-2809.314) (-2819.578) (-2831.572) [-2816.162] -- 0:05:07 415000 -- [-2810.977] (-2820.255) (-2816.621) (-2814.991) * [-2811.185] (-2829.037) (-2820.763) (-2814.043) -- 0:05:07 Average standard deviation of split frequencies: 0.007932 415500 -- (-2817.112) (-2823.300) (-2823.306) [-2812.169] * (-2820.000) (-2816.074) [-2819.560] (-2811.673) -- 0:05:06 416000 -- [-2817.696] (-2814.595) (-2823.814) (-2817.698) * (-2817.711) [-2819.867] (-2815.716) (-2817.863) -- 0:05:07 416500 -- (-2818.192) (-2813.380) (-2851.826) [-2815.383] * [-2811.744] (-2811.437) (-2817.556) (-2812.673) -- 0:05:06 417000 -- (-2812.573) (-2815.168) (-2832.976) [-2817.142] * (-2816.475) [-2821.077] (-2814.496) (-2819.844) -- 0:05:06 417500 -- (-2826.727) (-2815.745) (-2822.241) [-2814.281] * (-2819.516) (-2825.299) [-2806.559] (-2825.146) -- 0:05:05 418000 -- (-2814.109) (-2812.093) (-2826.979) [-2819.456] * (-2821.775) (-2815.840) (-2812.510) [-2819.236] -- 0:05:06 418500 -- (-2818.011) (-2824.412) (-2820.512) [-2828.330] * (-2814.643) (-2814.887) (-2831.000) [-2812.089] -- 0:05:05 419000 -- (-2818.782) (-2816.572) (-2813.953) [-2818.619] * (-2810.688) (-2816.731) (-2838.715) [-2821.119] -- 0:05:05 419500 -- (-2820.610) (-2816.839) [-2813.019] (-2818.787) * (-2821.696) (-2818.827) [-2813.865] (-2816.380) -- 0:05:04 420000 -- (-2818.276) (-2812.318) [-2810.265] (-2811.479) * [-2813.595] (-2812.629) (-2818.083) (-2814.435) -- 0:05:05 Average standard deviation of split frequencies: 0.007471 420500 -- [-2815.883] (-2827.602) (-2815.736) (-2815.147) * (-2819.980) (-2821.806) (-2836.125) [-2816.693] -- 0:05:04 421000 -- (-2812.205) (-2822.833) [-2817.038] (-2815.012) * (-2822.252) [-2810.953] (-2826.271) (-2815.438) -- 0:05:03 421500 -- [-2815.114] (-2812.595) (-2822.565) (-2815.016) * (-2820.635) [-2817.799] (-2820.167) (-2812.374) -- 0:05:03 422000 -- [-2811.084] (-2811.908) (-2820.104) (-2814.221) * (-2810.594) (-2817.678) (-2813.652) [-2820.558] -- 0:05:04 422500 -- [-2811.383] (-2810.333) (-2817.781) (-2806.924) * (-2821.922) [-2810.415] (-2808.375) (-2812.814) -- 0:05:03 423000 -- (-2827.921) (-2813.241) [-2821.163] (-2816.711) * (-2822.724) (-2825.268) (-2808.248) [-2809.254] -- 0:05:02 423500 -- (-2824.684) [-2809.553] (-2815.308) (-2814.742) * (-2814.440) (-2820.918) (-2822.335) [-2814.383] -- 0:05:02 424000 -- (-2829.415) (-2814.029) (-2832.100) [-2812.490] * (-2808.913) (-2819.893) (-2819.273) [-2815.517] -- 0:05:02 424500 -- (-2819.898) [-2831.093] (-2821.250) (-2813.194) * (-2819.251) [-2820.820] (-2813.700) (-2818.585) -- 0:05:02 425000 -- (-2813.917) [-2820.656] (-2816.741) (-2814.694) * (-2818.548) [-2809.341] (-2817.128) (-2810.385) -- 0:05:01 Average standard deviation of split frequencies: 0.007500 425500 -- (-2824.432) (-2812.881) [-2816.777] (-2819.718) * [-2815.670] (-2827.064) (-2815.086) (-2817.363) -- 0:05:02 426000 -- (-2811.251) [-2821.490] (-2818.515) (-2812.925) * [-2819.892] (-2820.196) (-2813.146) (-2825.509) -- 0:05:01 426500 -- (-2814.195) (-2807.102) [-2806.707] (-2818.314) * (-2817.114) (-2811.737) [-2823.900] (-2811.692) -- 0:05:01 427000 -- (-2809.377) [-2813.361] (-2821.018) (-2816.365) * (-2815.079) (-2824.051) [-2820.631] (-2825.379) -- 0:05:00 427500 -- (-2811.197) (-2819.519) (-2821.514) [-2812.854] * [-2815.107] (-2821.825) (-2819.297) (-2815.767) -- 0:05:01 428000 -- (-2815.710) [-2815.623] (-2813.401) (-2809.303) * (-2808.961) [-2812.999] (-2822.062) (-2815.011) -- 0:05:00 428500 -- (-2816.251) [-2806.867] (-2819.692) (-2815.908) * [-2812.274] (-2811.644) (-2824.310) (-2815.966) -- 0:05:00 429000 -- [-2815.590] (-2815.090) (-2825.099) (-2825.506) * [-2817.302] (-2825.080) (-2816.609) (-2826.707) -- 0:04:59 429500 -- (-2814.474) [-2819.318] (-2820.418) (-2824.428) * [-2824.364] (-2821.968) (-2813.946) (-2818.141) -- 0:05:00 430000 -- (-2829.054) (-2814.925) (-2809.691) [-2813.805] * [-2815.789] (-2811.689) (-2825.330) (-2818.440) -- 0:04:59 Average standard deviation of split frequencies: 0.006446 430500 -- (-2818.598) (-2823.962) [-2812.604] (-2828.310) * (-2810.222) (-2813.018) (-2812.417) [-2815.481] -- 0:04:58 431000 -- [-2828.741] (-2819.931) (-2813.908) (-2822.966) * (-2816.122) [-2812.272] (-2817.402) (-2816.692) -- 0:04:58 431500 -- [-2820.345] (-2812.406) (-2821.255) (-2818.113) * (-2827.552) (-2809.129) [-2812.457] (-2817.999) -- 0:04:59 432000 -- [-2814.956] (-2816.988) (-2814.138) (-2820.685) * [-2825.513] (-2811.334) (-2816.444) (-2810.945) -- 0:04:58 432500 -- [-2813.148] (-2811.639) (-2821.222) (-2814.087) * (-2812.064) [-2815.343] (-2818.145) (-2817.999) -- 0:04:57 433000 -- [-2814.378] (-2814.181) (-2821.347) (-2829.521) * (-2811.235) (-2816.173) [-2810.539] (-2820.558) -- 0:04:58 433500 -- [-2805.402] (-2819.085) (-2835.754) (-2819.535) * (-2814.776) (-2826.563) [-2815.311] (-2825.308) -- 0:04:57 434000 -- [-2811.216] (-2815.104) (-2812.920) (-2821.805) * (-2810.942) [-2824.902] (-2808.426) (-2826.373) -- 0:04:57 434500 -- (-2817.289) [-2816.120] (-2817.399) (-2825.880) * (-2813.709) (-2811.101) (-2814.563) [-2822.548] -- 0:04:56 435000 -- (-2826.076) (-2814.109) [-2819.528] (-2811.069) * (-2821.604) (-2814.167) [-2817.122] (-2820.699) -- 0:04:57 Average standard deviation of split frequencies: 0.005766 435500 -- [-2820.241] (-2815.498) (-2820.635) (-2830.516) * (-2813.416) (-2820.845) (-2819.642) [-2820.114] -- 0:04:56 436000 -- [-2815.328] (-2821.475) (-2818.424) (-2815.739) * [-2810.590] (-2829.538) (-2816.374) (-2814.238) -- 0:04:56 436500 -- (-2816.692) (-2814.299) (-2813.685) [-2820.533] * [-2809.685] (-2826.436) (-2816.428) (-2818.852) -- 0:04:55 437000 -- (-2814.590) (-2810.213) [-2813.315] (-2813.043) * (-2818.576) (-2817.272) (-2812.283) [-2816.382] -- 0:04:56 437500 -- (-2829.703) (-2823.032) [-2812.090] (-2816.009) * (-2820.855) [-2812.446] (-2813.015) (-2814.646) -- 0:04:55 438000 -- (-2818.682) (-2816.027) (-2817.392) [-2815.276] * [-2815.921] (-2818.165) (-2814.194) (-2815.548) -- 0:04:55 438500 -- (-2822.446) (-2817.432) [-2808.116] (-2814.853) * [-2819.499] (-2813.786) (-2820.445) (-2816.061) -- 0:04:54 439000 -- [-2820.662] (-2814.040) (-2810.298) (-2824.148) * (-2824.521) (-2813.310) (-2830.652) [-2815.879] -- 0:04:55 439500 -- (-2816.672) (-2809.124) [-2810.358] (-2814.060) * (-2825.331) [-2817.235] (-2814.410) (-2815.427) -- 0:04:54 440000 -- (-2823.838) (-2810.589) [-2811.141] (-2810.246) * (-2818.419) [-2827.017] (-2811.808) (-2813.715) -- 0:04:54 Average standard deviation of split frequencies: 0.005824 440500 -- (-2808.841) (-2815.540) [-2813.356] (-2815.040) * (-2825.802) (-2814.152) [-2818.816] (-2814.584) -- 0:04:53 441000 -- (-2826.605) [-2811.179] (-2808.095) (-2811.642) * (-2834.474) (-2821.012) [-2807.002] (-2810.262) -- 0:04:54 441500 -- (-2822.700) (-2828.921) [-2812.444] (-2818.783) * (-2816.005) [-2817.939] (-2812.567) (-2819.721) -- 0:04:53 442000 -- (-2819.994) (-2821.645) [-2810.184] (-2820.701) * (-2811.490) [-2819.289] (-2814.418) (-2819.392) -- 0:04:52 442500 -- (-2820.239) (-2813.924) [-2812.475] (-2809.857) * (-2815.223) (-2828.987) (-2813.518) [-2817.636] -- 0:04:52 443000 -- (-2818.866) (-2822.018) (-2812.246) [-2808.717] * [-2809.939] (-2818.001) (-2815.309) (-2823.271) -- 0:04:52 443500 -- (-2819.410) (-2818.235) (-2816.580) [-2812.373] * (-2812.839) (-2817.343) [-2815.966] (-2819.401) -- 0:04:52 444000 -- [-2814.878] (-2810.199) (-2821.714) (-2814.967) * (-2821.417) (-2830.085) (-2811.423) [-2814.143] -- 0:04:51 444500 -- (-2813.777) [-2817.560] (-2811.510) (-2818.120) * (-2814.709) [-2817.736] (-2834.594) (-2817.872) -- 0:04:51 445000 -- [-2818.344] (-2816.676) (-2822.858) (-2816.179) * (-2824.101) [-2809.832] (-2835.286) (-2822.880) -- 0:04:51 Average standard deviation of split frequencies: 0.005989 445500 -- [-2825.075] (-2816.699) (-2827.135) (-2818.299) * (-2823.190) (-2820.201) (-2813.425) [-2813.431] -- 0:04:51 446000 -- (-2820.782) (-2827.073) [-2825.556] (-2826.222) * (-2817.176) (-2818.986) [-2815.398] (-2811.524) -- 0:04:50 446500 -- [-2825.506] (-2819.672) (-2820.889) (-2818.048) * [-2809.694] (-2818.026) (-2819.139) (-2816.549) -- 0:04:50 447000 -- (-2818.212) (-2811.179) (-2820.961) [-2814.570] * [-2819.749] (-2815.106) (-2821.020) (-2817.455) -- 0:04:50 447500 -- (-2818.025) (-2823.239) [-2818.416] (-2821.197) * [-2810.881] (-2810.741) (-2820.885) (-2818.421) -- 0:04:50 448000 -- (-2812.091) [-2817.999] (-2828.098) (-2811.451) * [-2816.741] (-2818.869) (-2816.366) (-2833.599) -- 0:04:49 448500 -- (-2817.297) [-2808.861] (-2824.730) (-2808.432) * (-2816.355) (-2815.515) [-2815.971] (-2826.545) -- 0:04:48 449000 -- (-2835.101) [-2812.896] (-2817.168) (-2820.602) * (-2823.467) (-2810.668) (-2816.978) [-2819.422] -- 0:04:49 449500 -- (-2822.267) (-2813.505) (-2822.164) [-2813.546] * (-2822.494) (-2817.335) (-2816.075) [-2811.627] -- 0:04:49 450000 -- [-2817.242] (-2823.459) (-2811.764) (-2824.939) * (-2811.988) (-2822.983) [-2814.471] (-2819.764) -- 0:04:48 Average standard deviation of split frequencies: 0.005927 450500 -- (-2809.905) [-2820.780] (-2822.498) (-2815.507) * [-2821.520] (-2821.145) (-2827.760) (-2821.838) -- 0:04:47 451000 -- [-2814.088] (-2813.774) (-2819.973) (-2818.538) * [-2814.393] (-2828.147) (-2821.033) (-2811.871) -- 0:04:48 451500 -- (-2814.832) [-2813.230] (-2820.049) (-2817.449) * (-2810.678) (-2810.322) [-2813.965] (-2816.808) -- 0:04:47 452000 -- (-2811.611) (-2817.553) (-2815.948) [-2809.533] * (-2813.252) (-2817.811) [-2811.424] (-2815.718) -- 0:04:47 452500 -- [-2815.686] (-2811.936) (-2816.688) (-2818.683) * [-2811.192] (-2826.641) (-2827.566) (-2810.395) -- 0:04:46 453000 -- (-2824.526) (-2817.985) (-2825.011) [-2818.439] * [-2816.833] (-2824.182) (-2817.942) (-2812.200) -- 0:04:47 453500 -- (-2824.308) [-2813.239] (-2824.457) (-2819.469) * [-2812.315] (-2825.682) (-2820.537) (-2811.492) -- 0:04:46 454000 -- (-2823.880) (-2818.364) [-2817.209] (-2817.058) * [-2816.160] (-2815.814) (-2830.398) (-2812.940) -- 0:04:46 454500 -- (-2820.207) (-2816.781) (-2817.680) [-2822.287] * (-2819.186) (-2820.249) [-2810.544] (-2819.281) -- 0:04:45 455000 -- (-2826.304) (-2815.405) (-2818.598) [-2813.479] * (-2816.150) (-2825.154) (-2820.715) [-2814.646] -- 0:04:46 Average standard deviation of split frequencies: 0.006318 455500 -- (-2824.079) (-2814.888) [-2816.594] (-2815.269) * [-2819.561] (-2813.029) (-2814.687) (-2816.835) -- 0:04:45 456000 -- (-2823.120) [-2814.093] (-2830.571) (-2808.382) * (-2826.613) [-2808.243] (-2825.586) (-2830.515) -- 0:04:45 456500 -- (-2811.974) (-2811.878) [-2821.330] (-2820.940) * (-2813.762) (-2819.829) [-2814.584] (-2813.608) -- 0:04:44 457000 -- (-2828.011) (-2818.679) [-2815.656] (-2817.068) * (-2814.957) (-2814.047) (-2815.138) [-2817.608] -- 0:04:45 457500 -- [-2817.306] (-2820.427) (-2817.920) (-2812.885) * (-2823.195) (-2814.088) [-2819.184] (-2819.696) -- 0:04:44 458000 -- (-2818.712) [-2816.048] (-2810.585) (-2821.319) * (-2817.910) (-2817.930) [-2820.284] (-2817.692) -- 0:04:44 458500 -- (-2812.749) (-2807.258) (-2815.999) [-2817.861] * (-2822.316) (-2818.540) [-2813.047] (-2821.695) -- 0:04:43 459000 -- (-2812.659) (-2808.965) (-2822.972) [-2812.060] * [-2818.349] (-2817.632) (-2812.679) (-2819.904) -- 0:04:44 459500 -- [-2810.638] (-2819.091) (-2814.797) (-2817.069) * (-2820.565) [-2817.738] (-2816.405) (-2817.443) -- 0:04:43 460000 -- [-2813.721] (-2815.170) (-2813.793) (-2807.364) * (-2817.139) (-2815.393) (-2808.525) [-2823.180] -- 0:04:42 Average standard deviation of split frequencies: 0.007618 460500 -- [-2810.800] (-2823.354) (-2821.705) (-2815.137) * (-2813.748) (-2823.303) [-2814.075] (-2811.567) -- 0:04:43 461000 -- (-2822.668) (-2827.253) (-2824.029) [-2809.887] * (-2818.157) (-2813.781) [-2814.170] (-2822.618) -- 0:04:42 461500 -- [-2816.045] (-2818.593) (-2823.248) (-2811.200) * (-2820.212) [-2813.136] (-2814.967) (-2829.850) -- 0:04:42 462000 -- (-2809.623) (-2812.752) [-2812.893] (-2806.474) * (-2813.719) [-2813.783] (-2814.940) (-2815.925) -- 0:04:41 462500 -- (-2805.394) (-2817.430) (-2827.672) [-2805.816] * [-2816.235] (-2809.325) (-2819.202) (-2811.309) -- 0:04:42 463000 -- [-2816.491] (-2813.514) (-2822.662) (-2818.723) * (-2816.809) (-2819.646) [-2810.876] (-2813.338) -- 0:04:41 463500 -- [-2815.710] (-2811.656) (-2824.066) (-2814.882) * (-2818.993) (-2815.088) [-2809.345] (-2817.797) -- 0:04:41 464000 -- (-2820.957) (-2811.014) [-2812.189] (-2809.467) * (-2819.856) (-2808.347) (-2813.571) [-2812.595] -- 0:04:40 464500 -- (-2825.729) (-2817.719) [-2812.552] (-2814.390) * (-2823.857) [-2817.893] (-2813.295) (-2813.866) -- 0:04:41 465000 -- (-2815.169) (-2822.229) (-2816.515) [-2818.248] * [-2807.922] (-2829.876) (-2819.686) (-2813.995) -- 0:04:40 Average standard deviation of split frequencies: 0.007418 465500 -- [-2817.225] (-2822.226) (-2821.307) (-2814.225) * (-2821.472) (-2820.534) [-2815.270] (-2808.014) -- 0:04:40 466000 -- (-2825.748) (-2814.312) (-2813.945) [-2815.487] * [-2811.492] (-2816.007) (-2840.110) (-2822.627) -- 0:04:39 466500 -- (-2827.052) (-2816.257) (-2818.095) [-2816.265] * (-2808.440) (-2821.844) [-2820.815] (-2819.739) -- 0:04:40 467000 -- (-2829.996) (-2807.877) [-2821.076] (-2819.074) * (-2820.082) (-2820.790) [-2822.839] (-2815.366) -- 0:04:39 467500 -- (-2829.123) (-2812.996) (-2819.718) [-2818.481] * (-2818.539) (-2811.598) [-2817.597] (-2825.817) -- 0:04:39 468000 -- [-2815.879] (-2814.594) (-2839.131) (-2818.814) * (-2821.908) [-2807.882] (-2816.429) (-2816.349) -- 0:04:38 468500 -- (-2815.655) [-2810.709] (-2819.898) (-2816.171) * (-2821.922) (-2818.314) [-2816.435] (-2816.232) -- 0:04:39 469000 -- (-2818.113) (-2821.825) [-2815.447] (-2817.072) * (-2822.228) (-2820.015) [-2810.946] (-2815.085) -- 0:04:38 469500 -- (-2818.629) (-2819.543) [-2825.141] (-2819.977) * (-2820.927) (-2813.412) [-2813.879] (-2809.934) -- 0:04:37 470000 -- (-2828.129) [-2820.195] (-2821.290) (-2820.559) * (-2826.391) (-2818.685) [-2812.488] (-2820.576) -- 0:04:38 Average standard deviation of split frequencies: 0.007567 470500 -- (-2822.639) (-2817.726) (-2817.344) [-2808.251] * [-2814.258] (-2817.877) (-2820.548) (-2819.646) -- 0:04:37 471000 -- (-2815.374) [-2815.230] (-2814.460) (-2812.943) * (-2817.522) (-2822.701) [-2815.757] (-2824.406) -- 0:04:37 471500 -- (-2814.940) (-2814.929) [-2810.026] (-2823.754) * (-2822.135) [-2807.532] (-2820.380) (-2821.794) -- 0:04:36 472000 -- (-2821.227) (-2820.910) (-2820.169) [-2810.306] * (-2817.150) (-2819.569) [-2816.480] (-2828.793) -- 0:04:37 472500 -- (-2815.466) (-2817.425) [-2821.199] (-2833.191) * (-2816.744) (-2816.554) [-2812.026] (-2810.453) -- 0:04:36 473000 -- (-2813.467) (-2817.575) [-2822.718] (-2826.237) * (-2810.996) [-2814.787] (-2825.345) (-2834.347) -- 0:04:36 473500 -- [-2811.759] (-2819.124) (-2823.987) (-2820.153) * (-2814.683) (-2819.464) (-2821.147) [-2821.018] -- 0:04:36 474000 -- [-2809.143] (-2819.361) (-2822.815) (-2823.462) * [-2812.165] (-2807.671) (-2817.004) (-2821.365) -- 0:04:36 474500 -- (-2826.103) (-2822.605) (-2813.368) [-2812.264] * (-2814.201) (-2809.910) (-2819.994) [-2816.613] -- 0:04:35 475000 -- (-2815.232) (-2825.174) (-2824.131) [-2816.298] * (-2812.985) (-2816.665) [-2815.847] (-2815.842) -- 0:04:35 Average standard deviation of split frequencies: 0.008033 475500 -- [-2818.703] (-2818.108) (-2826.544) (-2827.604) * (-2813.694) (-2809.463) [-2814.224] (-2821.342) -- 0:04:35 476000 -- (-2817.746) (-2812.878) (-2818.026) [-2818.312] * (-2824.655) (-2812.500) (-2812.756) [-2816.120] -- 0:04:35 476500 -- (-2811.921) (-2825.548) [-2819.021] (-2809.611) * (-2830.085) (-2829.769) (-2819.511) [-2813.465] -- 0:04:34 477000 -- [-2811.253] (-2821.463) (-2812.470) (-2812.599) * (-2817.062) [-2816.710] (-2816.575) (-2814.983) -- 0:04:34 477500 -- [-2822.183] (-2822.633) (-2819.785) (-2810.089) * (-2818.420) [-2820.093] (-2817.137) (-2813.738) -- 0:04:34 478000 -- (-2814.881) (-2823.403) [-2810.110] (-2829.975) * (-2825.125) (-2819.408) [-2821.951] (-2813.332) -- 0:04:34 478500 -- (-2816.983) [-2818.845] (-2831.408) (-2814.017) * (-2820.954) (-2816.731) [-2815.310] (-2813.067) -- 0:04:33 479000 -- (-2813.841) (-2822.133) [-2822.717] (-2814.996) * [-2813.606] (-2813.793) (-2820.757) (-2815.444) -- 0:04:33 479500 -- [-2811.628] (-2815.383) (-2813.009) (-2826.185) * (-2823.230) [-2812.350] (-2820.148) (-2816.634) -- 0:04:33 480000 -- (-2814.338) [-2820.995] (-2811.944) (-2812.526) * (-2824.525) (-2817.164) (-2813.097) [-2820.924] -- 0:04:33 Average standard deviation of split frequencies: 0.007192 480500 -- [-2819.242] (-2825.515) (-2822.662) (-2814.783) * [-2815.726] (-2813.244) (-2823.996) (-2817.753) -- 0:04:32 481000 -- [-2818.828] (-2815.730) (-2811.172) (-2820.033) * [-2814.660] (-2811.935) (-2829.730) (-2821.313) -- 0:04:31 481500 -- [-2809.704] (-2824.570) (-2813.588) (-2824.898) * (-2818.714) (-2817.296) (-2826.174) [-2813.947] -- 0:04:32 482000 -- (-2808.252) (-2810.525) (-2822.389) [-2817.830] * (-2810.898) (-2818.135) (-2820.088) [-2824.702] -- 0:04:31 482500 -- (-2821.369) [-2812.333] (-2820.694) (-2820.781) * [-2813.542] (-2826.043) (-2818.793) (-2824.656) -- 0:04:31 483000 -- (-2813.249) [-2815.111] (-2817.534) (-2817.881) * (-2810.136) (-2817.849) [-2809.524] (-2813.182) -- 0:04:30 483500 -- (-2825.240) (-2812.878) (-2815.909) [-2812.999] * (-2814.118) (-2819.151) (-2809.371) [-2812.981] -- 0:04:31 484000 -- (-2816.192) (-2818.599) [-2816.452] (-2820.857) * [-2816.133] (-2816.507) (-2812.479) (-2819.810) -- 0:04:30 484500 -- [-2812.862] (-2822.327) (-2819.141) (-2815.605) * (-2826.066) [-2810.002] (-2813.924) (-2818.733) -- 0:04:30 485000 -- [-2813.267] (-2821.061) (-2814.812) (-2818.263) * (-2822.464) [-2813.174] (-2827.216) (-2815.795) -- 0:04:30 Average standard deviation of split frequencies: 0.007544 485500 -- (-2812.107) [-2813.471] (-2821.808) (-2815.839) * (-2812.105) (-2813.832) (-2826.667) [-2818.645] -- 0:04:30 486000 -- (-2813.823) (-2826.578) (-2822.763) [-2810.407] * [-2818.250] (-2812.486) (-2815.645) (-2820.485) -- 0:04:29 486500 -- (-2814.716) (-2813.889) [-2822.872] (-2817.002) * (-2812.412) [-2814.745] (-2817.444) (-2818.529) -- 0:04:29 487000 -- (-2818.907) (-2811.799) (-2819.165) [-2811.081] * (-2816.601) [-2811.057] (-2820.802) (-2824.144) -- 0:04:29 487500 -- (-2815.393) (-2811.441) [-2813.646] (-2815.684) * (-2823.009) (-2830.471) [-2817.626] (-2820.903) -- 0:04:29 488000 -- (-2822.683) (-2812.040) (-2819.475) [-2819.721] * (-2817.236) (-2830.502) [-2811.101] (-2824.134) -- 0:04:28 488500 -- (-2822.813) (-2815.021) (-2816.021) [-2818.947] * [-2807.404] (-2819.211) (-2813.724) (-2809.593) -- 0:04:28 489000 -- (-2820.854) (-2817.685) [-2819.924] (-2824.835) * [-2816.455] (-2810.509) (-2820.287) (-2812.094) -- 0:04:28 489500 -- [-2811.056] (-2818.728) (-2834.641) (-2822.404) * [-2812.762] (-2816.168) (-2820.115) (-2815.096) -- 0:04:28 490000 -- (-2821.918) [-2812.620] (-2820.659) (-2820.100) * (-2814.255) (-2816.548) (-2814.167) [-2814.065] -- 0:04:27 Average standard deviation of split frequencies: 0.007579 490500 -- (-2822.218) (-2820.004) [-2812.555] (-2814.454) * (-2825.663) (-2821.291) [-2814.762] (-2812.499) -- 0:04:26 491000 -- (-2821.313) [-2822.503] (-2825.448) (-2817.722) * (-2826.815) (-2822.265) (-2820.977) [-2808.792] -- 0:04:27 491500 -- [-2817.032] (-2827.836) (-2824.212) (-2814.653) * [-2820.222] (-2817.748) (-2813.266) (-2825.182) -- 0:04:26 492000 -- (-2822.927) (-2820.465) [-2811.071] (-2818.427) * [-2812.253] (-2827.878) (-2823.819) (-2812.920) -- 0:04:26 492500 -- (-2812.359) [-2820.957] (-2810.192) (-2830.764) * (-2811.580) (-2824.857) [-2822.630] (-2818.034) -- 0:04:25 493000 -- [-2804.517] (-2818.229) (-2814.875) (-2821.828) * (-2816.791) (-2812.108) (-2830.065) [-2814.407] -- 0:04:26 493500 -- (-2817.566) (-2821.812) (-2820.236) [-2818.384] * (-2811.147) (-2825.085) [-2822.356] (-2822.827) -- 0:04:25 494000 -- [-2818.035] (-2809.890) (-2822.169) (-2821.614) * (-2811.422) (-2817.270) (-2818.587) [-2815.092] -- 0:04:25 494500 -- (-2816.809) [-2821.924] (-2819.817) (-2818.887) * (-2817.835) (-2834.421) [-2813.901] (-2821.772) -- 0:04:25 495000 -- (-2817.818) [-2812.352] (-2814.021) (-2821.084) * (-2813.414) (-2810.903) [-2809.227] (-2813.514) -- 0:04:25 Average standard deviation of split frequencies: 0.007181 495500 -- (-2820.022) (-2813.188) (-2821.771) [-2816.980] * (-2817.905) (-2818.463) [-2810.904] (-2823.330) -- 0:04:24 496000 -- (-2813.244) (-2816.933) (-2812.377) [-2818.043] * (-2814.360) [-2806.842] (-2816.546) (-2817.789) -- 0:04:24 496500 -- (-2815.973) [-2819.920] (-2821.222) (-2820.617) * (-2811.991) (-2826.938) (-2816.834) [-2818.203] -- 0:04:24 497000 -- (-2815.808) [-2815.263] (-2815.882) (-2816.809) * (-2813.294) (-2815.445) [-2818.734] (-2821.486) -- 0:04:24 497500 -- (-2816.438) (-2816.338) [-2814.873] (-2814.867) * [-2813.987] (-2810.858) (-2827.579) (-2828.271) -- 0:04:23 498000 -- (-2816.670) [-2814.083] (-2814.921) (-2812.294) * [-2817.897] (-2812.892) (-2810.795) (-2820.403) -- 0:04:23 498500 -- [-2811.236] (-2829.478) (-2810.000) (-2814.574) * (-2819.010) (-2818.818) [-2809.254] (-2822.996) -- 0:04:23 499000 -- [-2810.441] (-2826.935) (-2823.427) (-2813.948) * (-2818.125) (-2828.260) [-2811.921] (-2821.106) -- 0:04:23 499500 -- (-2815.477) (-2822.688) [-2808.934] (-2816.648) * (-2815.088) (-2827.782) (-2827.706) [-2816.768] -- 0:04:22 500000 -- [-2819.764] (-2811.392) (-2816.299) (-2815.515) * (-2822.905) (-2826.598) (-2815.016) [-2817.799] -- 0:04:22 Average standard deviation of split frequencies: 0.007428 500500 -- (-2822.846) [-2811.613] (-2822.355) (-2819.560) * (-2816.629) (-2819.932) [-2813.723] (-2817.124) -- 0:04:22 501000 -- (-2827.112) [-2819.144] (-2818.630) (-2810.954) * [-2819.696] (-2812.433) (-2810.593) (-2817.228) -- 0:04:21 501500 -- [-2810.838] (-2821.307) (-2807.943) (-2819.115) * (-2821.736) [-2814.016] (-2813.168) (-2819.904) -- 0:04:21 502000 -- [-2814.092] (-2818.459) (-2820.065) (-2828.538) * [-2814.933] (-2815.159) (-2812.595) (-2826.591) -- 0:04:20 502500 -- [-2811.034] (-2815.339) (-2814.380) (-2812.872) * (-2829.592) (-2820.645) [-2811.677] (-2821.244) -- 0:04:21 503000 -- (-2823.082) (-2822.720) [-2812.667] (-2817.557) * (-2806.376) (-2813.742) [-2814.077] (-2811.844) -- 0:04:20 503500 -- (-2818.638) (-2824.142) (-2811.456) [-2814.676] * [-2814.944] (-2818.149) (-2811.894) (-2813.263) -- 0:04:20 504000 -- (-2822.967) (-2819.976) [-2815.361] (-2826.254) * [-2809.284] (-2816.456) (-2809.084) (-2822.393) -- 0:04:19 504500 -- (-2821.476) (-2809.955) [-2813.748] (-2815.437) * [-2811.814] (-2819.859) (-2814.815) (-2819.854) -- 0:04:20 505000 -- (-2823.753) [-2816.797] (-2826.218) (-2811.278) * (-2816.596) (-2823.789) [-2819.767] (-2814.236) -- 0:04:19 Average standard deviation of split frequencies: 0.007660 505500 -- (-2816.220) (-2822.514) (-2824.146) [-2815.607] * (-2818.561) [-2820.978] (-2816.607) (-2814.962) -- 0:04:19 506000 -- [-2820.647] (-2811.456) (-2825.331) (-2828.644) * (-2813.756) (-2817.633) (-2813.533) [-2810.302] -- 0:04:18 506500 -- [-2809.245] (-2822.173) (-2813.021) (-2816.112) * (-2810.581) [-2812.501] (-2818.923) (-2814.326) -- 0:04:19 507000 -- (-2822.675) (-2816.193) (-2820.165) [-2814.487] * (-2814.306) (-2813.987) [-2810.493] (-2810.354) -- 0:04:18 507500 -- [-2815.925] (-2819.994) (-2812.896) (-2821.382) * [-2818.275] (-2819.523) (-2812.282) (-2819.422) -- 0:04:18 508000 -- (-2811.166) [-2810.169] (-2814.007) (-2822.773) * (-2822.592) [-2811.891] (-2810.841) (-2821.631) -- 0:04:17 508500 -- [-2820.490] (-2816.457) (-2819.200) (-2819.562) * (-2810.975) [-2813.863] (-2816.600) (-2823.358) -- 0:04:18 509000 -- (-2822.085) [-2816.326] (-2815.451) (-2819.388) * [-2818.275] (-2812.185) (-2828.181) (-2816.153) -- 0:04:17 509500 -- (-2817.982) (-2826.537) (-2820.843) [-2815.135] * (-2812.601) (-2821.869) [-2813.095] (-2828.798) -- 0:04:17 510000 -- (-2806.824) [-2820.399] (-2821.082) (-2818.761) * (-2808.599) (-2819.084) (-2819.023) [-2814.508] -- 0:04:16 Average standard deviation of split frequencies: 0.007898 510500 -- (-2822.972) (-2813.111) (-2811.911) [-2812.450] * [-2812.529] (-2814.809) (-2820.407) (-2818.576) -- 0:04:16 511000 -- (-2818.172) (-2812.360) [-2818.453] (-2819.814) * (-2816.274) (-2821.027) [-2815.327] (-2820.858) -- 0:04:16 511500 -- [-2807.054] (-2831.590) (-2813.113) (-2823.208) * (-2813.048) [-2820.452] (-2819.733) (-2832.263) -- 0:04:15 512000 -- (-2819.349) (-2817.186) [-2812.611] (-2822.755) * (-2821.458) (-2821.672) [-2816.894] (-2820.459) -- 0:04:15 512500 -- (-2812.389) (-2816.749) [-2811.409] (-2821.725) * [-2812.362] (-2830.766) (-2821.135) (-2821.964) -- 0:04:15 513000 -- [-2813.365] (-2819.616) (-2812.959) (-2817.694) * (-2827.227) (-2828.022) (-2816.644) [-2814.604] -- 0:04:15 513500 -- (-2817.934) [-2814.623] (-2806.452) (-2823.079) * (-2817.643) (-2829.644) [-2812.813] (-2817.397) -- 0:04:14 514000 -- (-2809.572) (-2810.333) (-2808.802) [-2823.977] * (-2813.744) [-2814.337] (-2817.237) (-2816.759) -- 0:04:14 514500 -- (-2811.646) [-2809.350] (-2821.961) (-2823.658) * (-2818.531) (-2819.406) (-2830.419) [-2817.392] -- 0:04:14 515000 -- [-2815.331] (-2806.484) (-2824.135) (-2825.595) * (-2815.625) (-2815.795) (-2813.999) [-2816.181] -- 0:04:14 Average standard deviation of split frequencies: 0.007106 515500 -- [-2822.796] (-2815.347) (-2812.647) (-2815.293) * (-2813.495) (-2816.993) [-2811.404] (-2817.793) -- 0:04:13 516000 -- (-2820.150) (-2819.484) (-2818.899) [-2806.944] * (-2808.714) (-2815.344) (-2818.850) [-2814.169] -- 0:04:13 516500 -- (-2811.635) (-2822.869) (-2818.599) [-2815.065] * [-2819.407] (-2815.459) (-2812.942) (-2820.086) -- 0:04:13 517000 -- (-2822.551) (-2812.747) [-2806.828] (-2817.856) * (-2820.927) (-2821.537) [-2810.939] (-2824.698) -- 0:04:13 517500 -- (-2818.262) (-2821.146) (-2817.115) [-2812.755] * (-2813.718) (-2819.302) [-2811.340] (-2820.550) -- 0:04:12 518000 -- [-2812.021] (-2818.801) (-2812.822) (-2824.744) * (-2828.636) [-2811.241] (-2815.631) (-2821.334) -- 0:04:13 518500 -- [-2808.522] (-2821.038) (-2820.469) (-2814.154) * [-2815.116] (-2813.356) (-2816.800) (-2811.878) -- 0:04:12 519000 -- (-2816.970) (-2813.117) [-2814.902] (-2817.304) * (-2824.573) [-2813.395] (-2818.232) (-2812.304) -- 0:04:12 519500 -- (-2814.342) (-2813.878) [-2808.739] (-2829.618) * (-2807.937) (-2815.661) (-2821.137) [-2810.406] -- 0:04:11 520000 -- (-2820.750) [-2822.846] (-2819.034) (-2818.663) * (-2810.584) (-2821.366) [-2821.543] (-2821.176) -- 0:04:11 Average standard deviation of split frequencies: 0.006740 520500 -- (-2814.868) (-2812.687) [-2814.673] (-2811.743) * [-2816.082] (-2818.629) (-2815.064) (-2819.027) -- 0:04:11 521000 -- (-2823.960) [-2816.327] (-2814.538) (-2808.539) * (-2818.778) [-2818.700] (-2819.824) (-2823.510) -- 0:04:10 521500 -- (-2823.509) (-2812.794) [-2807.047] (-2817.506) * [-2822.630] (-2823.751) (-2825.179) (-2822.628) -- 0:04:10 522000 -- [-2813.665] (-2820.525) (-2814.906) (-2815.787) * [-2818.496] (-2809.748) (-2815.426) (-2815.354) -- 0:04:10 522500 -- [-2816.123] (-2812.962) (-2822.033) (-2820.751) * (-2812.114) (-2812.981) [-2822.849] (-2817.650) -- 0:04:10 523000 -- (-2817.894) (-2816.142) [-2811.371] (-2817.303) * (-2817.497) [-2807.512] (-2822.911) (-2815.799) -- 0:04:09 523500 -- (-2812.355) (-2820.285) [-2818.735] (-2814.880) * (-2814.167) (-2826.359) [-2817.922] (-2815.439) -- 0:04:09 524000 -- (-2819.227) [-2815.755] (-2816.228) (-2818.305) * [-2820.814] (-2816.778) (-2814.397) (-2813.686) -- 0:04:09 524500 -- (-2816.682) (-2816.298) [-2807.632] (-2828.637) * (-2821.471) [-2821.579] (-2830.463) (-2820.914) -- 0:04:09 525000 -- [-2813.590] (-2813.887) (-2819.679) (-2816.516) * (-2820.667) (-2821.188) [-2812.457] (-2821.082) -- 0:04:08 Average standard deviation of split frequencies: 0.006473 525500 -- (-2815.412) (-2817.134) [-2814.633] (-2812.125) * (-2814.392) (-2820.116) [-2813.867] (-2813.745) -- 0:04:08 526000 -- (-2816.340) (-2813.288) [-2813.523] (-2837.800) * (-2820.799) [-2816.456] (-2813.398) (-2818.527) -- 0:04:08 526500 -- (-2827.790) (-2819.141) (-2816.708) [-2811.969] * (-2820.725) [-2817.083] (-2810.819) (-2814.480) -- 0:04:08 527000 -- (-2809.317) (-2811.349) (-2818.876) [-2810.787] * (-2818.593) (-2826.152) (-2812.112) [-2809.609] -- 0:04:07 527500 -- (-2815.111) (-2812.004) [-2812.433] (-2821.812) * (-2823.162) (-2833.799) [-2811.343] (-2814.099) -- 0:04:07 528000 -- (-2813.143) (-2833.451) (-2816.430) [-2815.088] * [-2815.398] (-2822.380) (-2816.389) (-2819.796) -- 0:04:07 528500 -- (-2818.537) (-2823.268) [-2809.965] (-2822.124) * (-2814.789) (-2821.036) (-2818.652) [-2813.436] -- 0:04:07 529000 -- (-2814.352) (-2811.246) (-2819.451) [-2814.307] * (-2815.620) [-2829.479] (-2826.183) (-2811.946) -- 0:04:06 529500 -- (-2815.783) [-2821.652] (-2826.347) (-2822.461) * (-2817.528) (-2827.629) [-2815.963] (-2819.389) -- 0:04:06 530000 -- (-2828.313) (-2819.835) (-2818.224) [-2809.604] * (-2820.136) (-2824.541) [-2819.995] (-2832.153) -- 0:04:06 Average standard deviation of split frequencies: 0.006317 530500 -- (-2816.833) (-2818.354) [-2821.760] (-2823.019) * (-2822.271) [-2817.708] (-2822.999) (-2819.043) -- 0:04:06 531000 -- (-2814.909) (-2815.707) [-2809.698] (-2819.952) * (-2816.308) (-2823.014) [-2828.583] (-2820.447) -- 0:04:05 531500 -- (-2821.321) [-2811.667] (-2813.029) (-2823.695) * (-2815.149) (-2813.912) [-2824.429] (-2817.362) -- 0:04:05 532000 -- (-2817.135) (-2816.540) (-2817.451) [-2813.382] * (-2820.858) (-2824.323) (-2816.924) [-2816.562] -- 0:04:05 532500 -- (-2814.662) (-2818.019) (-2814.310) [-2812.323] * (-2823.260) (-2813.025) (-2815.614) [-2809.441] -- 0:04:04 533000 -- (-2823.895) (-2817.894) (-2826.847) [-2810.045] * (-2812.233) (-2819.738) [-2816.998] (-2814.628) -- 0:04:04 533500 -- (-2820.470) [-2821.180] (-2820.946) (-2813.221) * (-2814.822) [-2822.101] (-2822.518) (-2815.590) -- 0:04:03 534000 -- (-2821.776) (-2811.746) (-2820.940) [-2812.564] * [-2805.737] (-2812.760) (-2814.800) (-2818.143) -- 0:04:04 534500 -- (-2817.262) (-2816.356) (-2814.552) [-2812.511] * (-2821.177) [-2807.072] (-2817.894) (-2818.085) -- 0:04:03 535000 -- (-2813.728) (-2825.921) [-2815.032] (-2814.743) * (-2819.446) (-2817.722) (-2823.726) [-2815.977] -- 0:04:03 Average standard deviation of split frequencies: 0.006840 535500 -- (-2817.813) (-2811.772) (-2823.994) [-2811.101] * (-2817.776) [-2823.686] (-2820.881) (-2809.875) -- 0:04:02 536000 -- [-2813.841] (-2827.438) (-2820.095) (-2814.925) * (-2815.429) [-2815.110] (-2809.833) (-2819.048) -- 0:04:03 536500 -- [-2815.482] (-2815.537) (-2813.172) (-2814.948) * [-2813.699] (-2811.116) (-2818.210) (-2813.917) -- 0:04:02 537000 -- (-2817.326) (-2831.176) (-2822.630) [-2817.836] * (-2819.473) [-2815.662] (-2817.451) (-2811.822) -- 0:04:02 537500 -- (-2816.910) (-2813.851) [-2818.937] (-2814.078) * (-2817.179) (-2810.203) (-2828.718) [-2818.922] -- 0:04:02 538000 -- (-2823.489) (-2817.076) (-2822.665) [-2809.564] * (-2814.132) [-2813.601] (-2822.013) (-2818.445) -- 0:04:02 538500 -- [-2815.842] (-2817.129) (-2814.423) (-2816.354) * (-2819.291) (-2813.943) [-2810.910] (-2813.692) -- 0:04:01 539000 -- (-2819.315) [-2812.304] (-2807.361) (-2819.393) * (-2819.880) [-2808.791] (-2812.282) (-2813.684) -- 0:04:01 539500 -- (-2815.976) [-2812.175] (-2817.378) (-2820.236) * (-2819.477) (-2816.463) (-2811.754) [-2814.553] -- 0:04:01 540000 -- (-2814.155) (-2815.855) (-2806.263) [-2816.801] * (-2815.889) (-2812.030) [-2809.085] (-2819.457) -- 0:04:01 Average standard deviation of split frequencies: 0.007556 540500 -- (-2817.602) [-2806.652] (-2817.603) (-2817.868) * (-2822.442) [-2813.812] (-2815.792) (-2811.426) -- 0:04:00 541000 -- (-2817.113) [-2812.215] (-2817.822) (-2822.465) * (-2820.783) (-2817.108) (-2820.336) [-2810.763] -- 0:04:00 541500 -- [-2814.095] (-2823.976) (-2816.271) (-2824.307) * (-2809.133) [-2814.966] (-2826.791) (-2818.821) -- 0:04:00 542000 -- (-2823.058) [-2810.237] (-2829.044) (-2827.563) * (-2816.982) (-2815.916) [-2814.123] (-2814.832) -- 0:03:59 542500 -- (-2821.266) (-2820.846) (-2821.623) [-2817.099] * (-2818.165) (-2816.943) [-2823.373] (-2811.219) -- 0:03:59 543000 -- (-2816.088) (-2822.680) (-2834.898) [-2812.689] * [-2808.819] (-2809.963) (-2825.233) (-2827.039) -- 0:03:59 543500 -- (-2818.574) (-2821.401) [-2826.982] (-2815.455) * (-2818.111) (-2815.325) (-2826.185) [-2815.297] -- 0:03:59 544000 -- (-2822.555) (-2812.431) (-2812.856) [-2808.478] * [-2818.560] (-2811.104) (-2811.360) (-2818.570) -- 0:03:58 544500 -- (-2817.692) [-2815.796] (-2817.683) (-2813.546) * [-2810.159] (-2807.554) (-2819.709) (-2827.204) -- 0:03:58 545000 -- (-2821.256) (-2822.302) (-2820.572) [-2810.889] * (-2818.473) (-2817.552) [-2816.266] (-2842.244) -- 0:03:57 Average standard deviation of split frequencies: 0.008058 545500 -- [-2808.466] (-2808.438) (-2827.842) (-2810.660) * (-2810.506) (-2812.172) (-2813.191) [-2817.177] -- 0:03:58 546000 -- (-2820.217) [-2818.216] (-2829.624) (-2817.130) * (-2812.276) (-2817.146) [-2807.553] (-2816.653) -- 0:03:57 546500 -- (-2821.861) [-2819.395] (-2836.960) (-2819.180) * (-2812.541) (-2812.846) [-2807.274] (-2825.184) -- 0:03:57 547000 -- (-2822.813) [-2820.988] (-2832.318) (-2818.220) * [-2808.748] (-2815.963) (-2811.158) (-2833.611) -- 0:03:56 547500 -- (-2820.035) [-2817.003] (-2821.601) (-2816.476) * (-2809.748) (-2835.241) [-2811.793] (-2828.428) -- 0:03:57 548000 -- (-2821.941) (-2809.384) (-2827.916) [-2819.058] * (-2808.542) (-2821.389) (-2821.949) [-2830.704] -- 0:03:56 548500 -- [-2811.473] (-2824.726) (-2821.352) (-2823.982) * [-2808.859] (-2815.159) (-2823.827) (-2821.995) -- 0:03:56 549000 -- [-2818.880] (-2822.161) (-2826.169) (-2816.818) * [-2811.548] (-2817.285) (-2815.956) (-2821.265) -- 0:03:55 549500 -- [-2816.437] (-2822.181) (-2821.492) (-2826.051) * (-2825.024) (-2811.264) [-2815.719] (-2834.139) -- 0:03:56 550000 -- (-2821.481) [-2813.765] (-2817.250) (-2815.682) * (-2815.973) [-2819.205] (-2818.445) (-2811.379) -- 0:03:55 Average standard deviation of split frequencies: 0.007895 550500 -- (-2826.806) (-2817.115) [-2823.500] (-2817.994) * [-2818.925] (-2813.990) (-2811.792) (-2821.687) -- 0:03:55 551000 -- (-2818.071) (-2823.298) [-2811.281] (-2823.991) * (-2820.516) (-2814.783) [-2817.024] (-2814.033) -- 0:03:54 551500 -- (-2824.922) (-2815.163) [-2816.275] (-2825.430) * [-2822.427] (-2813.723) (-2811.206) (-2816.354) -- 0:03:55 552000 -- (-2812.232) [-2812.772] (-2837.810) (-2823.084) * [-2818.665] (-2817.855) (-2819.436) (-2816.906) -- 0:03:54 552500 -- (-2813.500) (-2819.473) (-2828.411) [-2817.520] * [-2816.011] (-2818.669) (-2811.738) (-2825.095) -- 0:03:54 553000 -- (-2820.591) [-2809.866] (-2825.781) (-2816.826) * (-2818.196) (-2820.781) (-2820.792) [-2819.752] -- 0:03:53 553500 -- [-2821.725] (-2822.736) (-2818.502) (-2820.084) * [-2813.863] (-2818.398) (-2818.790) (-2817.140) -- 0:03:53 554000 -- (-2815.489) (-2831.685) [-2818.889] (-2821.053) * (-2817.397) [-2823.139] (-2823.799) (-2819.787) -- 0:03:53 554500 -- (-2823.532) [-2819.403] (-2812.854) (-2824.077) * (-2814.014) [-2806.256] (-2822.366) (-2828.345) -- 0:03:52 555000 -- (-2815.860) [-2814.687] (-2816.826) (-2817.936) * (-2821.534) (-2806.775) [-2820.919] (-2818.678) -- 0:03:53 Average standard deviation of split frequencies: 0.007819 555500 -- (-2821.463) (-2822.651) [-2808.752] (-2819.256) * [-2817.076] (-2810.251) (-2816.542) (-2813.052) -- 0:03:52 556000 -- (-2819.085) (-2814.869) (-2818.207) [-2813.698] * [-2812.945] (-2815.175) (-2809.533) (-2822.825) -- 0:03:52 556500 -- (-2828.290) (-2816.659) (-2819.308) [-2813.616] * (-2816.022) (-2822.845) (-2825.428) [-2815.009] -- 0:03:52 557000 -- (-2813.878) [-2807.963] (-2814.069) (-2812.031) * (-2822.407) (-2823.614) (-2815.305) [-2816.978] -- 0:03:52 557500 -- (-2821.697) [-2819.121] (-2824.181) (-2819.326) * (-2815.476) (-2817.153) (-2825.724) [-2817.767] -- 0:03:51 558000 -- (-2815.581) [-2813.627] (-2818.462) (-2816.027) * (-2813.167) (-2820.771) [-2814.981] (-2830.022) -- 0:03:51 558500 -- [-2812.722] (-2812.863) (-2813.665) (-2812.971) * (-2816.660) (-2810.944) (-2815.765) [-2821.397] -- 0:03:51 559000 -- (-2829.654) (-2817.304) [-2812.587] (-2815.844) * (-2825.029) (-2823.145) (-2813.950) [-2812.307] -- 0:03:51 559500 -- [-2819.027] (-2814.078) (-2813.604) (-2821.919) * (-2812.912) [-2817.609] (-2818.467) (-2835.103) -- 0:03:50 560000 -- [-2824.543] (-2817.339) (-2815.764) (-2827.422) * [-2813.843] (-2825.482) (-2826.752) (-2813.218) -- 0:03:50 Average standard deviation of split frequencies: 0.008501 560500 -- (-2827.443) (-2820.674) [-2810.774] (-2831.009) * (-2812.923) (-2824.872) (-2814.337) [-2817.676] -- 0:03:50 561000 -- (-2815.590) [-2818.807] (-2821.777) (-2824.632) * (-2811.701) (-2820.973) [-2821.677] (-2815.780) -- 0:03:50 561500 -- [-2817.088] (-2814.659) (-2821.351) (-2814.096) * (-2815.615) [-2811.504] (-2814.578) (-2819.734) -- 0:03:49 562000 -- (-2813.890) (-2822.578) (-2813.710) [-2815.488] * (-2811.652) (-2817.871) [-2819.286] (-2820.068) -- 0:03:49 562500 -- [-2817.030] (-2812.753) (-2806.561) (-2810.556) * (-2810.465) (-2821.895) (-2815.450) [-2820.316] -- 0:03:49 563000 -- (-2813.860) (-2824.022) (-2816.104) [-2811.986] * (-2822.243) [-2817.110] (-2821.390) (-2817.703) -- 0:03:48 563500 -- (-2811.698) [-2817.265] (-2823.699) (-2816.846) * [-2811.428] (-2823.281) (-2815.969) (-2813.727) -- 0:03:48 564000 -- (-2815.141) (-2818.644) [-2820.850] (-2822.839) * [-2813.153] (-2816.183) (-2813.277) (-2818.286) -- 0:03:48 564500 -- (-2817.011) (-2812.193) [-2808.892] (-2819.174) * (-2815.696) (-2823.645) (-2813.040) [-2812.399] -- 0:03:48 565000 -- (-2824.689) [-2810.603] (-2821.376) (-2824.885) * (-2820.259) (-2818.775) [-2812.016] (-2815.063) -- 0:03:47 Average standard deviation of split frequencies: 0.007866 565500 -- (-2812.640) (-2822.989) [-2808.308] (-2820.475) * (-2825.717) (-2820.857) [-2823.596] (-2827.274) -- 0:03:47 566000 -- (-2817.738) [-2814.076] (-2829.158) (-2815.570) * (-2819.854) (-2815.304) [-2815.788] (-2839.114) -- 0:03:46 566500 -- [-2812.325] (-2807.619) (-2823.205) (-2818.207) * [-2811.637] (-2817.129) (-2830.345) (-2824.181) -- 0:03:47 567000 -- (-2818.663) [-2814.209] (-2823.374) (-2817.031) * (-2820.809) (-2824.620) (-2811.459) [-2813.308] -- 0:03:46 567500 -- [-2817.341] (-2817.585) (-2816.573) (-2815.645) * (-2814.889) [-2819.699] (-2818.581) (-2829.662) -- 0:03:46 568000 -- (-2819.729) [-2816.502] (-2830.099) (-2813.841) * [-2810.634] (-2813.334) (-2813.659) (-2819.141) -- 0:03:45 568500 -- (-2810.794) [-2813.084] (-2817.780) (-2818.841) * (-2821.332) (-2815.288) (-2819.884) [-2815.302] -- 0:03:46 569000 -- (-2824.812) (-2810.964) [-2814.223] (-2826.037) * (-2818.694) (-2811.066) [-2810.945] (-2826.032) -- 0:03:45 569500 -- [-2810.318] (-2818.002) (-2817.063) (-2821.754) * (-2826.957) (-2822.199) (-2822.454) [-2819.716] -- 0:03:45 570000 -- (-2822.504) [-2819.633] (-2818.716) (-2828.630) * (-2823.294) (-2819.454) (-2824.733) [-2819.665] -- 0:03:44 Average standard deviation of split frequencies: 0.008536 570500 -- [-2826.794] (-2816.595) (-2825.629) (-2812.636) * (-2826.721) (-2815.035) (-2817.116) [-2816.285] -- 0:03:45 571000 -- (-2822.338) [-2816.680] (-2816.313) (-2812.145) * (-2818.691) (-2822.597) (-2816.991) [-2816.615] -- 0:03:44 571500 -- (-2820.704) (-2822.805) (-2821.686) [-2813.095] * (-2814.080) (-2816.571) (-2815.432) [-2817.694] -- 0:03:44 572000 -- [-2807.135] (-2820.781) (-2825.303) (-2814.389) * (-2829.103) [-2813.840] (-2812.248) (-2817.059) -- 0:03:43 572500 -- (-2816.737) [-2807.194] (-2819.533) (-2810.483) * (-2811.050) (-2809.168) (-2822.603) [-2809.568] -- 0:03:44 573000 -- [-2814.614] (-2820.669) (-2815.724) (-2816.146) * [-2815.903] (-2807.929) (-2811.943) (-2814.956) -- 0:03:43 573500 -- (-2819.885) [-2820.070] (-2817.958) (-2817.868) * [-2817.375] (-2822.255) (-2820.756) (-2808.850) -- 0:03:43 574000 -- (-2811.718) [-2821.168] (-2812.269) (-2818.743) * [-2816.503] (-2812.477) (-2819.852) (-2817.881) -- 0:03:43 574500 -- [-2814.099] (-2824.313) (-2817.562) (-2817.228) * (-2822.807) (-2815.535) (-2811.838) [-2822.323] -- 0:03:42 575000 -- (-2817.953) (-2817.474) [-2814.514] (-2820.397) * (-2816.635) (-2813.144) (-2814.129) [-2817.572] -- 0:03:42 Average standard deviation of split frequencies: 0.008912 575500 -- (-2819.126) (-2813.938) (-2828.355) [-2818.384] * (-2810.754) [-2816.188] (-2812.695) (-2813.745) -- 0:03:42 576000 -- (-2815.070) (-2825.174) (-2815.344) [-2807.391] * [-2811.344] (-2817.568) (-2816.291) (-2819.109) -- 0:03:42 576500 -- (-2825.228) (-2828.013) [-2810.746] (-2815.765) * (-2816.698) (-2816.325) [-2821.699] (-2814.651) -- 0:03:41 577000 -- (-2821.814) (-2824.977) [-2812.517] (-2812.196) * (-2823.592) (-2816.716) [-2818.537] (-2811.173) -- 0:03:41 577500 -- (-2823.782) [-2826.405] (-2809.980) (-2820.742) * (-2813.414) (-2832.493) [-2811.690] (-2813.703) -- 0:03:40 578000 -- (-2817.765) (-2821.969) (-2816.400) [-2808.535] * (-2813.317) (-2812.999) [-2818.816] (-2822.729) -- 0:03:41 578500 -- (-2817.468) (-2817.451) (-2816.532) [-2813.493] * (-2814.229) [-2819.506] (-2818.517) (-2810.351) -- 0:03:40 579000 -- (-2819.189) (-2821.783) [-2814.010] (-2818.860) * [-2823.579] (-2821.757) (-2813.594) (-2815.961) -- 0:03:40 579500 -- (-2812.792) (-2818.246) (-2822.086) [-2813.813] * [-2814.187] (-2820.357) (-2813.802) (-2817.670) -- 0:03:40 580000 -- (-2813.100) (-2828.526) (-2808.970) [-2809.639] * (-2824.242) [-2816.129] (-2814.539) (-2823.868) -- 0:03:40 Average standard deviation of split frequencies: 0.008660 580500 -- [-2810.756] (-2834.926) (-2823.443) (-2817.629) * (-2822.906) [-2815.662] (-2815.723) (-2808.939) -- 0:03:39 581000 -- (-2809.815) (-2824.565) [-2810.905] (-2818.679) * (-2818.196) (-2821.495) (-2819.037) [-2813.232] -- 0:03:39 581500 -- (-2814.918) (-2814.255) [-2814.984] (-2814.884) * (-2818.147) (-2811.060) [-2810.001] (-2814.290) -- 0:03:39 582000 -- (-2814.853) (-2815.477) [-2821.800] (-2817.425) * (-2815.789) (-2817.895) [-2809.744] (-2812.345) -- 0:03:39 582500 -- [-2816.771] (-2812.902) (-2817.007) (-2821.361) * (-2818.431) (-2816.778) (-2811.077) [-2812.598] -- 0:03:38 583000 -- [-2815.306] (-2810.957) (-2815.146) (-2826.979) * (-2815.405) (-2810.837) (-2828.754) [-2813.227] -- 0:03:38 583500 -- (-2822.018) [-2812.784] (-2813.120) (-2826.933) * (-2817.054) (-2816.632) [-2815.330] (-2823.166) -- 0:03:38 584000 -- (-2823.290) [-2806.244] (-2817.609) (-2820.108) * (-2821.610) (-2812.439) (-2819.778) [-2818.754] -- 0:03:37 584500 -- (-2820.379) (-2818.475) [-2817.459] (-2814.468) * [-2811.735] (-2813.678) (-2809.301) (-2813.000) -- 0:03:37 585000 -- [-2814.239] (-2822.207) (-2817.460) (-2821.263) * (-2822.037) (-2824.534) (-2812.784) [-2814.269] -- 0:03:37 Average standard deviation of split frequencies: 0.008134 585500 -- (-2810.642) (-2807.368) (-2817.738) [-2820.713] * (-2822.135) (-2813.505) [-2813.990] (-2819.941) -- 0:03:37 586000 -- (-2820.564) (-2806.597) [-2815.091] (-2826.181) * (-2818.122) [-2806.741] (-2829.747) (-2820.971) -- 0:03:36 586500 -- [-2811.712] (-2813.344) (-2813.352) (-2821.552) * [-2817.219] (-2812.097) (-2822.251) (-2820.434) -- 0:03:36 587000 -- [-2818.067] (-2818.014) (-2815.804) (-2820.627) * (-2815.453) (-2819.566) [-2815.609] (-2813.121) -- 0:03:35 587500 -- (-2814.048) (-2811.342) (-2818.100) [-2824.512] * [-2809.943] (-2816.428) (-2821.492) (-2820.028) -- 0:03:36 588000 -- (-2812.269) (-2817.002) [-2810.900] (-2816.744) * [-2811.485] (-2822.967) (-2821.012) (-2820.234) -- 0:03:35 588500 -- (-2806.216) [-2824.912] (-2816.869) (-2813.030) * [-2822.910] (-2825.432) (-2814.437) (-2814.015) -- 0:03:35 589000 -- (-2812.831) (-2810.374) (-2815.145) [-2813.296] * (-2817.987) (-2824.504) [-2807.794] (-2817.678) -- 0:03:34 589500 -- (-2813.205) (-2820.339) (-2811.931) [-2812.820] * (-2818.294) (-2821.048) (-2811.812) [-2815.710] -- 0:03:35 590000 -- (-2813.732) (-2817.949) [-2812.308] (-2818.969) * (-2824.301) (-2816.970) (-2811.221) [-2810.757] -- 0:03:34 Average standard deviation of split frequencies: 0.007183 590500 -- (-2825.926) (-2812.307) [-2824.483] (-2824.495) * (-2811.303) (-2817.476) [-2810.718] (-2810.907) -- 0:03:34 591000 -- (-2824.263) [-2812.454] (-2828.745) (-2815.022) * (-2824.184) (-2808.234) (-2815.962) [-2812.971] -- 0:03:33 591500 -- [-2808.549] (-2814.064) (-2812.895) (-2817.139) * (-2826.121) (-2823.750) [-2808.191] (-2813.523) -- 0:03:34 592000 -- (-2812.003) (-2811.451) (-2812.255) [-2809.072] * (-2824.244) [-2818.894] (-2828.722) (-2815.526) -- 0:03:33 592500 -- [-2818.144] (-2810.777) (-2819.281) (-2810.503) * (-2820.278) (-2820.754) (-2817.435) [-2823.046] -- 0:03:33 593000 -- (-2812.273) (-2812.120) [-2816.364] (-2818.492) * (-2817.024) (-2823.060) (-2824.814) [-2819.893] -- 0:03:32 593500 -- [-2811.584] (-2812.602) (-2815.108) (-2814.330) * (-2814.208) (-2833.129) [-2813.412] (-2817.363) -- 0:03:33 594000 -- (-2816.344) (-2811.471) (-2815.563) [-2812.432] * (-2817.719) (-2819.436) (-2810.799) [-2816.247] -- 0:03:32 594500 -- (-2818.618) [-2811.420] (-2825.025) (-2816.724) * (-2811.389) (-2818.757) (-2811.202) [-2813.100] -- 0:03:32 595000 -- (-2812.963) (-2821.156) [-2814.127] (-2808.614) * [-2815.521] (-2817.692) (-2813.298) (-2814.807) -- 0:03:31 Average standard deviation of split frequencies: 0.006943 595500 -- (-2819.960) [-2816.690] (-2822.272) (-2819.542) * [-2817.061] (-2821.601) (-2816.674) (-2826.320) -- 0:03:31 596000 -- (-2813.474) (-2815.495) (-2814.333) [-2817.667] * (-2818.753) [-2817.356] (-2811.640) (-2825.251) -- 0:03:31 596500 -- (-2816.634) (-2811.277) (-2822.364) [-2811.117] * (-2816.534) (-2823.354) (-2824.252) [-2818.537] -- 0:03:31 597000 -- (-2821.581) (-2806.752) (-2838.228) [-2814.258] * [-2811.277] (-2812.079) (-2819.253) (-2812.071) -- 0:03:30 597500 -- (-2818.593) [-2813.530] (-2822.820) (-2813.806) * (-2821.232) (-2820.755) [-2813.020] (-2822.219) -- 0:03:30 598000 -- (-2821.135) [-2808.002] (-2820.364) (-2826.421) * (-2821.691) [-2826.564] (-2808.760) (-2816.044) -- 0:03:30 598500 -- (-2833.024) [-2821.136] (-2820.677) (-2823.094) * (-2809.750) (-2814.912) (-2818.470) [-2819.181] -- 0:03:29 599000 -- (-2831.522) (-2821.450) (-2816.025) [-2819.732] * (-2819.154) (-2820.957) (-2817.350) [-2819.019] -- 0:03:30 599500 -- (-2832.550) [-2813.876] (-2822.586) (-2811.731) * (-2817.013) (-2815.870) (-2827.587) [-2817.897] -- 0:03:29 600000 -- (-2841.758) (-2812.189) [-2815.655] (-2819.862) * (-2818.377) (-2818.983) (-2815.182) [-2812.713] -- 0:03:29 Average standard deviation of split frequencies: 0.007761 600500 -- (-2838.362) [-2815.782] (-2819.588) (-2821.345) * (-2823.985) (-2817.351) (-2819.749) [-2815.420] -- 0:03:28 601000 -- (-2826.369) [-2815.817] (-2819.440) (-2813.636) * (-2822.133) (-2822.159) [-2825.408] (-2815.602) -- 0:03:29 601500 -- (-2817.222) (-2814.240) (-2820.110) [-2814.531] * (-2818.079) (-2813.192) (-2823.289) [-2811.497] -- 0:03:28 602000 -- (-2818.977) (-2819.499) (-2825.826) [-2815.757] * (-2810.612) (-2811.318) (-2815.537) [-2816.430] -- 0:03:28 602500 -- (-2813.183) [-2814.733] (-2824.186) (-2816.178) * [-2812.692] (-2814.364) (-2819.609) (-2821.334) -- 0:03:27 603000 -- (-2829.135) (-2818.085) (-2812.107) [-2813.494] * [-2833.002] (-2819.662) (-2812.219) (-2822.104) -- 0:03:28 603500 -- [-2819.775] (-2820.969) (-2827.964) (-2822.416) * [-2813.818] (-2813.568) (-2814.673) (-2816.383) -- 0:03:27 604000 -- [-2810.704] (-2810.088) (-2821.288) (-2813.874) * (-2817.097) (-2819.646) (-2819.287) [-2818.010] -- 0:03:27 604500 -- (-2814.545) [-2810.895] (-2822.512) (-2821.204) * (-2820.644) (-2829.702) [-2822.049] (-2818.097) -- 0:03:26 605000 -- (-2816.241) [-2810.183] (-2836.547) (-2816.512) * (-2823.623) (-2816.054) (-2815.740) [-2821.153] -- 0:03:26 Average standard deviation of split frequencies: 0.007693 605500 -- (-2825.168) (-2809.316) (-2826.829) [-2814.171] * (-2816.426) [-2814.280] (-2807.758) (-2823.199) -- 0:03:26 606000 -- (-2817.412) (-2810.457) [-2815.657] (-2813.655) * [-2821.644] (-2823.014) (-2827.358) (-2818.755) -- 0:03:26 606500 -- (-2817.355) [-2820.227] (-2811.737) (-2821.467) * (-2815.299) (-2810.430) [-2813.504] (-2817.032) -- 0:03:25 607000 -- (-2816.174) (-2823.681) (-2819.705) [-2815.703] * (-2816.780) [-2813.100] (-2819.826) (-2818.623) -- 0:03:25 607500 -- [-2812.559] (-2820.225) (-2826.363) (-2815.714) * [-2821.364] (-2811.073) (-2815.854) (-2820.127) -- 0:03:25 608000 -- (-2817.800) (-2812.942) [-2823.142] (-2814.053) * (-2819.245) [-2811.520] (-2815.876) (-2823.987) -- 0:03:25 608500 -- (-2812.767) (-2819.190) [-2811.453] (-2819.678) * (-2821.597) (-2822.242) [-2811.436] (-2826.110) -- 0:03:24 609000 -- (-2825.518) (-2819.924) [-2814.063] (-2818.999) * (-2824.231) (-2821.394) [-2816.287] (-2817.474) -- 0:03:24 609500 -- (-2817.411) (-2812.744) [-2816.595] (-2820.757) * (-2818.386) (-2810.240) [-2814.089] (-2825.585) -- 0:03:24 610000 -- (-2816.132) [-2814.137] (-2818.974) (-2821.153) * (-2818.615) [-2822.787] (-2817.610) (-2812.221) -- 0:03:23 Average standard deviation of split frequencies: 0.007033 610500 -- [-2813.837] (-2817.282) (-2813.101) (-2818.901) * [-2814.760] (-2812.960) (-2813.109) (-2816.801) -- 0:03:23 611000 -- (-2821.318) (-2820.246) (-2823.258) [-2816.021] * [-2817.733] (-2815.418) (-2820.269) (-2833.412) -- 0:03:23 611500 -- (-2818.564) (-2822.449) (-2816.247) [-2816.796] * (-2818.460) [-2814.251] (-2812.626) (-2828.749) -- 0:03:23 612000 -- (-2811.696) [-2812.169] (-2817.356) (-2813.983) * [-2813.976] (-2818.635) (-2814.222) (-2818.767) -- 0:03:22 612500 -- [-2810.648] (-2809.213) (-2815.247) (-2813.235) * (-2821.338) (-2832.034) [-2812.865] (-2812.599) -- 0:03:22 613000 -- (-2827.233) (-2822.048) (-2818.276) [-2815.470] * (-2818.986) (-2820.927) (-2822.543) [-2814.334] -- 0:03:22 613500 -- (-2822.957) (-2820.219) (-2818.616) [-2811.527] * (-2825.962) [-2819.078] (-2809.086) (-2814.007) -- 0:03:22 614000 -- (-2813.631) (-2817.885) (-2819.207) [-2819.663] * (-2823.319) (-2815.161) (-2817.070) [-2822.661] -- 0:03:21 614500 -- (-2816.167) (-2820.102) (-2814.198) [-2823.593] * (-2826.353) (-2832.238) [-2813.655] (-2809.088) -- 0:03:21 615000 -- (-2813.590) (-2816.917) (-2817.406) [-2816.986] * [-2812.714] (-2820.076) (-2822.787) (-2816.420) -- 0:03:21 Average standard deviation of split frequencies: 0.007568 615500 -- (-2816.289) (-2821.177) [-2812.726] (-2814.306) * (-2823.360) [-2810.564] (-2815.394) (-2812.968) -- 0:03:21 616000 -- [-2811.298] (-2812.669) (-2820.627) (-2828.382) * (-2827.220) [-2813.861] (-2815.736) (-2814.585) -- 0:03:20 616500 -- [-2815.804] (-2820.304) (-2814.045) (-2814.002) * (-2820.628) (-2809.023) (-2821.563) [-2812.012] -- 0:03:20 617000 -- (-2814.728) (-2815.069) [-2813.701] (-2811.247) * [-2811.461] (-2814.163) (-2820.411) (-2813.572) -- 0:03:20 617500 -- (-2828.958) (-2820.045) [-2811.620] (-2818.481) * [-2817.706] (-2825.541) (-2814.553) (-2821.808) -- 0:03:20 618000 -- (-2818.704) (-2815.144) [-2815.213] (-2814.765) * (-2814.204) (-2819.441) (-2818.641) [-2810.536] -- 0:03:19 618500 -- [-2809.039] (-2815.990) (-2814.749) (-2809.191) * [-2813.262] (-2815.666) (-2823.444) (-2812.420) -- 0:03:19 619000 -- (-2824.532) (-2819.725) (-2817.231) [-2808.811] * (-2815.382) (-2822.095) [-2820.607] (-2829.353) -- 0:03:19 619500 -- (-2832.143) (-2813.418) [-2810.715] (-2815.891) * [-2816.613] (-2822.005) (-2816.289) (-2817.864) -- 0:03:19 620000 -- (-2817.872) [-2814.370] (-2822.414) (-2819.512) * (-2808.455) [-2822.507] (-2820.850) (-2817.050) -- 0:03:18 Average standard deviation of split frequencies: 0.007173 620500 -- (-2817.848) [-2810.316] (-2823.369) (-2813.297) * [-2811.782] (-2812.132) (-2820.522) (-2817.813) -- 0:03:18 621000 -- [-2808.442] (-2813.589) (-2818.471) (-2819.967) * (-2812.415) (-2818.153) [-2812.395] (-2813.500) -- 0:03:18 621500 -- (-2813.350) (-2811.493) [-2814.532] (-2817.313) * (-2815.243) (-2816.812) (-2810.983) [-2812.844] -- 0:03:17 622000 -- (-2823.058) [-2808.648] (-2815.770) (-2811.311) * (-2805.142) (-2822.477) (-2815.794) [-2818.471] -- 0:03:17 622500 -- (-2811.687) [-2815.618] (-2818.511) (-2812.981) * [-2817.706] (-2819.234) (-2820.253) (-2820.897) -- 0:03:17 623000 -- (-2820.587) (-2810.235) (-2820.191) [-2815.211] * [-2817.660] (-2817.002) (-2819.580) (-2809.672) -- 0:03:17 623500 -- (-2809.797) (-2811.721) [-2814.732] (-2820.273) * (-2821.994) [-2812.072] (-2814.383) (-2825.638) -- 0:03:16 624000 -- (-2812.557) (-2811.240) [-2813.276] (-2816.225) * (-2813.854) (-2820.333) [-2811.469] (-2816.200) -- 0:03:17 624500 -- (-2815.888) (-2821.441) (-2819.754) [-2815.747] * (-2810.414) (-2824.148) (-2814.435) [-2809.057] -- 0:03:16 625000 -- [-2825.104] (-2823.402) (-2812.414) (-2811.683) * (-2810.449) [-2822.095] (-2813.045) (-2816.948) -- 0:03:16 Average standard deviation of split frequencies: 0.006861 625500 -- (-2829.492) (-2814.952) (-2816.292) [-2813.861] * (-2818.687) [-2815.326] (-2810.888) (-2815.667) -- 0:03:15 626000 -- (-2814.813) [-2821.725] (-2818.286) (-2812.704) * (-2817.302) (-2812.816) [-2814.349] (-2820.315) -- 0:03:15 626500 -- (-2818.980) (-2811.536) [-2810.824] (-2813.993) * (-2812.953) [-2813.860] (-2820.690) (-2814.722) -- 0:03:15 627000 -- (-2819.314) (-2818.139) (-2813.583) [-2819.787] * (-2815.085) (-2811.562) (-2815.315) [-2825.602] -- 0:03:15 627500 -- [-2819.075] (-2817.247) (-2812.098) (-2814.014) * (-2822.709) [-2813.105] (-2825.313) (-2816.994) -- 0:03:14 628000 -- [-2817.035] (-2820.530) (-2822.256) (-2819.304) * (-2815.749) (-2812.577) [-2820.954] (-2835.364) -- 0:03:14 628500 -- (-2818.779) (-2817.347) [-2816.053] (-2815.138) * (-2815.782) [-2811.909] (-2815.083) (-2827.575) -- 0:03:14 629000 -- [-2816.559] (-2821.603) (-2817.378) (-2815.756) * (-2823.836) [-2809.582] (-2811.014) (-2820.143) -- 0:03:14 629500 -- [-2816.722] (-2819.294) (-2817.514) (-2821.506) * (-2822.644) (-2814.691) (-2828.104) [-2813.154] -- 0:03:13 630000 -- [-2818.257] (-2818.090) (-2815.477) (-2815.051) * (-2813.807) [-2813.869] (-2830.096) (-2818.608) -- 0:03:13 Average standard deviation of split frequencies: 0.006063 630500 -- [-2812.566] (-2816.703) (-2821.167) (-2811.482) * (-2815.623) (-2817.829) (-2821.424) [-2812.886] -- 0:03:13 631000 -- (-2822.490) (-2829.939) (-2817.318) [-2811.925] * (-2823.771) [-2812.051] (-2813.880) (-2811.697) -- 0:03:12 631500 -- (-2817.543) [-2824.776] (-2821.486) (-2824.570) * (-2813.827) (-2819.126) (-2828.139) [-2813.133] -- 0:03:12 632000 -- (-2822.671) (-2810.656) [-2807.977] (-2811.933) * (-2812.216) [-2814.856] (-2819.286) (-2813.560) -- 0:03:12 632500 -- (-2822.324) [-2815.437] (-2824.948) (-2813.920) * (-2808.866) (-2815.249) (-2809.620) [-2812.360] -- 0:03:12 633000 -- (-2819.077) (-2813.909) [-2813.361] (-2828.428) * (-2814.920) [-2812.098] (-2811.500) (-2809.273) -- 0:03:11 633500 -- (-2812.337) (-2820.388) (-2816.588) [-2811.209] * (-2815.375) [-2819.308] (-2820.699) (-2811.044) -- 0:03:11 634000 -- [-2817.374] (-2819.337) (-2819.333) (-2824.073) * (-2817.344) [-2810.625] (-2818.531) (-2826.232) -- 0:03:11 634500 -- [-2818.976] (-2815.301) (-2816.950) (-2821.979) * [-2815.155] (-2819.132) (-2829.698) (-2827.053) -- 0:03:11 635000 -- (-2810.069) [-2824.218] (-2816.347) (-2821.467) * [-2812.159] (-2823.211) (-2827.765) (-2820.967) -- 0:03:10 Average standard deviation of split frequencies: 0.005600 635500 -- (-2816.953) (-2817.123) [-2823.967] (-2818.353) * (-2821.477) [-2815.282] (-2811.267) (-2812.103) -- 0:03:10 636000 -- [-2811.440] (-2818.055) (-2822.584) (-2818.991) * (-2817.979) [-2812.738] (-2818.541) (-2824.928) -- 0:03:10 636500 -- (-2818.955) (-2813.166) [-2814.962] (-2827.909) * [-2823.459] (-2812.962) (-2822.736) (-2819.013) -- 0:03:10 637000 -- (-2820.049) [-2810.653] (-2814.772) (-2817.999) * (-2820.634) [-2815.171] (-2814.025) (-2817.230) -- 0:03:09 637500 -- (-2811.084) (-2815.225) (-2819.157) [-2819.439] * (-2814.770) (-2820.117) [-2811.408] (-2813.709) -- 0:03:09 638000 -- (-2827.550) (-2828.368) (-2820.624) [-2812.527] * (-2820.895) (-2812.825) [-2816.439] (-2815.092) -- 0:03:09 638500 -- (-2815.468) (-2808.978) [-2816.793] (-2818.315) * (-2809.116) [-2821.863] (-2811.979) (-2816.925) -- 0:03:09 639000 -- (-2811.116) (-2814.722) [-2817.326] (-2819.063) * [-2810.203] (-2816.134) (-2820.491) (-2813.908) -- 0:03:08 639500 -- [-2815.571] (-2816.537) (-2808.929) (-2821.745) * [-2815.687] (-2819.951) (-2818.697) (-2827.154) -- 0:03:08 640000 -- (-2819.965) (-2814.628) (-2809.522) [-2815.873] * [-2818.803] (-2816.835) (-2821.238) (-2816.234) -- 0:03:08 Average standard deviation of split frequencies: 0.005314 640500 -- [-2816.524] (-2815.851) (-2814.304) (-2814.172) * (-2814.605) (-2806.827) [-2813.048] (-2816.631) -- 0:03:08 641000 -- (-2820.259) (-2817.394) [-2814.128] (-2819.409) * (-2825.346) [-2809.752] (-2814.286) (-2816.580) -- 0:03:07 641500 -- [-2809.629] (-2823.070) (-2817.262) (-2808.698) * [-2808.843] (-2817.140) (-2823.694) (-2819.019) -- 0:03:07 642000 -- (-2819.776) (-2818.429) [-2814.919] (-2810.226) * (-2821.159) [-2811.347] (-2823.258) (-2822.379) -- 0:03:07 642500 -- [-2808.024] (-2825.388) (-2823.074) (-2814.648) * (-2824.311) [-2814.378] (-2816.280) (-2819.603) -- 0:03:06 643000 -- (-2815.349) (-2816.673) (-2819.379) [-2808.908] * (-2809.342) (-2814.901) [-2816.680] (-2821.169) -- 0:03:06 643500 -- (-2818.842) [-2812.674] (-2820.311) (-2821.596) * (-2812.013) (-2824.300) [-2812.185] (-2813.726) -- 0:03:06 644000 -- (-2819.507) (-2822.773) (-2812.949) [-2808.694] * [-2811.933] (-2821.923) (-2817.134) (-2818.411) -- 0:03:06 644500 -- (-2821.108) (-2818.471) (-2817.278) [-2814.296] * (-2811.171) [-2822.689] (-2822.445) (-2825.525) -- 0:03:05 645000 -- (-2812.770) (-2818.282) [-2811.301] (-2820.045) * (-2817.477) (-2820.121) [-2813.956] (-2825.252) -- 0:03:05 Average standard deviation of split frequencies: 0.004784 645500 -- (-2817.754) [-2822.469] (-2810.213) (-2821.146) * (-2816.427) (-2818.272) [-2815.285] (-2820.893) -- 0:03:05 646000 -- (-2826.245) (-2814.474) [-2825.928] (-2814.902) * (-2812.538) [-2817.061] (-2821.931) (-2809.270) -- 0:03:05 646500 -- (-2816.502) [-2820.794] (-2809.777) (-2819.673) * (-2812.879) [-2817.283] (-2817.636) (-2820.870) -- 0:03:04 647000 -- (-2820.645) (-2815.846) [-2811.486] (-2814.879) * (-2821.174) (-2825.679) [-2814.594] (-2816.159) -- 0:03:04 647500 -- (-2815.777) [-2818.461] (-2820.980) (-2822.910) * (-2820.442) (-2827.513) [-2809.611] (-2813.407) -- 0:03:04 648000 -- [-2814.797] (-2817.931) (-2823.013) (-2827.515) * (-2809.180) [-2817.252] (-2829.767) (-2833.150) -- 0:03:04 648500 -- [-2815.295] (-2810.729) (-2824.122) (-2828.220) * (-2812.333) (-2821.140) [-2810.963] (-2822.933) -- 0:03:03 649000 -- (-2821.504) [-2811.901] (-2811.229) (-2816.769) * (-2817.337) [-2812.074] (-2816.201) (-2818.162) -- 0:03:03 649500 -- (-2815.979) (-2820.992) [-2814.618] (-2817.363) * (-2819.557) [-2818.291] (-2813.801) (-2827.722) -- 0:03:03 650000 -- (-2817.193) (-2821.133) [-2814.604] (-2825.101) * (-2820.860) (-2828.070) [-2818.335] (-2813.068) -- 0:03:03 Average standard deviation of split frequencies: 0.004347 650500 -- (-2822.420) [-2818.177] (-2818.147) (-2832.973) * (-2817.191) [-2821.213] (-2821.987) (-2832.465) -- 0:03:02 651000 -- (-2820.691) [-2814.582] (-2814.342) (-2826.698) * [-2806.785] (-2813.971) (-2822.750) (-2820.352) -- 0:03:02 651500 -- (-2830.718) (-2821.029) [-2812.360] (-2831.415) * [-2811.580] (-2816.776) (-2822.728) (-2822.311) -- 0:03:02 652000 -- (-2823.478) [-2806.471] (-2818.301) (-2812.188) * (-2815.841) [-2807.239] (-2814.523) (-2817.027) -- 0:03:02 652500 -- (-2819.601) (-2818.700) (-2808.603) [-2812.339] * (-2808.980) [-2811.193] (-2817.320) (-2824.644) -- 0:03:01 653000 -- [-2813.067] (-2819.755) (-2818.868) (-2825.873) * [-2810.991] (-2822.806) (-2827.974) (-2817.367) -- 0:03:01 653500 -- (-2817.444) (-2826.460) (-2818.728) [-2810.558] * (-2814.791) [-2811.665] (-2818.850) (-2816.506) -- 0:03:01 654000 -- [-2807.273] (-2815.474) (-2825.554) (-2807.587) * [-2807.506] (-2825.309) (-2809.437) (-2811.577) -- 0:03:00 654500 -- [-2811.671] (-2819.114) (-2821.341) (-2822.079) * (-2818.051) (-2820.244) (-2820.609) [-2814.010] -- 0:03:00 655000 -- [-2810.908] (-2820.629) (-2821.163) (-2815.781) * [-2808.357] (-2821.959) (-2813.258) (-2814.099) -- 0:03:00 Average standard deviation of split frequencies: 0.004391 655500 -- (-2818.696) (-2812.398) (-2829.846) [-2817.052] * (-2816.896) (-2812.113) [-2820.988] (-2813.042) -- 0:03:00 656000 -- (-2815.282) [-2813.080] (-2818.531) (-2827.720) * (-2813.599) [-2817.418] (-2811.013) (-2818.118) -- 0:02:59 656500 -- (-2817.378) (-2824.099) (-2819.401) [-2814.271] * [-2809.242] (-2811.524) (-2813.949) (-2817.997) -- 0:02:59 657000 -- (-2821.620) (-2826.301) (-2816.475) [-2817.153] * [-2812.518] (-2815.766) (-2814.197) (-2814.882) -- 0:02:59 657500 -- [-2817.231] (-2822.301) (-2813.107) (-2820.877) * [-2822.461] (-2820.570) (-2812.485) (-2813.096) -- 0:02:59 658000 -- (-2823.604) [-2813.294] (-2827.613) (-2813.263) * (-2824.879) [-2816.957] (-2815.077) (-2815.656) -- 0:02:58 658500 -- (-2822.455) (-2825.264) (-2813.130) [-2816.080] * [-2815.081] (-2812.876) (-2808.908) (-2814.377) -- 0:02:58 659000 -- [-2817.165] (-2816.114) (-2811.333) (-2813.112) * (-2822.209) (-2813.063) [-2816.085] (-2819.682) -- 0:02:58 659500 -- [-2819.888] (-2819.866) (-2817.300) (-2825.663) * (-2821.562) (-2809.111) [-2812.770] (-2817.461) -- 0:02:58 660000 -- [-2811.826] (-2819.066) (-2819.171) (-2821.005) * (-2813.677) [-2813.744] (-2814.694) (-2818.567) -- 0:02:57 Average standard deviation of split frequencies: 0.004360 660500 -- [-2810.294] (-2819.762) (-2828.802) (-2816.883) * [-2819.094] (-2811.634) (-2815.828) (-2813.626) -- 0:02:57 661000 -- (-2815.873) (-2820.981) (-2826.435) [-2814.092] * (-2821.563) [-2812.992] (-2817.629) (-2825.004) -- 0:02:57 661500 -- (-2816.790) [-2811.605] (-2818.444) (-2823.654) * [-2813.195] (-2822.380) (-2822.469) (-2832.632) -- 0:02:57 662000 -- (-2824.309) (-2817.277) [-2812.730] (-2808.603) * (-2821.710) (-2820.256) (-2825.202) [-2822.727] -- 0:02:56 662500 -- (-2817.714) (-2817.326) [-2824.540] (-2808.436) * [-2822.238] (-2811.092) (-2814.947) (-2826.589) -- 0:02:56 663000 -- (-2818.007) [-2811.973] (-2818.380) (-2809.662) * (-2818.947) (-2820.016) [-2823.639] (-2822.327) -- 0:02:56 663500 -- (-2820.989) [-2813.515] (-2816.662) (-2818.645) * (-2817.891) (-2814.860) (-2817.190) [-2816.578] -- 0:02:55 664000 -- (-2812.503) (-2827.397) [-2814.581] (-2824.516) * (-2818.476) [-2812.487] (-2812.012) (-2815.990) -- 0:02:55 664500 -- (-2824.906) [-2813.798] (-2813.637) (-2820.912) * (-2825.511) (-2816.016) (-2810.925) [-2818.053] -- 0:02:55 665000 -- [-2815.506] (-2813.810) (-2822.201) (-2815.955) * (-2836.920) [-2816.160] (-2813.925) (-2816.615) -- 0:02:55 Average standard deviation of split frequencies: 0.004797 665500 -- [-2811.213] (-2821.775) (-2817.480) (-2817.754) * (-2823.848) (-2816.047) (-2818.493) [-2813.857] -- 0:02:54 666000 -- (-2820.161) (-2817.982) (-2819.015) [-2813.399] * (-2831.383) (-2813.150) (-2810.504) [-2810.897] -- 0:02:54 666500 -- (-2819.985) [-2815.681] (-2815.993) (-2815.637) * (-2822.492) [-2813.073] (-2824.460) (-2812.628) -- 0:02:54 667000 -- (-2813.906) (-2813.944) [-2821.875] (-2825.896) * (-2819.170) [-2814.411] (-2825.277) (-2819.948) -- 0:02:54 667500 -- (-2812.972) [-2822.849] (-2815.317) (-2825.147) * (-2821.719) (-2820.368) [-2823.482] (-2814.627) -- 0:02:53 668000 -- (-2811.287) [-2820.020] (-2817.773) (-2818.330) * (-2824.279) (-2822.042) [-2809.937] (-2818.564) -- 0:02:53 668500 -- (-2824.990) (-2809.010) (-2822.602) [-2818.240] * [-2819.527] (-2822.517) (-2810.602) (-2827.235) -- 0:02:53 669000 -- (-2816.531) (-2826.048) [-2815.520] (-2814.979) * (-2822.924) (-2820.030) [-2807.562] (-2824.557) -- 0:02:53 669500 -- (-2813.653) (-2812.730) (-2820.495) [-2822.004] * (-2824.049) (-2814.535) (-2812.933) [-2818.821] -- 0:02:52 670000 -- [-2816.287] (-2814.010) (-2819.475) (-2815.472) * (-2822.793) [-2808.440] (-2826.697) (-2814.612) -- 0:02:52 Average standard deviation of split frequencies: 0.004217 670500 -- (-2824.653) (-2819.360) (-2815.798) [-2817.060] * [-2818.792] (-2819.646) (-2811.546) (-2820.519) -- 0:02:51 671000 -- [-2812.119] (-2812.489) (-2815.653) (-2820.370) * [-2820.124] (-2823.065) (-2823.956) (-2818.771) -- 0:02:52 671500 -- (-2820.903) (-2819.245) (-2813.300) [-2817.059] * (-2815.430) (-2819.555) [-2829.358] (-2830.673) -- 0:02:51 672000 -- (-2819.365) (-2826.008) [-2813.960] (-2821.187) * (-2825.257) [-2816.039] (-2828.931) (-2814.415) -- 0:02:51 672500 -- (-2812.612) (-2824.228) [-2810.697] (-2825.910) * [-2810.638] (-2822.207) (-2814.582) (-2817.734) -- 0:02:50 673000 -- (-2815.880) [-2816.519] (-2824.341) (-2812.969) * (-2821.073) [-2813.082] (-2812.443) (-2816.499) -- 0:02:51 673500 -- (-2810.591) (-2811.778) [-2817.244] (-2811.534) * (-2830.853) (-2822.058) (-2817.604) [-2808.480] -- 0:02:50 674000 -- [-2816.493] (-2815.523) (-2816.872) (-2825.636) * (-2821.314) (-2815.512) (-2810.474) [-2818.306] -- 0:02:50 674500 -- (-2817.712) [-2814.936] (-2817.070) (-2819.038) * (-2817.176) (-2830.164) [-2816.150] (-2811.367) -- 0:02:50 675000 -- (-2824.174) (-2821.611) (-2826.772) [-2815.112] * (-2808.223) [-2815.536] (-2815.171) (-2818.648) -- 0:02:49 Average standard deviation of split frequencies: 0.004649 675500 -- (-2816.670) (-2826.828) (-2821.964) [-2814.777] * (-2813.684) (-2821.535) [-2815.223] (-2818.617) -- 0:02:49 676000 -- (-2823.815) (-2834.922) [-2821.686] (-2831.277) * [-2814.524] (-2829.735) (-2816.124) (-2823.452) -- 0:02:49 676500 -- [-2806.809] (-2815.953) (-2821.174) (-2822.508) * (-2818.456) (-2830.490) (-2822.237) [-2814.821] -- 0:02:49 677000 -- (-2814.781) (-2820.996) [-2817.913] (-2813.710) * [-2821.834] (-2822.994) (-2833.208) (-2817.122) -- 0:02:48 677500 -- (-2813.437) (-2816.864) (-2824.516) [-2814.681] * (-2816.953) [-2824.177] (-2821.718) (-2827.719) -- 0:02:48 678000 -- (-2817.366) [-2815.364] (-2808.573) (-2813.099) * [-2816.725] (-2817.105) (-2817.895) (-2821.397) -- 0:02:48 678500 -- (-2817.341) (-2819.835) (-2831.143) [-2813.420] * (-2816.503) (-2812.953) [-2814.840] (-2813.310) -- 0:02:48 679000 -- (-2815.309) [-2814.714] (-2817.359) (-2808.843) * (-2816.508) (-2829.892) [-2812.445] (-2814.665) -- 0:02:47 679500 -- (-2818.001) [-2813.151] (-2827.127) (-2826.020) * (-2816.068) (-2818.221) (-2811.442) [-2809.122] -- 0:02:47 680000 -- (-2812.081) (-2832.702) (-2824.798) [-2816.312] * (-2824.196) (-2820.672) (-2812.802) [-2820.041] -- 0:02:47 Average standard deviation of split frequencies: 0.004155 680500 -- [-2812.253] (-2824.834) (-2813.929) (-2827.821) * (-2820.321) (-2820.652) (-2828.996) [-2816.741] -- 0:02:47 681000 -- [-2808.136] (-2821.261) (-2809.614) (-2819.788) * (-2821.238) [-2815.549] (-2820.710) (-2815.694) -- 0:02:46 681500 -- (-2818.693) (-2820.504) [-2816.316] (-2827.603) * (-2822.934) (-2814.664) (-2820.276) [-2810.029] -- 0:02:46 682000 -- (-2826.183) [-2814.426] (-2811.037) (-2826.725) * (-2825.846) (-2818.433) [-2815.427] (-2818.829) -- 0:02:45 682500 -- (-2828.910) (-2815.965) (-2815.850) [-2819.365] * (-2816.697) (-2826.851) [-2813.777] (-2830.672) -- 0:02:46 683000 -- (-2816.535) (-2823.802) [-2811.035] (-2817.823) * (-2814.795) [-2814.827] (-2810.681) (-2819.181) -- 0:02:45 683500 -- (-2820.900) (-2820.845) [-2817.469] (-2820.954) * [-2815.689] (-2818.014) (-2806.480) (-2812.651) -- 0:02:45 684000 -- [-2819.461] (-2814.395) (-2814.718) (-2815.624) * (-2835.603) [-2812.620] (-2816.242) (-2820.980) -- 0:02:44 684500 -- (-2824.509) (-2820.206) (-2815.815) [-2809.012] * (-2822.937) (-2813.949) [-2819.378] (-2825.085) -- 0:02:45 685000 -- (-2821.784) (-2829.638) [-2819.941] (-2808.036) * (-2826.643) (-2811.930) [-2826.353] (-2815.626) -- 0:02:44 Average standard deviation of split frequencies: 0.004047 685500 -- (-2814.155) (-2825.253) (-2820.985) [-2812.395] * (-2816.094) (-2828.304) (-2818.604) [-2822.018] -- 0:02:44 686000 -- (-2822.064) [-2822.586] (-2821.116) (-2819.429) * (-2822.785) (-2812.355) (-2823.409) [-2810.355] -- 0:02:43 686500 -- (-2830.851) (-2814.565) [-2807.657] (-2812.083) * (-2818.173) (-2809.855) [-2811.770] (-2818.598) -- 0:02:43 687000 -- (-2811.479) [-2810.395] (-2812.803) (-2824.958) * [-2811.511] (-2814.752) (-2813.774) (-2814.751) -- 0:02:43 687500 -- [-2823.211] (-2814.376) (-2817.725) (-2826.041) * [-2816.690] (-2812.648) (-2809.662) (-2814.375) -- 0:02:43 688000 -- (-2827.301) (-2821.479) [-2820.467] (-2813.901) * (-2813.375) (-2817.362) (-2812.958) [-2812.053] -- 0:02:42 688500 -- [-2816.792] (-2810.430) (-2813.304) (-2815.237) * (-2818.139) (-2810.896) [-2818.770] (-2825.097) -- 0:02:42 689000 -- (-2816.109) (-2818.526) [-2812.125] (-2822.759) * (-2826.085) (-2809.729) (-2823.776) [-2817.650] -- 0:02:42 689500 -- (-2818.433) [-2821.026] (-2819.113) (-2826.637) * [-2818.529] (-2815.578) (-2819.335) (-2817.221) -- 0:02:42 690000 -- (-2817.958) [-2815.285] (-2815.534) (-2822.188) * (-2818.828) (-2818.205) (-2816.754) [-2812.336] -- 0:02:41 Average standard deviation of split frequencies: 0.003868 690500 -- [-2812.575] (-2822.005) (-2816.893) (-2829.504) * [-2813.802] (-2824.728) (-2814.717) (-2824.165) -- 0:02:41 691000 -- (-2818.716) (-2821.834) [-2812.787] (-2827.830) * (-2816.587) [-2813.354] (-2821.545) (-2819.492) -- 0:02:41 691500 -- (-2814.921) [-2816.143] (-2819.948) (-2810.025) * [-2812.945] (-2817.511) (-2812.646) (-2818.627) -- 0:02:41 692000 -- (-2816.746) (-2824.488) (-2819.185) [-2818.770] * (-2818.064) (-2817.271) (-2817.304) [-2815.083] -- 0:02:41 692500 -- (-2813.374) (-2821.494) (-2827.249) [-2814.100] * (-2816.418) (-2814.152) [-2814.992] (-2819.616) -- 0:02:40 693000 -- (-2818.155) (-2817.492) [-2813.269] (-2818.137) * (-2823.849) (-2821.230) (-2816.413) [-2815.366] -- 0:02:40 693500 -- [-2815.064] (-2818.777) (-2816.884) (-2811.962) * (-2811.810) (-2815.135) (-2818.090) [-2813.060] -- 0:02:39 694000 -- (-2822.002) [-2814.242] (-2815.059) (-2824.677) * (-2819.221) (-2821.635) [-2813.460] (-2816.075) -- 0:02:40 694500 -- (-2808.980) (-2819.574) [-2812.699] (-2811.647) * (-2820.615) [-2817.302] (-2817.354) (-2813.531) -- 0:02:39 695000 -- [-2820.547] (-2822.596) (-2819.241) (-2816.406) * (-2813.935) [-2819.888] (-2818.194) (-2824.451) -- 0:02:39 Average standard deviation of split frequencies: 0.003838 695500 -- [-2809.041] (-2809.935) (-2820.636) (-2818.971) * (-2816.752) (-2811.718) [-2816.237] (-2813.235) -- 0:02:38 696000 -- (-2825.607) (-2813.876) [-2810.194] (-2818.282) * [-2817.666] (-2815.760) (-2816.874) (-2818.119) -- 0:02:38 696500 -- [-2816.032] (-2818.053) (-2831.796) (-2818.411) * (-2816.197) (-2809.210) [-2816.985] (-2818.339) -- 0:02:38 697000 -- (-2810.883) (-2821.183) [-2815.922] (-2824.735) * (-2818.610) (-2823.589) (-2822.727) [-2810.919] -- 0:02:38 697500 -- [-2816.590] (-2820.285) (-2815.034) (-2817.093) * (-2821.739) (-2823.942) [-2817.498] (-2815.309) -- 0:02:37 698000 -- (-2823.603) [-2809.378] (-2813.546) (-2812.025) * (-2824.650) (-2823.528) (-2812.694) [-2812.175] -- 0:02:37 698500 -- (-2819.178) (-2813.426) [-2817.938] (-2809.825) * (-2817.284) (-2815.978) [-2817.924] (-2812.872) -- 0:02:37 699000 -- (-2818.338) (-2815.477) (-2819.699) [-2816.366] * (-2819.120) (-2820.289) [-2816.298] (-2820.676) -- 0:02:37 699500 -- (-2825.684) [-2812.686] (-2820.390) (-2811.018) * (-2813.553) (-2810.649) (-2813.830) [-2813.869] -- 0:02:36 700000 -- (-2821.548) [-2811.245] (-2824.771) (-2812.861) * (-2809.778) (-2811.447) (-2810.757) [-2820.554] -- 0:02:36 Average standard deviation of split frequencies: 0.003289 700500 -- (-2816.545) (-2818.525) [-2817.487] (-2808.289) * (-2822.034) (-2814.190) [-2815.036] (-2818.388) -- 0:02:36 701000 -- [-2819.790] (-2818.494) (-2819.602) (-2810.654) * [-2818.874] (-2818.658) (-2822.013) (-2813.917) -- 0:02:36 701500 -- (-2819.439) (-2819.597) (-2807.426) [-2818.263] * (-2821.130) [-2810.001] (-2816.441) (-2813.781) -- 0:02:35 702000 -- (-2815.347) (-2820.476) (-2814.171) [-2813.834] * (-2817.090) (-2806.178) [-2815.857] (-2815.765) -- 0:02:35 702500 -- (-2816.701) (-2828.168) [-2811.764] (-2817.686) * (-2814.853) (-2817.957) (-2825.360) [-2814.018] -- 0:02:35 703000 -- (-2812.861) [-2813.372] (-2810.332) (-2818.265) * [-2805.911] (-2810.937) (-2816.942) (-2814.317) -- 0:02:35 703500 -- (-2822.193) [-2812.059] (-2816.448) (-2821.767) * [-2809.014] (-2811.674) (-2825.990) (-2830.332) -- 0:02:34 704000 -- (-2818.909) (-2826.708) (-2817.192) [-2819.769] * [-2816.524] (-2816.869) (-2820.780) (-2817.332) -- 0:02:34 704500 -- (-2826.841) (-2827.532) (-2818.135) [-2810.435] * (-2821.776) (-2814.951) (-2821.527) [-2816.188] -- 0:02:34 705000 -- [-2823.669] (-2827.524) (-2831.786) (-2813.805) * (-2814.708) (-2814.808) [-2818.820] (-2823.676) -- 0:02:33 Average standard deviation of split frequencies: 0.003413 705500 -- (-2826.237) (-2815.699) (-2819.777) [-2820.023] * [-2805.306] (-2818.067) (-2815.076) (-2825.111) -- 0:02:33 706000 -- (-2823.598) (-2818.839) (-2819.198) [-2805.248] * (-2808.683) (-2813.417) (-2815.973) [-2815.037] -- 0:02:33 706500 -- (-2817.484) (-2813.221) [-2818.243] (-2817.571) * [-2811.580] (-2823.274) (-2822.615) (-2811.709) -- 0:02:33 707000 -- (-2813.808) (-2812.082) (-2831.547) [-2816.539] * (-2816.286) [-2819.679] (-2817.353) (-2811.063) -- 0:02:32 707500 -- (-2821.699) (-2824.259) (-2810.702) [-2819.122] * (-2821.815) (-2819.390) (-2821.088) [-2812.511] -- 0:02:32 708000 -- (-2817.762) (-2814.738) [-2809.210] (-2814.098) * (-2812.071) (-2832.670) (-2815.216) [-2814.730] -- 0:02:32 708500 -- (-2818.630) [-2815.062] (-2823.325) (-2821.448) * [-2822.463] (-2821.659) (-2822.885) (-2813.958) -- 0:02:32 709000 -- (-2833.839) (-2818.092) [-2814.672] (-2823.811) * (-2817.311) [-2818.385] (-2818.389) (-2820.833) -- 0:02:31 709500 -- (-2810.714) [-2808.329] (-2820.350) (-2821.312) * (-2814.579) (-2817.480) [-2820.626] (-2821.897) -- 0:02:31 710000 -- (-2815.109) (-2820.976) [-2816.925] (-2822.392) * (-2817.920) (-2824.685) (-2828.848) [-2819.565] -- 0:02:31 Average standard deviation of split frequencies: 0.003243 710500 -- [-2813.417] (-2834.926) (-2816.478) (-2819.931) * [-2814.363] (-2825.607) (-2821.356) (-2816.805) -- 0:02:31 711000 -- (-2819.864) [-2816.443] (-2813.375) (-2816.923) * (-2818.881) (-2825.165) [-2813.794] (-2816.626) -- 0:02:30 711500 -- [-2814.558] (-2818.070) (-2810.984) (-2809.445) * (-2815.788) (-2820.296) [-2817.667] (-2823.698) -- 0:02:30 712000 -- (-2808.834) (-2817.697) [-2813.882] (-2821.125) * (-2812.762) [-2814.110] (-2811.547) (-2817.106) -- 0:02:30 712500 -- (-2809.277) (-2811.133) [-2817.268] (-2816.488) * (-2810.679) (-2809.928) [-2811.663] (-2819.899) -- 0:02:30 713000 -- (-2812.010) (-2819.786) [-2810.387] (-2816.806) * [-2808.824] (-2818.190) (-2817.417) (-2834.051) -- 0:02:29 713500 -- [-2807.870] (-2825.612) (-2815.742) (-2813.863) * [-2812.972] (-2806.897) (-2811.245) (-2821.337) -- 0:02:29 714000 -- [-2814.155] (-2822.911) (-2817.643) (-2820.024) * (-2816.357) [-2812.522] (-2818.081) (-2814.838) -- 0:02:29 714500 -- [-2813.488] (-2824.058) (-2814.469) (-2820.900) * (-2817.742) (-2817.161) (-2820.608) [-2814.698] -- 0:02:29 715000 -- (-2816.833) (-2820.600) [-2811.529] (-2822.339) * [-2817.255] (-2821.448) (-2820.799) (-2820.276) -- 0:02:28 Average standard deviation of split frequencies: 0.003511 715500 -- [-2812.013] (-2815.625) (-2819.410) (-2823.245) * (-2812.960) (-2814.084) [-2812.758] (-2816.998) -- 0:02:28 716000 -- (-2812.715) (-2812.534) (-2820.692) [-2828.521] * (-2818.104) [-2815.774] (-2817.671) (-2816.382) -- 0:02:28 716500 -- (-2820.014) [-2814.736] (-2819.030) (-2819.744) * (-2813.048) (-2814.137) (-2817.401) [-2810.513] -- 0:02:27 717000 -- (-2813.860) (-2825.690) [-2814.493] (-2823.793) * [-2814.581] (-2815.009) (-2814.331) (-2816.862) -- 0:02:27 717500 -- (-2824.777) (-2813.345) [-2811.394] (-2819.001) * [-2808.560] (-2812.844) (-2806.913) (-2822.356) -- 0:02:27 718000 -- (-2819.612) [-2816.864] (-2812.806) (-2822.747) * (-2821.071) (-2815.815) (-2817.014) [-2819.551] -- 0:02:27 718500 -- (-2824.480) (-2815.785) (-2813.974) [-2812.088] * (-2817.922) (-2815.252) (-2816.719) [-2819.216] -- 0:02:26 719000 -- (-2815.862) (-2821.793) [-2822.312] (-2825.990) * [-2810.923] (-2812.734) (-2815.008) (-2811.132) -- 0:02:26 719500 -- [-2811.050] (-2822.361) (-2825.311) (-2816.774) * (-2817.057) [-2810.482] (-2815.671) (-2821.936) -- 0:02:26 720000 -- [-2822.635] (-2813.324) (-2817.113) (-2813.185) * (-2811.860) (-2816.430) [-2815.267] (-2830.435) -- 0:02:26 Average standard deviation of split frequencies: 0.003343 720500 -- [-2815.583] (-2809.948) (-2810.044) (-2819.540) * [-2811.411] (-2826.728) (-2817.743) (-2819.027) -- 0:02:25 721000 -- [-2823.187] (-2813.972) (-2816.501) (-2813.243) * (-2814.016) (-2814.872) [-2815.984] (-2817.057) -- 0:02:25 721500 -- (-2813.606) (-2811.866) [-2812.746] (-2824.393) * (-2819.523) (-2812.029) (-2831.758) [-2813.954] -- 0:02:25 722000 -- (-2819.268) [-2816.729] (-2816.375) (-2816.745) * (-2813.014) (-2820.840) [-2814.963] (-2811.752) -- 0:02:25 722500 -- [-2811.188] (-2826.004) (-2819.238) (-2824.083) * (-2811.910) (-2814.382) (-2817.554) [-2815.679] -- 0:02:24 723000 -- [-2819.302] (-2813.501) (-2819.309) (-2811.260) * (-2807.550) (-2813.842) [-2811.203] (-2811.496) -- 0:02:24 723500 -- (-2813.451) (-2824.714) (-2816.342) [-2812.007] * (-2818.496) (-2819.056) [-2809.363] (-2820.266) -- 0:02:24 724000 -- (-2817.682) [-2815.912] (-2818.243) (-2820.795) * [-2825.184] (-2821.549) (-2814.046) (-2825.308) -- 0:02:24 724500 -- (-2820.208) (-2821.438) [-2816.678] (-2817.386) * (-2818.575) (-2814.612) [-2819.968] (-2824.789) -- 0:02:23 725000 -- (-2822.562) (-2815.805) (-2818.740) [-2815.205] * (-2819.503) [-2810.294] (-2818.701) (-2813.162) -- 0:02:23 Average standard deviation of split frequencies: 0.003247 725500 -- (-2831.762) [-2812.331] (-2816.801) (-2817.910) * [-2814.892] (-2826.161) (-2814.747) (-2819.753) -- 0:02:23 726000 -- (-2815.100) [-2820.869] (-2812.438) (-2815.754) * (-2820.351) (-2822.336) [-2804.335] (-2815.828) -- 0:02:23 726500 -- (-2822.732) (-2822.649) (-2813.928) [-2817.122] * [-2808.345] (-2817.335) (-2822.269) (-2823.515) -- 0:02:22 727000 -- (-2809.895) (-2817.735) [-2810.157] (-2817.590) * (-2828.901) (-2818.778) [-2815.612] (-2826.950) -- 0:02:22 727500 -- (-2815.725) (-2814.248) (-2817.709) [-2816.556] * (-2818.423) (-2819.492) (-2813.978) [-2821.035] -- 0:02:22 728000 -- (-2813.672) (-2821.088) (-2818.900) [-2815.161] * (-2815.776) (-2817.474) (-2809.755) [-2817.402] -- 0:02:21 728500 -- (-2813.127) (-2827.946) (-2817.733) [-2816.025] * (-2817.293) (-2817.226) (-2821.116) [-2816.628] -- 0:02:21 729000 -- (-2814.839) (-2819.169) [-2819.503] (-2815.402) * (-2817.123) (-2814.612) [-2816.484] (-2810.515) -- 0:02:21 729500 -- (-2818.991) (-2818.065) [-2815.892] (-2817.209) * (-2823.032) [-2814.125] (-2822.952) (-2816.153) -- 0:02:21 730000 -- (-2819.632) (-2820.059) (-2822.817) [-2811.198] * (-2819.033) (-2823.275) [-2822.337] (-2818.037) -- 0:02:20 Average standard deviation of split frequencies: 0.003369 730500 -- (-2815.692) [-2816.043] (-2818.809) (-2823.731) * (-2826.833) (-2823.179) (-2820.663) [-2812.746] -- 0:02:20 731000 -- [-2821.674] (-2812.595) (-2818.581) (-2817.105) * (-2819.203) (-2812.880) [-2812.621] (-2812.126) -- 0:02:20 731500 -- (-2832.563) [-2817.457] (-2824.710) (-2811.704) * (-2815.298) (-2820.552) (-2807.854) [-2814.537] -- 0:02:20 732000 -- (-2807.015) (-2824.438) [-2814.373] (-2813.851) * (-2821.421) (-2838.591) (-2819.393) [-2808.666] -- 0:02:19 732500 -- (-2811.052) (-2812.685) (-2820.397) [-2814.994] * [-2815.987] (-2820.594) (-2813.105) (-2817.929) -- 0:02:19 733000 -- (-2825.038) (-2825.834) (-2812.992) [-2815.624] * [-2816.084] (-2814.832) (-2825.307) (-2822.325) -- 0:02:19 733500 -- [-2816.664] (-2824.712) (-2814.439) (-2824.447) * (-2812.422) [-2818.861] (-2814.905) (-2817.388) -- 0:02:19 734000 -- (-2814.952) (-2822.343) [-2808.283] (-2834.771) * (-2817.636) [-2812.979] (-2830.802) (-2821.645) -- 0:02:18 734500 -- (-2820.753) (-2825.784) [-2809.734] (-2817.898) * (-2817.017) (-2830.135) (-2814.329) [-2820.258] -- 0:02:18 735000 -- (-2825.965) (-2823.886) [-2815.735] (-2811.055) * [-2804.863] (-2816.922) (-2813.773) (-2816.719) -- 0:02:18 Average standard deviation of split frequencies: 0.003416 735500 -- (-2814.747) (-2814.281) (-2815.779) [-2813.246] * (-2812.353) (-2810.838) (-2817.699) [-2816.382] -- 0:02:18 736000 -- [-2810.384] (-2820.571) (-2820.407) (-2823.461) * (-2819.979) (-2821.986) (-2812.749) [-2825.501] -- 0:02:17 736500 -- (-2816.991) (-2817.722) (-2823.190) [-2813.350] * [-2813.311] (-2813.036) (-2822.503) (-2822.643) -- 0:02:17 737000 -- (-2814.872) (-2823.148) [-2810.900] (-2823.115) * (-2811.882) [-2816.352] (-2813.813) (-2817.718) -- 0:02:17 737500 -- [-2811.916] (-2814.259) (-2820.815) (-2813.882) * [-2811.271] (-2824.752) (-2829.503) (-2814.413) -- 0:02:17 738000 -- (-2823.405) (-2817.533) (-2832.181) [-2808.862] * (-2809.680) (-2822.157) [-2821.089] (-2815.855) -- 0:02:16 738500 -- [-2820.701] (-2816.555) (-2824.235) (-2818.648) * (-2823.091) (-2812.144) (-2817.077) [-2808.416] -- 0:02:16 739000 -- [-2823.485] (-2815.147) (-2817.063) (-2820.312) * (-2815.804) (-2826.036) [-2813.419] (-2815.348) -- 0:02:16 739500 -- (-2822.825) (-2823.777) (-2813.633) [-2816.248] * [-2812.210] (-2821.774) (-2817.364) (-2816.632) -- 0:02:15 740000 -- (-2815.842) (-2807.526) (-2819.425) [-2822.780] * [-2812.103] (-2815.445) (-2816.735) (-2816.884) -- 0:02:15 Average standard deviation of split frequencies: 0.003324 740500 -- (-2812.198) (-2811.897) (-2817.684) [-2817.671] * (-2813.729) [-2819.041] (-2812.640) (-2811.567) -- 0:02:15 741000 -- (-2813.062) (-2810.311) [-2811.788] (-2814.888) * [-2812.445] (-2815.450) (-2817.303) (-2812.805) -- 0:02:15 741500 -- (-2820.571) (-2828.109) (-2818.168) [-2820.868] * (-2817.873) [-2806.197] (-2814.459) (-2823.844) -- 0:02:14 742000 -- (-2817.445) (-2822.057) [-2813.488] (-2821.577) * (-2816.739) (-2815.211) (-2814.919) [-2810.817] -- 0:02:14 742500 -- (-2816.422) (-2825.711) (-2807.559) [-2813.588] * (-2816.934) (-2822.972) [-2812.776] (-2817.010) -- 0:02:14 743000 -- [-2811.103] (-2811.447) (-2822.502) (-2812.916) * [-2811.880] (-2813.747) (-2824.133) (-2823.743) -- 0:02:14 743500 -- [-2811.921] (-2816.567) (-2812.474) (-2816.020) * (-2815.673) [-2814.670] (-2825.632) (-2818.224) -- 0:02:13 744000 -- (-2808.855) [-2817.985] (-2816.552) (-2819.555) * [-2812.878] (-2811.440) (-2821.473) (-2813.198) -- 0:02:13 744500 -- [-2815.004] (-2819.683) (-2816.253) (-2820.304) * (-2816.141) (-2816.213) [-2808.416] (-2819.193) -- 0:02:13 745000 -- [-2819.689] (-2815.178) (-2808.799) (-2813.929) * [-2811.577] (-2819.249) (-2819.737) (-2817.474) -- 0:02:13 Average standard deviation of split frequencies: 0.003230 745500 -- (-2818.601) (-2823.509) [-2815.647] (-2819.224) * (-2816.827) [-2816.243] (-2815.942) (-2814.605) -- 0:02:12 746000 -- (-2823.382) [-2817.087] (-2824.060) (-2812.111) * (-2818.427) (-2815.778) [-2813.819] (-2817.938) -- 0:02:12 746500 -- (-2819.632) (-2817.523) (-2817.013) [-2809.540] * (-2822.900) [-2806.456] (-2820.502) (-2814.878) -- 0:02:12 747000 -- (-2820.922) (-2811.996) (-2814.754) [-2812.789] * (-2829.733) (-2810.578) [-2818.864] (-2813.332) -- 0:02:12 747500 -- (-2815.330) (-2815.995) [-2810.632] (-2822.355) * (-2814.358) [-2806.949] (-2832.999) (-2823.116) -- 0:02:11 748000 -- [-2821.463] (-2831.618) (-2817.070) (-2810.215) * (-2815.407) [-2813.958] (-2827.083) (-2824.293) -- 0:02:11 748500 -- (-2815.092) [-2816.177] (-2817.102) (-2811.848) * (-2814.708) (-2818.056) (-2832.284) [-2815.343] -- 0:02:11 749000 -- (-2817.583) [-2810.281] (-2811.626) (-2815.436) * [-2812.345] (-2815.221) (-2829.337) (-2806.078) -- 0:02:11 749500 -- (-2812.881) (-2812.839) (-2820.853) [-2812.267] * [-2809.354] (-2813.029) (-2816.490) (-2815.830) -- 0:02:10 750000 -- (-2814.477) [-2814.685] (-2822.631) (-2808.488) * [-2816.000] (-2826.059) (-2810.525) (-2816.609) -- 0:02:10 Average standard deviation of split frequencies: 0.003210 750500 -- (-2812.469) (-2814.163) (-2812.094) [-2815.314] * (-2820.509) (-2812.306) [-2814.191] (-2819.013) -- 0:02:10 751000 -- (-2809.460) [-2814.006] (-2817.477) (-2810.138) * [-2825.088] (-2819.012) (-2821.867) (-2818.366) -- 0:02:09 751500 -- [-2817.495] (-2818.329) (-2824.108) (-2812.243) * (-2815.475) (-2813.910) (-2814.258) [-2808.718] -- 0:02:09 752000 -- (-2819.242) (-2822.651) (-2812.542) [-2812.792] * [-2818.832] (-2815.083) (-2820.982) (-2812.055) -- 0:02:09 752500 -- (-2818.775) [-2809.022] (-2822.016) (-2806.908) * [-2816.189] (-2815.621) (-2814.751) (-2819.091) -- 0:02:09 753000 -- [-2806.412] (-2810.232) (-2819.109) (-2818.800) * (-2820.447) (-2809.622) [-2820.472] (-2819.870) -- 0:02:08 753500 -- (-2812.429) [-2805.790] (-2816.898) (-2808.857) * (-2818.799) (-2817.856) (-2821.877) [-2813.259] -- 0:02:08 754000 -- [-2821.207] (-2816.647) (-2817.040) (-2820.280) * (-2820.871) (-2823.639) [-2814.587] (-2823.130) -- 0:02:08 754500 -- (-2816.010) [-2811.430] (-2820.624) (-2815.648) * (-2821.615) (-2813.858) (-2815.518) [-2815.218] -- 0:02:08 755000 -- [-2821.063] (-2824.332) (-2818.720) (-2819.290) * [-2814.115] (-2814.658) (-2816.491) (-2815.044) -- 0:02:07 Average standard deviation of split frequencies: 0.003187 755500 -- (-2815.434) [-2813.111] (-2819.110) (-2816.965) * (-2814.094) (-2820.665) (-2815.693) [-2813.617] -- 0:02:07 756000 -- [-2822.336] (-2816.338) (-2817.631) (-2820.595) * (-2817.246) (-2823.650) (-2819.008) [-2813.079] -- 0:02:07 756500 -- (-2816.347) [-2816.414] (-2811.490) (-2835.055) * (-2819.119) [-2813.705] (-2822.627) (-2811.107) -- 0:02:07 757000 -- [-2816.357] (-2827.273) (-2819.803) (-2816.911) * (-2824.784) [-2813.568] (-2826.318) (-2817.367) -- 0:02:06 757500 -- (-2823.820) [-2811.708] (-2812.723) (-2820.605) * (-2829.322) [-2811.773] (-2820.521) (-2826.123) -- 0:02:06 758000 -- (-2821.597) (-2810.469) (-2814.771) [-2814.798] * (-2826.481) (-2806.461) (-2808.975) [-2810.416] -- 0:02:06 758500 -- (-2817.464) [-2814.482] (-2821.251) (-2811.352) * [-2814.848] (-2826.341) (-2816.045) (-2814.878) -- 0:02:06 759000 -- (-2822.799) (-2815.563) (-2823.862) [-2811.033] * (-2812.682) (-2824.705) [-2813.094] (-2813.348) -- 0:02:05 759500 -- [-2814.841] (-2814.382) (-2818.730) (-2819.017) * [-2811.750] (-2816.796) (-2811.028) (-2822.470) -- 0:02:05 760000 -- [-2811.412] (-2814.009) (-2821.995) (-2824.822) * (-2812.180) [-2815.378] (-2821.919) (-2817.668) -- 0:02:05 Average standard deviation of split frequencies: 0.003305 760500 -- [-2809.552] (-2814.562) (-2819.787) (-2811.819) * [-2816.040] (-2812.010) (-2824.768) (-2821.683) -- 0:02:05 761000 -- (-2809.846) (-2814.736) [-2822.184] (-2808.568) * [-2816.620] (-2813.692) (-2818.796) (-2829.602) -- 0:02:04 761500 -- (-2815.960) [-2822.559] (-2815.630) (-2817.801) * [-2809.759] (-2823.838) (-2821.162) (-2816.461) -- 0:02:04 762000 -- (-2811.702) (-2816.014) (-2821.115) [-2815.566] * (-2818.451) (-2813.218) (-2823.392) [-2815.072] -- 0:02:04 762500 -- (-2818.736) (-2820.363) (-2813.796) [-2817.333] * (-2817.041) (-2829.037) [-2812.683] (-2819.453) -- 0:02:03 763000 -- (-2821.885) [-2814.860] (-2818.407) (-2812.366) * [-2816.925] (-2812.053) (-2817.603) (-2816.794) -- 0:02:03 763500 -- (-2819.032) [-2812.193] (-2820.983) (-2816.096) * (-2824.823) (-2818.244) [-2814.834] (-2817.764) -- 0:02:03 764000 -- [-2812.869] (-2826.126) (-2819.072) (-2815.794) * (-2825.661) (-2823.361) [-2812.182] (-2818.806) -- 0:02:03 764500 -- (-2823.651) [-2817.667] (-2812.837) (-2814.909) * [-2824.402] (-2821.400) (-2813.142) (-2825.766) -- 0:02:02 765000 -- (-2810.226) (-2821.738) (-2815.992) [-2815.852] * (-2810.752) (-2830.861) [-2810.960] (-2820.697) -- 0:02:02 Average standard deviation of split frequencies: 0.003282 765500 -- (-2813.706) (-2812.969) (-2812.988) [-2825.646] * (-2816.129) [-2808.956] (-2819.463) (-2818.557) -- 0:02:02 766000 -- (-2818.450) [-2815.967] (-2807.958) (-2817.158) * (-2819.023) (-2815.012) [-2812.855] (-2816.930) -- 0:02:02 766500 -- (-2823.513) (-2822.207) (-2813.732) [-2822.817] * (-2820.036) (-2820.122) [-2813.874] (-2820.885) -- 0:02:01 767000 -- (-2810.995) [-2816.635] (-2814.254) (-2821.069) * (-2824.311) (-2818.194) [-2817.172] (-2810.751) -- 0:02:01 767500 -- (-2817.892) (-2815.329) (-2808.884) [-2812.404] * (-2822.211) (-2819.124) [-2824.712] (-2822.698) -- 0:02:01 768000 -- (-2815.397) (-2816.120) [-2815.338] (-2816.813) * [-2826.133] (-2819.232) (-2819.550) (-2816.764) -- 0:02:01 768500 -- (-2819.429) (-2810.352) (-2824.262) [-2807.823] * (-2820.289) (-2817.428) [-2816.972] (-2827.702) -- 0:02:00 769000 -- (-2813.339) [-2818.209] (-2818.562) (-2817.904) * (-2821.017) [-2813.242] (-2812.907) (-2819.141) -- 0:02:00 769500 -- (-2813.624) [-2815.298] (-2813.593) (-2822.980) * (-2818.795) (-2810.381) [-2810.463] (-2819.025) -- 0:02:00 770000 -- (-2824.710) (-2817.137) [-2812.723] (-2818.234) * [-2811.178] (-2817.195) (-2819.108) (-2821.192) -- 0:02:00 Average standard deviation of split frequencies: 0.003330 770500 -- [-2821.085] (-2817.195) (-2810.065) (-2820.126) * (-2827.776) [-2814.493] (-2815.247) (-2821.495) -- 0:01:59 771000 -- [-2815.126] (-2825.488) (-2816.137) (-2817.147) * (-2820.511) (-2807.997) [-2814.571] (-2816.536) -- 0:01:59 771500 -- (-2813.971) (-2816.838) [-2816.351] (-2821.537) * [-2813.731] (-2816.490) (-2819.311) (-2817.951) -- 0:01:59 772000 -- (-2817.353) [-2817.351] (-2817.180) (-2817.180) * [-2807.702] (-2816.212) (-2817.429) (-2813.986) -- 0:01:59 772500 -- (-2816.239) (-2819.295) [-2813.234] (-2821.193) * [-2813.905] (-2816.091) (-2825.880) (-2817.065) -- 0:01:58 773000 -- (-2821.655) [-2809.169] (-2814.792) (-2815.547) * (-2836.723) [-2810.572] (-2814.732) (-2816.777) -- 0:01:58 773500 -- [-2819.480] (-2814.347) (-2823.795) (-2811.371) * (-2821.937) (-2822.514) [-2817.370] (-2821.243) -- 0:01:58 774000 -- (-2815.391) (-2812.364) (-2813.774) [-2814.799] * (-2816.099) [-2814.977] (-2814.107) (-2816.352) -- 0:01:57 774500 -- (-2818.970) (-2812.844) (-2809.564) [-2817.067] * (-2816.504) [-2811.350] (-2812.274) (-2820.545) -- 0:01:57 775000 -- (-2818.390) (-2816.676) [-2805.064] (-2817.068) * (-2813.438) (-2816.221) [-2808.282] (-2821.865) -- 0:01:57 Average standard deviation of split frequencies: 0.003307 775500 -- (-2822.582) (-2809.900) (-2821.171) [-2818.998] * (-2820.915) (-2815.358) (-2816.663) [-2811.184] -- 0:01:57 776000 -- (-2813.013) (-2812.612) [-2814.687] (-2828.265) * (-2822.166) (-2814.384) [-2819.297] (-2811.385) -- 0:01:56 776500 -- (-2825.293) (-2825.793) [-2812.077] (-2816.988) * (-2822.913) (-2822.386) (-2820.347) [-2811.172] -- 0:01:56 777000 -- (-2815.746) [-2813.208] (-2810.833) (-2819.199) * [-2817.153] (-2818.432) (-2822.114) (-2814.890) -- 0:01:56 777500 -- (-2819.776) (-2814.294) [-2810.568] (-2831.982) * [-2809.110] (-2819.289) (-2825.599) (-2824.131) -- 0:01:56 778000 -- [-2814.355] (-2822.245) (-2814.375) (-2821.421) * (-2816.090) [-2812.110] (-2811.802) (-2812.590) -- 0:01:55 778500 -- (-2811.897) [-2813.070] (-2815.759) (-2815.726) * (-2817.976) (-2815.183) [-2817.792] (-2823.101) -- 0:01:55 779000 -- (-2811.870) (-2805.762) (-2829.856) [-2817.156] * (-2819.817) (-2811.861) (-2816.693) [-2827.032] -- 0:01:55 779500 -- (-2816.830) (-2812.883) (-2815.258) [-2815.248] * (-2814.916) [-2811.638] (-2820.336) (-2820.821) -- 0:01:55 780000 -- (-2815.419) (-2816.754) [-2826.880] (-2815.553) * (-2814.125) [-2816.636] (-2817.789) (-2822.960) -- 0:01:55 Average standard deviation of split frequencies: 0.003422 780500 -- (-2815.753) [-2816.542] (-2823.701) (-2821.995) * (-2815.734) (-2821.433) [-2813.424] (-2814.248) -- 0:01:54 781000 -- [-2812.860] (-2821.286) (-2820.437) (-2818.183) * (-2811.321) [-2811.772] (-2824.161) (-2812.670) -- 0:01:54 781500 -- (-2814.046) (-2820.130) [-2815.688] (-2814.172) * (-2818.645) (-2816.670) (-2814.654) [-2816.096] -- 0:01:54 782000 -- (-2821.183) [-2809.125] (-2817.113) (-2812.687) * (-2814.528) [-2813.642] (-2820.577) (-2826.115) -- 0:01:54 782500 -- (-2812.752) (-2816.091) [-2813.408] (-2814.048) * (-2816.975) [-2814.255] (-2820.435) (-2826.331) -- 0:01:53 783000 -- (-2818.479) (-2816.691) [-2812.362] (-2831.717) * (-2821.060) [-2807.500] (-2811.346) (-2819.423) -- 0:01:53 783500 -- [-2810.871] (-2822.818) (-2825.276) (-2812.532) * (-2816.088) (-2812.015) [-2818.951] (-2817.386) -- 0:01:53 784000 -- [-2816.692] (-2821.587) (-2830.326) (-2813.505) * [-2814.285] (-2810.743) (-2810.461) (-2815.100) -- 0:01:52 784500 -- (-2824.082) [-2816.389] (-2823.157) (-2821.364) * (-2810.593) (-2814.879) (-2822.083) [-2814.138] -- 0:01:52 785000 -- (-2820.091) [-2811.311] (-2818.592) (-2812.008) * [-2815.531] (-2819.037) (-2813.066) (-2816.797) -- 0:01:52 Average standard deviation of split frequencies: 0.003265 785500 -- (-2831.091) (-2814.079) [-2815.034] (-2815.229) * [-2808.134] (-2821.789) (-2819.537) (-2810.807) -- 0:01:52 786000 -- (-2823.050) (-2827.797) [-2815.159] (-2818.222) * (-2815.157) (-2827.751) [-2825.241] (-2821.523) -- 0:01:51 786500 -- [-2810.047] (-2820.308) (-2812.275) (-2828.147) * (-2825.677) [-2832.177] (-2822.631) (-2822.534) -- 0:01:51 787000 -- (-2817.683) (-2813.085) [-2814.206] (-2819.814) * (-2813.893) (-2811.906) (-2820.112) [-2819.377] -- 0:01:51 787500 -- (-2816.305) (-2818.077) (-2814.167) [-2814.904] * [-2810.922] (-2823.860) (-2819.329) (-2820.113) -- 0:01:51 788000 -- [-2807.603] (-2816.260) (-2812.453) (-2816.706) * (-2821.436) (-2814.553) (-2823.735) [-2815.061] -- 0:01:50 788500 -- (-2815.235) (-2830.820) (-2818.569) [-2816.654] * (-2813.795) [-2817.248] (-2814.556) (-2815.839) -- 0:01:50 789000 -- [-2809.945] (-2810.889) (-2833.200) (-2821.581) * (-2825.359) (-2819.892) [-2811.656] (-2818.325) -- 0:01:50 789500 -- (-2830.809) (-2819.458) [-2812.116] (-2817.320) * (-2817.109) [-2821.764] (-2810.095) (-2823.264) -- 0:01:50 790000 -- [-2815.216] (-2819.489) (-2821.203) (-2822.671) * [-2813.497] (-2820.936) (-2809.252) (-2815.191) -- 0:01:49 Average standard deviation of split frequencies: 0.003379 790500 -- (-2816.250) [-2812.575] (-2822.493) (-2820.572) * (-2824.098) (-2813.191) (-2819.638) [-2813.281] -- 0:01:49 791000 -- (-2823.942) (-2823.478) [-2811.231] (-2826.435) * (-2812.834) [-2813.850] (-2818.848) (-2814.842) -- 0:01:49 791500 -- (-2814.667) (-2820.877) [-2821.404] (-2816.712) * (-2820.413) (-2819.857) (-2822.612) [-2814.311] -- 0:01:49 792000 -- (-2824.949) (-2814.029) [-2821.943] (-2819.158) * (-2829.132) (-2830.598) (-2822.887) [-2816.702] -- 0:01:48 792500 -- (-2825.554) (-2821.644) (-2818.853) [-2814.865] * (-2818.057) (-2821.039) [-2814.247] (-2822.350) -- 0:01:48 793000 -- [-2815.629] (-2817.292) (-2810.445) (-2813.468) * (-2819.216) (-2819.925) (-2821.891) [-2818.231] -- 0:01:48 793500 -- (-2818.017) [-2815.919] (-2820.715) (-2810.169) * (-2821.259) (-2826.130) (-2819.657) [-2814.908] -- 0:01:47 794000 -- (-2816.436) (-2819.737) (-2814.380) [-2813.235] * (-2819.597) (-2814.811) (-2814.123) [-2816.473] -- 0:01:47 794500 -- (-2812.556) (-2832.545) [-2811.752] (-2813.294) * (-2815.361) (-2816.237) (-2817.363) [-2813.060] -- 0:01:47 795000 -- (-2819.653) (-2820.595) [-2818.461] (-2811.006) * (-2820.888) [-2820.706] (-2810.496) (-2814.826) -- 0:01:47 Average standard deviation of split frequencies: 0.003422 795500 -- (-2823.073) [-2811.033] (-2813.438) (-2809.641) * (-2825.298) [-2815.895] (-2812.283) (-2815.989) -- 0:01:46 796000 -- (-2814.232) (-2817.573) (-2822.721) [-2810.336] * (-2820.820) [-2819.003] (-2816.471) (-2812.613) -- 0:01:46 796500 -- [-2818.174] (-2820.614) (-2813.660) (-2816.722) * (-2815.101) [-2808.701] (-2815.430) (-2816.084) -- 0:01:46 797000 -- [-2812.597] (-2813.472) (-2820.966) (-2807.682) * (-2826.169) [-2811.317] (-2818.732) (-2812.620) -- 0:01:46 797500 -- [-2821.865] (-2823.402) (-2814.847) (-2813.496) * (-2820.760) [-2808.737] (-2826.268) (-2812.993) -- 0:01:45 798000 -- (-2810.236) (-2816.251) (-2814.715) [-2813.144] * (-2826.018) (-2810.643) (-2819.016) [-2814.869] -- 0:01:45 798500 -- (-2813.837) (-2819.931) (-2814.106) [-2815.651] * (-2831.086) [-2817.643] (-2814.257) (-2810.164) -- 0:01:45 799000 -- [-2818.789] (-2815.745) (-2805.992) (-2815.431) * [-2815.040] (-2813.704) (-2830.102) (-2809.705) -- 0:01:45 799500 -- (-2817.203) (-2809.937) (-2818.114) [-2822.468] * (-2817.487) (-2825.577) (-2822.223) [-2803.185] -- 0:01:44 800000 -- (-2809.452) (-2817.267) (-2812.896) [-2818.160] * (-2826.600) (-2829.222) [-2813.648] (-2812.463) -- 0:01:44 Average standard deviation of split frequencies: 0.003075 800500 -- (-2807.734) (-2818.310) [-2816.114] (-2817.950) * [-2808.486] (-2826.551) (-2819.142) (-2823.163) -- 0:01:44 801000 -- (-2816.909) (-2814.870) [-2814.082] (-2816.238) * [-2821.256] (-2815.000) (-2816.771) (-2811.628) -- 0:01:44 801500 -- [-2813.997] (-2818.511) (-2815.704) (-2813.733) * [-2817.646] (-2821.333) (-2820.224) (-2816.448) -- 0:01:43 802000 -- [-2810.246] (-2811.630) (-2806.668) (-2814.805) * (-2823.859) (-2812.979) [-2821.217] (-2822.771) -- 0:01:43 802500 -- (-2820.246) (-2824.021) [-2814.028] (-2821.398) * (-2818.518) [-2816.300] (-2816.640) (-2819.959) -- 0:01:43 803000 -- (-2821.622) (-2822.301) (-2814.526) [-2814.217] * [-2815.722] (-2818.958) (-2818.783) (-2814.551) -- 0:01:43 803500 -- [-2816.100] (-2810.804) (-2816.000) (-2818.405) * [-2816.329] (-2821.057) (-2822.566) (-2819.098) -- 0:01:42 804000 -- (-2814.073) (-2817.573) [-2818.383] (-2821.214) * (-2818.466) [-2816.567] (-2818.271) (-2816.139) -- 0:01:42 804500 -- [-2817.871] (-2809.870) (-2815.877) (-2819.604) * [-2814.390] (-2811.506) (-2820.880) (-2816.653) -- 0:01:42 805000 -- (-2818.728) (-2820.307) [-2812.659] (-2818.674) * (-2820.224) (-2815.421) [-2816.306] (-2820.066) -- 0:01:41 Average standard deviation of split frequencies: 0.003249 805500 -- (-2822.699) (-2829.133) (-2818.071) [-2813.024] * (-2819.156) [-2814.898] (-2840.683) (-2819.867) -- 0:01:41 806000 -- (-2817.951) (-2820.532) (-2832.998) [-2816.612] * (-2831.023) (-2818.226) (-2817.225) [-2815.752] -- 0:01:41 806500 -- (-2823.100) (-2828.305) [-2810.018] (-2822.038) * (-2821.037) [-2811.463] (-2813.340) (-2817.786) -- 0:01:41 807000 -- (-2814.945) [-2822.270] (-2819.032) (-2816.499) * [-2812.700] (-2814.321) (-2820.922) (-2813.481) -- 0:01:40 807500 -- (-2813.417) (-2820.394) (-2811.579) [-2818.641] * (-2818.495) (-2818.567) [-2808.116] (-2826.228) -- 0:01:40 808000 -- [-2818.546] (-2821.898) (-2811.132) (-2816.983) * [-2812.769] (-2820.631) (-2817.567) (-2816.239) -- 0:01:40 808500 -- (-2823.808) (-2815.308) [-2817.124] (-2825.039) * (-2813.663) [-2823.734] (-2820.306) (-2814.588) -- 0:01:40 809000 -- [-2823.471] (-2812.059) (-2813.879) (-2820.011) * (-2820.825) (-2821.172) [-2817.043] (-2819.311) -- 0:01:39 809500 -- (-2818.772) [-2815.619] (-2818.003) (-2814.654) * (-2824.384) (-2813.575) [-2809.639] (-2821.185) -- 0:01:39 810000 -- (-2815.884) (-2816.626) [-2824.521] (-2819.964) * (-2831.336) [-2815.198] (-2811.244) (-2813.310) -- 0:01:39 Average standard deviation of split frequencies: 0.003101 810500 -- (-2809.983) [-2806.973] (-2827.238) (-2823.225) * (-2819.819) (-2811.172) (-2816.642) [-2815.172] -- 0:01:39 811000 -- [-2823.842] (-2819.512) (-2813.358) (-2826.456) * (-2811.784) (-2815.239) (-2809.824) [-2812.841] -- 0:01:38 811500 -- [-2816.366] (-2817.414) (-2815.035) (-2819.243) * [-2813.855] (-2811.374) (-2815.737) (-2817.519) -- 0:01:38 812000 -- [-2814.449] (-2813.075) (-2816.926) (-2815.017) * (-2815.159) [-2811.383] (-2818.257) (-2827.703) -- 0:01:38 812500 -- (-2817.804) [-2819.659] (-2813.859) (-2819.739) * (-2818.920) (-2812.568) (-2815.038) [-2821.809] -- 0:01:38 813000 -- (-2813.849) (-2822.190) [-2822.890] (-2817.507) * (-2818.958) (-2821.908) (-2813.003) [-2825.033] -- 0:01:37 813500 -- (-2820.472) [-2817.339] (-2814.012) (-2812.591) * [-2814.143] (-2814.193) (-2819.617) (-2820.362) -- 0:01:37 814000 -- (-2823.098) (-2811.918) (-2810.898) [-2825.318] * [-2812.783] (-2818.580) (-2818.050) (-2816.253) -- 0:01:37 814500 -- (-2818.391) [-2813.828] (-2818.199) (-2820.610) * [-2820.150] (-2821.906) (-2826.984) (-2814.658) -- 0:01:37 815000 -- (-2826.974) [-2813.500] (-2815.628) (-2817.429) * (-2811.998) (-2815.031) [-2818.660] (-2818.676) -- 0:01:36 Average standard deviation of split frequencies: 0.002953 815500 -- [-2814.315] (-2812.190) (-2835.180) (-2830.069) * (-2819.752) [-2822.462] (-2823.637) (-2816.216) -- 0:01:36 816000 -- (-2823.017) [-2812.380] (-2827.965) (-2820.465) * (-2820.454) [-2819.105] (-2819.101) (-2823.607) -- 0:01:36 816500 -- (-2809.397) (-2818.735) [-2814.022] (-2823.042) * (-2821.520) (-2825.731) [-2812.475] (-2830.004) -- 0:01:35 817000 -- (-2813.473) (-2819.881) [-2813.516] (-2823.287) * [-2821.518] (-2809.862) (-2810.762) (-2827.188) -- 0:01:35 817500 -- (-2819.192) (-2819.269) [-2811.915] (-2825.300) * (-2816.108) [-2813.604] (-2818.518) (-2805.717) -- 0:01:35 818000 -- (-2824.161) (-2826.589) [-2815.894] (-2813.638) * (-2817.068) [-2820.821] (-2832.912) (-2818.103) -- 0:01:35 818500 -- (-2815.271) [-2813.776] (-2822.557) (-2818.429) * (-2817.920) (-2812.988) (-2810.874) [-2816.721] -- 0:01:34 819000 -- [-2810.726] (-2818.634) (-2820.029) (-2823.252) * (-2820.869) (-2810.714) (-2811.150) [-2814.256] -- 0:01:34 819500 -- (-2818.074) (-2825.985) [-2818.843] (-2807.771) * (-2819.045) (-2817.877) [-2809.162] (-2822.652) -- 0:01:34 820000 -- (-2830.581) (-2817.117) [-2817.507] (-2822.482) * [-2820.370] (-2818.090) (-2817.066) (-2816.131) -- 0:01:34 Average standard deviation of split frequencies: 0.003127 820500 -- (-2822.750) (-2816.064) [-2813.397] (-2821.205) * (-2822.284) (-2818.426) [-2818.540] (-2817.571) -- 0:01:33 821000 -- (-2820.099) (-2820.870) [-2812.269] (-2815.041) * [-2819.871] (-2820.117) (-2817.262) (-2817.468) -- 0:01:33 821500 -- (-2816.807) [-2824.222] (-2816.460) (-2820.892) * (-2816.834) (-2813.146) (-2819.087) [-2811.591] -- 0:01:33 822000 -- [-2815.888] (-2821.921) (-2817.015) (-2817.795) * (-2813.343) (-2817.374) (-2816.527) [-2815.229] -- 0:01:33 822500 -- (-2820.324) [-2820.385] (-2817.545) (-2815.212) * (-2821.724) (-2812.962) (-2817.727) [-2823.546] -- 0:01:33 823000 -- (-2824.087) (-2822.148) [-2819.398] (-2815.498) * (-2816.640) (-2814.524) (-2815.650) [-2809.119] -- 0:01:32 823500 -- (-2825.332) (-2811.390) [-2810.751] (-2816.440) * (-2810.649) (-2816.730) (-2813.016) [-2814.744] -- 0:01:32 824000 -- (-2820.139) (-2819.735) [-2816.018] (-2819.867) * (-2817.050) (-2812.115) [-2809.875] (-2825.483) -- 0:01:32 824500 -- (-2812.752) [-2814.056] (-2819.288) (-2813.896) * [-2816.140] (-2810.840) (-2814.064) (-2809.902) -- 0:01:31 825000 -- [-2814.654] (-2819.752) (-2810.338) (-2818.448) * (-2823.827) (-2812.724) [-2810.025] (-2816.052) -- 0:01:31 Average standard deviation of split frequencies: 0.003171 825500 -- [-2813.357] (-2822.397) (-2812.807) (-2819.596) * (-2820.484) (-2821.789) [-2816.285] (-2817.517) -- 0:01:31 826000 -- (-2822.076) [-2818.547] (-2817.472) (-2820.103) * (-2816.615) [-2813.901] (-2815.683) (-2816.532) -- 0:01:31 826500 -- (-2825.100) [-2817.860] (-2822.204) (-2818.862) * (-2807.791) (-2827.721) [-2813.889] (-2820.406) -- 0:01:30 827000 -- (-2817.919) [-2817.154] (-2811.165) (-2819.504) * [-2811.703] (-2819.269) (-2821.696) (-2809.337) -- 0:01:30 827500 -- (-2822.186) (-2824.935) [-2817.811] (-2816.909) * [-2810.944] (-2810.619) (-2817.222) (-2813.567) -- 0:01:30 828000 -- (-2806.251) (-2823.054) (-2812.999) [-2818.697] * (-2816.769) (-2825.235) (-2822.835) [-2811.329] -- 0:01:30 828500 -- (-2818.514) [-2823.420] (-2805.580) (-2825.099) * [-2812.599] (-2812.628) (-2817.907) (-2809.007) -- 0:01:29 829000 -- (-2823.099) (-2821.132) (-2814.775) [-2822.112] * (-2827.870) [-2814.358] (-2816.822) (-2813.481) -- 0:01:29 829500 -- (-2812.095) [-2827.180] (-2811.175) (-2814.628) * [-2813.078] (-2823.562) (-2812.514) (-2813.738) -- 0:01:29 830000 -- [-2820.456] (-2823.119) (-2815.392) (-2817.687) * (-2814.501) (-2815.745) [-2810.552] (-2818.496) -- 0:01:29 Average standard deviation of split frequencies: 0.003216 830500 -- (-2820.033) [-2820.562] (-2824.133) (-2819.290) * (-2810.926) (-2824.304) [-2814.521] (-2815.355) -- 0:01:28 831000 -- [-2813.313] (-2819.051) (-2816.505) (-2820.564) * (-2825.373) [-2819.648] (-2820.410) (-2822.306) -- 0:01:28 831500 -- (-2820.024) (-2814.961) (-2812.388) [-2808.189] * (-2819.423) (-2821.484) [-2819.833] (-2813.244) -- 0:01:28 832000 -- [-2814.073] (-2828.986) (-2827.413) (-2809.131) * (-2809.522) (-2824.414) (-2823.856) [-2812.028] -- 0:01:28 832500 -- (-2823.711) (-2812.366) (-2818.138) [-2815.574] * (-2818.472) [-2814.405] (-2820.352) (-2819.986) -- 0:01:27 833000 -- (-2816.689) [-2813.957] (-2829.890) (-2822.950) * [-2819.398] (-2814.929) (-2816.337) (-2813.425) -- 0:01:27 833500 -- (-2814.610) (-2816.734) (-2818.410) [-2818.017] * (-2819.702) (-2818.594) (-2811.738) [-2814.984] -- 0:01:27 834000 -- [-2820.396] (-2814.787) (-2820.569) (-2818.972) * (-2820.080) [-2814.164] (-2810.401) (-2817.008) -- 0:01:26 834500 -- (-2817.817) (-2826.279) (-2821.526) [-2814.460] * (-2825.452) [-2810.709] (-2814.630) (-2823.855) -- 0:01:26 835000 -- [-2806.336] (-2814.737) (-2815.234) (-2814.847) * [-2812.376] (-2808.741) (-2815.884) (-2817.737) -- 0:01:26 Average standard deviation of split frequencies: 0.003007 835500 -- (-2813.749) (-2812.048) [-2816.302] (-2816.723) * (-2826.750) (-2814.052) [-2811.608] (-2815.650) -- 0:01:26 836000 -- [-2814.221] (-2816.841) (-2818.419) (-2811.958) * (-2840.132) (-2812.643) (-2824.866) [-2811.485] -- 0:01:25 836500 -- [-2819.613] (-2817.062) (-2826.823) (-2816.097) * (-2814.416) (-2813.650) [-2816.366] (-2813.065) -- 0:01:25 837000 -- [-2817.366] (-2819.147) (-2818.009) (-2811.011) * (-2817.791) (-2819.270) [-2817.506] (-2819.145) -- 0:01:25 837500 -- (-2811.375) [-2817.465] (-2818.721) (-2812.815) * (-2815.490) [-2815.995] (-2821.781) (-2819.636) -- 0:01:25 838000 -- (-2821.424) (-2813.153) [-2813.615] (-2820.004) * (-2816.215) (-2819.066) (-2815.374) [-2817.612] -- 0:01:24 838500 -- (-2812.434) (-2815.504) (-2823.253) [-2808.383] * (-2822.113) (-2818.382) [-2815.062] (-2816.864) -- 0:01:24 839000 -- (-2820.145) (-2823.373) (-2823.081) [-2820.145] * (-2813.561) (-2821.150) [-2819.337] (-2814.661) -- 0:01:24 839500 -- (-2814.484) (-2814.449) (-2823.950) [-2815.862] * (-2819.322) (-2812.477) [-2806.505] (-2829.690) -- 0:01:24 840000 -- (-2811.498) [-2817.296] (-2810.808) (-2819.537) * (-2813.496) [-2812.815] (-2826.254) (-2816.216) -- 0:01:23 Average standard deviation of split frequencies: 0.002928 840500 -- [-2811.196] (-2815.363) (-2814.045) (-2817.393) * (-2810.567) [-2816.738] (-2826.326) (-2820.721) -- 0:01:23 841000 -- [-2807.251] (-2815.764) (-2816.262) (-2815.866) * (-2813.279) (-2815.472) [-2813.232] (-2818.860) -- 0:01:23 841500 -- (-2822.156) (-2810.245) (-2820.810) [-2810.437] * (-2814.627) (-2822.694) [-2815.197] (-2820.380) -- 0:01:23 842000 -- [-2821.516] (-2816.421) (-2811.928) (-2833.457) * [-2816.095] (-2817.547) (-2817.367) (-2820.738) -- 0:01:22 842500 -- (-2821.433) (-2813.297) (-2812.586) [-2821.241] * (-2821.111) (-2808.123) [-2816.785] (-2817.457) -- 0:01:22 843000 -- [-2821.353] (-2824.138) (-2811.480) (-2813.478) * (-2817.337) (-2822.672) [-2815.165] (-2819.535) -- 0:01:22 843500 -- (-2816.837) (-2811.839) (-2811.805) [-2811.086] * (-2808.496) (-2809.721) (-2822.080) [-2810.915] -- 0:01:22 844000 -- [-2811.621] (-2819.458) (-2814.431) (-2814.115) * (-2828.874) (-2817.736) (-2829.877) [-2812.875] -- 0:01:21 844500 -- (-2822.003) [-2814.866] (-2824.966) (-2821.845) * (-2815.697) [-2819.698] (-2818.788) (-2812.413) -- 0:01:21 845000 -- (-2811.778) [-2816.069] (-2823.332) (-2834.251) * [-2815.778] (-2818.862) (-2816.617) (-2827.629) -- 0:01:21 Average standard deviation of split frequencies: 0.002724 845500 -- (-2824.370) (-2820.384) (-2821.177) [-2810.778] * (-2815.502) [-2821.597] (-2829.635) (-2827.160) -- 0:01:20 846000 -- (-2813.367) [-2814.216] (-2810.292) (-2827.925) * (-2816.190) (-2814.684) [-2819.860] (-2822.016) -- 0:01:20 846500 -- (-2823.014) [-2814.759] (-2809.898) (-2827.853) * [-2812.021] (-2815.518) (-2819.070) (-2822.981) -- 0:01:20 847000 -- (-2818.069) [-2811.405] (-2820.853) (-2817.633) * (-2817.128) (-2823.517) (-2816.438) [-2816.329] -- 0:01:20 847500 -- [-2811.487] (-2824.196) (-2808.648) (-2821.426) * (-2818.499) [-2812.224] (-2816.670) (-2815.255) -- 0:01:19 848000 -- (-2812.420) [-2818.863] (-2815.910) (-2812.736) * (-2815.209) (-2823.062) [-2808.754] (-2816.532) -- 0:01:19 848500 -- (-2817.175) [-2815.569] (-2819.240) (-2821.799) * (-2826.692) (-2818.080) (-2815.960) [-2816.055] -- 0:01:19 849000 -- [-2819.073] (-2824.614) (-2820.806) (-2809.792) * (-2819.300) [-2822.611] (-2817.869) (-2810.810) -- 0:01:19 849500 -- (-2820.394) (-2821.689) [-2815.365] (-2814.139) * [-2807.730] (-2818.415) (-2815.872) (-2820.531) -- 0:01:18 850000 -- (-2815.162) (-2816.650) (-2812.776) [-2811.225] * [-2811.967] (-2819.172) (-2818.851) (-2818.061) -- 0:01:18 Average standard deviation of split frequencies: 0.002709 850500 -- [-2808.247] (-2814.469) (-2826.841) (-2812.830) * (-2815.992) (-2821.857) (-2811.741) [-2816.912] -- 0:01:18 851000 -- (-2816.841) [-2815.216] (-2809.416) (-2817.200) * [-2818.167] (-2822.847) (-2812.794) (-2815.679) -- 0:01:18 851500 -- (-2815.793) [-2817.666] (-2814.858) (-2817.229) * (-2813.632) (-2816.723) (-2811.966) [-2814.925] -- 0:01:17 852000 -- (-2823.413) (-2816.627) [-2822.026] (-2827.453) * (-2817.548) (-2825.439) (-2819.152) [-2816.381] -- 0:01:17 852500 -- (-2816.946) [-2815.242] (-2818.375) (-2833.337) * (-2815.935) [-2811.588] (-2810.214) (-2814.792) -- 0:01:17 853000 -- (-2818.523) (-2813.768) (-2815.148) [-2815.455] * (-2810.384) (-2819.812) [-2809.056] (-2825.358) -- 0:01:17 853500 -- (-2816.489) (-2813.303) [-2814.154] (-2816.256) * (-2817.504) (-2824.290) [-2812.262] (-2818.673) -- 0:01:16 854000 -- [-2818.927] (-2814.296) (-2816.100) (-2817.308) * (-2811.491) (-2819.706) [-2824.729] (-2826.481) -- 0:01:16 854500 -- (-2812.268) [-2814.501] (-2815.342) (-2823.440) * [-2818.536] (-2820.345) (-2812.470) (-2821.651) -- 0:01:16 855000 -- (-2815.278) (-2821.651) (-2820.879) [-2817.233] * (-2820.953) (-2816.798) (-2820.494) [-2815.297] -- 0:01:15 Average standard deviation of split frequencies: 0.002631 855500 -- (-2812.632) [-2818.150] (-2817.304) (-2821.297) * (-2812.436) (-2810.709) (-2811.011) [-2824.566] -- 0:01:15 856000 -- (-2827.880) (-2821.189) [-2813.185] (-2811.411) * [-2810.558] (-2818.117) (-2823.599) (-2816.128) -- 0:01:15 856500 -- (-2819.915) [-2817.160] (-2824.029) (-2813.510) * (-2817.300) [-2816.609] (-2819.081) (-2815.012) -- 0:01:15 857000 -- [-2811.977] (-2818.395) (-2817.082) (-2819.136) * (-2815.938) (-2821.142) [-2812.786] (-2815.042) -- 0:01:14 857500 -- [-2821.085] (-2819.098) (-2813.506) (-2822.730) * (-2816.304) (-2811.499) [-2815.670] (-2819.544) -- 0:01:14 858000 -- (-2822.435) (-2816.902) (-2812.484) [-2826.443] * [-2810.008] (-2812.439) (-2825.957) (-2808.909) -- 0:01:14 858500 -- [-2818.732] (-2818.491) (-2825.431) (-2826.521) * (-2814.005) [-2808.468] (-2814.871) (-2815.147) -- 0:01:14 859000 -- [-2816.087] (-2815.064) (-2815.526) (-2820.108) * (-2814.274) (-2819.483) (-2813.823) [-2815.760] -- 0:01:13 859500 -- (-2814.943) (-2820.449) [-2812.185] (-2815.303) * (-2816.859) [-2813.010] (-2812.020) (-2816.519) -- 0:01:13 860000 -- (-2830.216) (-2817.745) [-2811.727] (-2825.584) * (-2812.429) (-2810.932) (-2825.292) [-2821.090] -- 0:01:13 Average standard deviation of split frequencies: 0.002556 860500 -- [-2816.505] (-2815.722) (-2808.663) (-2815.810) * (-2813.601) [-2813.103] (-2822.015) (-2817.356) -- 0:01:13 861000 -- (-2822.531) (-2813.464) [-2814.772] (-2825.272) * (-2820.305) (-2816.904) [-2811.201] (-2809.636) -- 0:01:12 861500 -- (-2816.735) (-2826.469) (-2814.920) [-2807.713] * (-2817.829) (-2814.860) (-2816.688) [-2815.257] -- 0:01:12 862000 -- (-2816.504) [-2811.751] (-2816.327) (-2815.327) * [-2819.304] (-2819.010) (-2812.287) (-2811.420) -- 0:01:12 862500 -- (-2810.320) (-2815.842) [-2811.714] (-2811.032) * (-2823.297) [-2815.140] (-2818.989) (-2810.972) -- 0:01:12 863000 -- [-2817.880] (-2827.845) (-2814.060) (-2816.372) * (-2823.615) (-2818.315) [-2813.416] (-2810.987) -- 0:01:11 863500 -- (-2810.037) [-2817.182] (-2817.675) (-2816.914) * [-2811.043] (-2814.653) (-2811.716) (-2815.630) -- 0:01:11 864000 -- (-2819.164) (-2819.285) (-2818.400) [-2814.638] * (-2822.922) (-2814.009) [-2815.043] (-2824.407) -- 0:01:11 864500 -- (-2813.314) (-2816.587) [-2818.215] (-2821.187) * (-2820.758) (-2816.417) (-2819.054) [-2820.155] -- 0:01:11 865000 -- (-2819.253) (-2818.852) (-2812.464) [-2812.445] * [-2814.485] (-2815.817) (-2811.419) (-2820.568) -- 0:01:10 Average standard deviation of split frequencies: 0.002480 865500 -- (-2815.595) (-2827.018) [-2809.199] (-2808.294) * [-2818.076] (-2810.684) (-2822.158) (-2819.066) -- 0:01:10 866000 -- [-2815.668] (-2826.852) (-2817.676) (-2805.459) * (-2823.950) [-2813.132] (-2822.816) (-2818.945) -- 0:01:10 866500 -- (-2820.552) (-2811.042) (-2813.356) [-2808.912] * (-2816.934) [-2815.712] (-2815.017) (-2815.376) -- 0:01:09 867000 -- (-2816.628) (-2822.650) [-2810.499] (-2816.950) * (-2822.348) [-2809.552] (-2818.031) (-2824.902) -- 0:01:09 867500 -- (-2814.967) (-2817.854) [-2810.371] (-2822.668) * [-2815.630] (-2811.101) (-2812.696) (-2826.929) -- 0:01:09 868000 -- (-2817.538) (-2816.602) (-2813.256) [-2812.798] * (-2817.833) (-2822.974) [-2812.220] (-2828.711) -- 0:01:09 868500 -- (-2818.092) (-2809.556) (-2819.585) [-2814.505] * (-2817.104) [-2812.735] (-2819.849) (-2831.760) -- 0:01:08 869000 -- (-2816.439) (-2815.590) [-2824.271] (-2821.411) * (-2822.865) [-2821.057] (-2816.586) (-2826.872) -- 0:01:08 869500 -- (-2810.780) [-2815.619] (-2816.768) (-2828.057) * (-2840.508) (-2823.442) (-2811.410) [-2814.213] -- 0:01:08 870000 -- (-2824.693) (-2819.279) (-2821.178) [-2810.061] * (-2822.746) [-2812.035] (-2817.806) (-2817.633) -- 0:01:08 Average standard deviation of split frequencies: 0.002527 870500 -- (-2818.161) (-2832.141) (-2814.556) [-2814.742] * [-2817.643] (-2826.384) (-2817.537) (-2813.541) -- 0:01:07 871000 -- (-2824.320) [-2810.378] (-2817.717) (-2815.628) * (-2817.165) (-2820.323) [-2810.078] (-2810.817) -- 0:01:07 871500 -- (-2819.896) [-2813.764] (-2818.257) (-2810.199) * (-2828.396) [-2813.171] (-2814.987) (-2819.347) -- 0:01:07 872000 -- [-2820.202] (-2819.480) (-2811.622) (-2819.783) * [-2817.067] (-2815.206) (-2814.159) (-2816.443) -- 0:01:07 872500 -- (-2821.467) (-2820.669) (-2816.207) [-2814.988] * (-2815.852) (-2816.991) [-2817.257] (-2815.650) -- 0:01:06 873000 -- (-2826.463) (-2828.421) (-2826.940) [-2809.814] * (-2825.460) [-2813.017] (-2822.585) (-2813.288) -- 0:01:06 873500 -- (-2829.068) (-2815.080) [-2809.331] (-2818.843) * (-2821.290) [-2812.434] (-2813.124) (-2825.265) -- 0:01:06 874000 -- [-2812.073] (-2818.642) (-2814.233) (-2817.680) * (-2825.207) (-2817.030) (-2815.297) [-2808.738] -- 0:01:06 874500 -- (-2813.657) (-2817.837) (-2810.139) [-2816.439] * [-2816.053] (-2814.155) (-2829.945) (-2814.079) -- 0:01:05 875000 -- (-2815.711) [-2820.339] (-2810.926) (-2822.061) * (-2816.618) [-2818.040] (-2827.736) (-2814.544) -- 0:01:05 Average standard deviation of split frequencies: 0.002392 875500 -- [-2814.028] (-2824.572) (-2817.056) (-2815.480) * [-2816.145] (-2819.436) (-2814.926) (-2812.829) -- 0:01:05 876000 -- (-2810.050) (-2823.106) (-2815.385) [-2821.771] * (-2812.878) (-2817.454) (-2825.660) [-2818.388] -- 0:01:04 876500 -- (-2808.869) (-2836.229) [-2811.462] (-2823.975) * (-2816.590) [-2820.061] (-2814.722) (-2832.266) -- 0:01:04 877000 -- (-2810.187) (-2822.103) (-2820.159) [-2818.687] * (-2812.557) [-2819.971] (-2819.600) (-2826.251) -- 0:01:04 877500 -- [-2810.082] (-2816.901) (-2830.925) (-2820.769) * (-2822.862) [-2811.217] (-2820.212) (-2818.470) -- 0:01:04 878000 -- (-2821.680) (-2820.851) (-2819.691) [-2819.633] * (-2818.473) (-2816.000) (-2825.208) [-2816.894] -- 0:01:03 878500 -- (-2820.281) [-2821.789] (-2819.454) (-2822.579) * [-2816.431] (-2808.651) (-2823.153) (-2816.306) -- 0:01:03 879000 -- (-2812.668) [-2814.013] (-2821.748) (-2816.236) * (-2825.675) [-2810.177] (-2817.973) (-2817.200) -- 0:01:03 879500 -- (-2816.449) [-2814.314] (-2813.162) (-2815.994) * (-2820.860) (-2817.725) (-2827.099) [-2816.890] -- 0:01:03 880000 -- (-2818.911) (-2818.398) (-2824.429) [-2819.052] * (-2819.486) [-2814.301] (-2819.473) (-2808.130) -- 0:01:02 Average standard deviation of split frequencies: 0.002379 880500 -- (-2823.527) (-2819.661) [-2823.411] (-2815.982) * (-2812.288) (-2823.440) [-2814.484] (-2806.328) -- 0:01:02 881000 -- (-2815.985) [-2819.954] (-2822.231) (-2811.146) * (-2814.279) (-2828.689) (-2820.878) [-2811.177] -- 0:01:02 881500 -- (-2812.772) (-2820.000) [-2817.291] (-2822.212) * (-2810.800) [-2817.323] (-2818.356) (-2814.731) -- 0:01:02 882000 -- (-2817.708) [-2813.454] (-2818.185) (-2816.087) * (-2816.730) [-2816.419] (-2827.941) (-2824.105) -- 0:01:01 882500 -- (-2819.310) (-2811.141) (-2809.787) [-2812.900] * [-2814.813] (-2813.065) (-2822.141) (-2815.715) -- 0:01:01 883000 -- (-2811.527) (-2819.257) (-2812.813) [-2814.481] * (-2819.057) [-2805.649] (-2811.412) (-2814.723) -- 0:01:01 883500 -- [-2812.220] (-2813.403) (-2812.569) (-2823.345) * (-2815.591) (-2813.972) [-2811.135] (-2813.555) -- 0:01:01 884000 -- (-2813.387) [-2813.103] (-2817.294) (-2829.370) * (-2821.873) (-2813.984) [-2815.739] (-2822.010) -- 0:01:00 884500 -- (-2820.043) [-2811.274] (-2815.456) (-2818.156) * (-2809.898) [-2808.683] (-2817.763) (-2827.396) -- 0:01:00 885000 -- (-2824.794) (-2809.515) [-2807.429] (-2825.928) * (-2820.311) (-2810.905) [-2810.203] (-2811.597) -- 0:01:00 Average standard deviation of split frequencies: 0.002365 885500 -- (-2816.525) [-2811.284] (-2828.570) (-2820.686) * (-2822.016) [-2825.415] (-2816.201) (-2830.634) -- 0:00:59 886000 -- (-2822.078) (-2815.610) [-2816.061] (-2815.347) * [-2810.968] (-2824.383) (-2818.643) (-2820.175) -- 0:00:59 886500 -- (-2810.776) [-2815.563] (-2825.984) (-2817.765) * (-2817.430) (-2829.980) [-2815.599] (-2815.175) -- 0:00:59 887000 -- (-2815.048) (-2817.973) [-2823.432] (-2816.342) * (-2814.229) (-2821.384) (-2820.657) [-2816.902] -- 0:00:59 887500 -- (-2827.569) (-2820.646) [-2822.586] (-2814.926) * (-2813.503) (-2818.943) [-2812.418] (-2814.212) -- 0:00:58 888000 -- (-2818.748) (-2831.522) (-2822.872) [-2818.728] * (-2814.756) [-2808.323] (-2811.475) (-2813.624) -- 0:00:58 888500 -- (-2825.828) (-2830.712) (-2819.438) [-2812.463] * (-2817.115) (-2818.179) [-2813.423] (-2814.688) -- 0:00:58 889000 -- (-2817.148) (-2816.827) (-2815.297) [-2816.608] * [-2810.276] (-2813.348) (-2829.265) (-2818.030) -- 0:00:58 889500 -- [-2815.962] (-2822.524) (-2817.738) (-2812.802) * (-2815.055) (-2816.637) [-2811.808] (-2825.247) -- 0:00:57 890000 -- (-2816.348) [-2816.436] (-2818.996) (-2817.831) * (-2811.572) [-2808.562] (-2810.438) (-2813.406) -- 0:00:57 Average standard deviation of split frequencies: 0.002470 890500 -- [-2820.146] (-2823.169) (-2815.967) (-2814.428) * (-2814.281) [-2806.599] (-2816.307) (-2823.730) -- 0:00:57 891000 -- [-2807.993] (-2812.189) (-2824.103) (-2819.983) * [-2818.877] (-2818.921) (-2815.511) (-2815.672) -- 0:00:57 891500 -- (-2812.733) [-2808.465] (-2823.126) (-2818.746) * (-2813.313) (-2812.714) [-2817.749] (-2826.613) -- 0:00:56 892000 -- (-2820.020) (-2817.288) [-2824.663] (-2822.242) * [-2811.601] (-2824.894) (-2822.349) (-2816.169) -- 0:00:56 892500 -- [-2815.377] (-2816.052) (-2819.649) (-2817.985) * (-2807.356) (-2816.606) (-2812.421) [-2811.430] -- 0:00:56 893000 -- (-2812.998) (-2814.207) (-2831.639) [-2814.625] * [-2809.033] (-2809.533) (-2810.676) (-2814.240) -- 0:00:56 893500 -- (-2810.069) (-2817.768) (-2817.496) [-2813.977] * (-2815.754) (-2811.398) (-2813.293) [-2820.905] -- 0:00:55 894000 -- (-2824.114) [-2818.366] (-2811.047) (-2822.576) * (-2822.344) [-2814.368] (-2811.217) (-2817.569) -- 0:00:55 894500 -- (-2816.658) [-2810.696] (-2812.459) (-2816.773) * (-2820.417) (-2819.105) (-2816.919) [-2819.852] -- 0:00:55 895000 -- (-2813.083) (-2814.943) (-2811.572) [-2810.829] * [-2816.047] (-2819.700) (-2816.160) (-2815.944) -- 0:00:55 Average standard deviation of split frequencies: 0.002514 895500 -- (-2820.129) (-2820.085) [-2809.829] (-2821.145) * (-2816.300) (-2815.491) (-2822.266) [-2811.900] -- 0:00:54 896000 -- [-2813.600] (-2818.212) (-2820.797) (-2819.901) * [-2816.503] (-2819.148) (-2817.580) (-2811.483) -- 0:00:54 896500 -- (-2810.460) [-2810.266] (-2814.641) (-2819.945) * [-2812.843] (-2811.507) (-2821.338) (-2813.552) -- 0:00:54 897000 -- (-2814.859) (-2823.154) (-2812.954) [-2822.401] * [-2821.310] (-2812.409) (-2815.129) (-2813.817) -- 0:00:53 897500 -- (-2819.414) (-2821.227) (-2812.127) [-2813.949] * (-2829.907) (-2816.006) (-2816.380) [-2820.401] -- 0:00:53 898000 -- (-2817.345) [-2816.142] (-2811.795) (-2818.665) * (-2823.684) (-2818.622) (-2818.810) [-2812.890] -- 0:00:53 898500 -- (-2813.304) (-2821.773) [-2813.215] (-2820.176) * [-2813.100] (-2816.919) (-2813.425) (-2811.858) -- 0:00:53 899000 -- (-2821.269) (-2815.635) [-2824.219] (-2814.785) * (-2826.674) (-2815.966) [-2816.657] (-2822.317) -- 0:00:52 899500 -- (-2813.242) (-2812.348) [-2821.223] (-2815.584) * (-2817.655) [-2817.495] (-2822.592) (-2813.851) -- 0:00:52 900000 -- [-2817.859] (-2818.832) (-2824.641) (-2824.358) * (-2821.915) (-2821.930) [-2819.267] (-2821.984) -- 0:00:52 Average standard deviation of split frequencies: 0.002326 900500 -- [-2816.250] (-2817.582) (-2824.568) (-2827.615) * (-2817.349) (-2822.332) (-2808.706) [-2819.522] -- 0:00:52 901000 -- (-2829.698) (-2825.353) (-2823.106) [-2810.302] * (-2824.649) (-2823.003) (-2814.365) [-2816.460] -- 0:00:51 901500 -- [-2812.762] (-2818.189) (-2814.298) (-2810.595) * (-2828.160) [-2816.809] (-2816.126) (-2818.829) -- 0:00:51 902000 -- (-2829.592) (-2816.779) [-2827.836] (-2813.694) * (-2811.850) [-2818.823] (-2815.511) (-2822.115) -- 0:00:51 902500 -- (-2822.232) [-2818.234] (-2824.910) (-2813.456) * [-2812.770] (-2812.496) (-2818.296) (-2815.628) -- 0:00:50 903000 -- (-2816.124) (-2818.032) [-2819.323] (-2815.608) * (-2811.309) (-2817.885) (-2827.151) [-2811.380] -- 0:00:50 903500 -- (-2816.428) [-2810.327] (-2814.527) (-2811.750) * (-2815.596) [-2816.219] (-2821.606) (-2817.558) -- 0:00:50 904000 -- (-2820.413) (-2812.299) [-2811.648] (-2818.671) * [-2814.522] (-2816.152) (-2840.231) (-2812.980) -- 0:00:50 904500 -- [-2811.001] (-2810.782) (-2821.528) (-2815.510) * (-2820.217) (-2812.050) (-2820.302) [-2817.082] -- 0:00:50 905000 -- [-2812.166] (-2817.013) (-2820.980) (-2822.991) * [-2820.528] (-2816.327) (-2822.077) (-2823.762) -- 0:00:49 Average standard deviation of split frequencies: 0.002428 905500 -- (-2817.396) [-2812.031] (-2822.477) (-2818.763) * (-2811.198) [-2819.228] (-2832.902) (-2811.779) -- 0:00:49 906000 -- [-2817.189] (-2825.221) (-2815.515) (-2841.789) * [-2817.047] (-2813.959) (-2821.465) (-2816.118) -- 0:00:49 906500 -- (-2815.935) [-2815.634] (-2827.480) (-2823.163) * (-2820.019) (-2814.740) [-2813.648] (-2817.950) -- 0:00:48 907000 -- (-2827.324) (-2814.663) (-2826.186) [-2816.925] * [-2812.455] (-2809.944) (-2817.878) (-2810.712) -- 0:00:48 907500 -- (-2817.739) (-2813.894) (-2825.497) [-2811.313] * (-2820.553) (-2812.305) [-2821.593] (-2820.704) -- 0:00:48 908000 -- (-2813.651) [-2818.242] (-2826.621) (-2816.668) * (-2814.719) (-2812.467) (-2814.113) [-2812.453] -- 0:00:48 908500 -- [-2814.681] (-2818.350) (-2809.971) (-2819.528) * [-2816.606] (-2820.454) (-2816.027) (-2821.668) -- 0:00:47 909000 -- (-2822.211) (-2823.446) [-2818.661] (-2819.809) * (-2829.889) [-2819.659] (-2818.943) (-2822.891) -- 0:00:47 909500 -- [-2817.006] (-2821.326) (-2819.590) (-2821.528) * (-2820.139) (-2813.164) (-2818.034) [-2815.032] -- 0:00:47 910000 -- (-2811.160) (-2818.462) (-2812.416) [-2813.169] * [-2818.530] (-2811.271) (-2808.007) (-2822.510) -- 0:00:47 Average standard deviation of split frequencies: 0.002301 910500 -- [-2817.309] (-2824.729) (-2813.620) (-2816.625) * (-2821.059) [-2824.332] (-2816.151) (-2828.539) -- 0:00:46 911000 -- [-2813.059] (-2815.256) (-2815.315) (-2818.344) * (-2820.932) (-2813.578) [-2818.185] (-2818.516) -- 0:00:46 911500 -- (-2819.689) (-2807.153) [-2811.911] (-2818.999) * (-2832.148) (-2814.982) (-2818.482) [-2812.859] -- 0:00:46 912000 -- [-2816.388] (-2812.565) (-2840.111) (-2821.203) * (-2820.936) (-2818.217) [-2814.916] (-2821.925) -- 0:00:46 912500 -- [-2815.647] (-2813.310) (-2815.503) (-2806.854) * (-2825.307) (-2819.851) (-2807.537) [-2816.594] -- 0:00:45 913000 -- [-2816.767] (-2820.144) (-2823.465) (-2815.664) * (-2818.459) (-2819.182) (-2828.917) [-2814.728] -- 0:00:45 913500 -- (-2818.055) (-2813.765) (-2822.178) [-2808.436] * (-2816.759) [-2820.497] (-2814.476) (-2817.079) -- 0:00:45 914000 -- [-2808.702] (-2826.584) (-2813.207) (-2817.231) * (-2814.202) (-2817.966) [-2811.786] (-2818.917) -- 0:00:44 914500 -- (-2812.848) (-2824.126) (-2807.715) [-2812.299] * (-2813.996) (-2809.494) [-2818.739] (-2815.539) -- 0:00:44 915000 -- (-2819.767) [-2819.440] (-2823.275) (-2814.874) * (-2818.677) (-2813.560) (-2816.422) [-2817.124] -- 0:00:44 Average standard deviation of split frequencies: 0.002230 915500 -- (-2831.901) (-2815.540) (-2817.655) [-2806.242] * (-2818.357) [-2818.249] (-2821.608) (-2810.109) -- 0:00:44 916000 -- (-2814.243) (-2815.618) (-2827.671) [-2814.075] * (-2815.361) (-2811.719) [-2811.740] (-2836.601) -- 0:00:44 916500 -- (-2815.731) (-2816.694) (-2814.843) [-2811.308] * (-2817.280) [-2815.459] (-2820.740) (-2825.736) -- 0:00:43 917000 -- [-2816.604] (-2820.747) (-2820.177) (-2825.979) * (-2813.237) [-2816.333] (-2814.094) (-2822.709) -- 0:00:43 917500 -- (-2813.179) (-2825.160) (-2818.134) [-2811.873] * (-2813.777) [-2815.675] (-2810.202) (-2822.636) -- 0:00:43 918000 -- (-2823.462) (-2815.405) [-2818.308] (-2819.543) * (-2814.706) (-2819.062) [-2817.473] (-2825.417) -- 0:00:42 918500 -- (-2827.217) (-2811.028) (-2822.606) [-2822.910] * (-2821.495) (-2816.266) [-2819.719] (-2819.305) -- 0:00:42 919000 -- [-2820.376] (-2820.518) (-2815.545) (-2815.190) * (-2816.430) (-2813.009) (-2831.664) [-2813.134] -- 0:00:42 919500 -- [-2814.068] (-2817.855) (-2816.880) (-2810.514) * (-2819.047) (-2813.776) (-2817.357) [-2812.075] -- 0:00:42 920000 -- [-2811.621] (-2820.071) (-2813.895) (-2811.839) * (-2814.772) [-2811.871] (-2822.508) (-2821.633) -- 0:00:41 Average standard deviation of split frequencies: 0.002162 920500 -- [-2821.028] (-2820.940) (-2813.525) (-2810.371) * [-2813.363] (-2816.657) (-2814.375) (-2840.063) -- 0:00:41 921000 -- (-2819.422) (-2822.960) [-2805.745] (-2815.929) * (-2812.977) [-2818.056] (-2817.939) (-2824.095) -- 0:00:41 921500 -- (-2811.454) (-2814.930) (-2812.743) [-2811.065] * (-2818.971) (-2819.560) [-2816.522] (-2821.333) -- 0:00:41 922000 -- (-2817.452) (-2808.757) (-2829.481) [-2811.759] * (-2812.951) (-2831.907) [-2812.807] (-2819.661) -- 0:00:40 922500 -- (-2822.221) (-2812.277) (-2814.068) [-2811.392] * (-2818.834) (-2821.165) [-2818.359] (-2821.954) -- 0:00:40 923000 -- [-2819.363] (-2819.823) (-2819.919) (-2824.043) * (-2813.649) (-2820.905) (-2811.329) [-2816.306] -- 0:00:40 923500 -- (-2820.460) (-2821.132) (-2818.670) [-2817.357] * (-2817.684) (-2823.754) [-2821.016] (-2814.904) -- 0:00:40 924000 -- (-2818.461) (-2817.827) (-2808.818) [-2817.786] * (-2831.297) (-2818.461) [-2814.856] (-2817.037) -- 0:00:39 924500 -- (-2824.127) (-2814.229) [-2817.754] (-2818.372) * (-2820.688) (-2820.044) (-2821.635) [-2815.963] -- 0:00:39 925000 -- [-2822.297] (-2821.906) (-2814.281) (-2821.015) * [-2812.752] (-2814.386) (-2822.027) (-2821.319) -- 0:00:39 Average standard deviation of split frequencies: 0.002036 925500 -- [-2814.516] (-2824.882) (-2820.822) (-2814.095) * (-2820.390) (-2824.114) (-2818.041) [-2817.511] -- 0:00:38 926000 -- (-2819.590) (-2809.962) (-2822.760) [-2808.582] * (-2828.974) [-2811.357] (-2817.392) (-2821.055) -- 0:00:38 926500 -- (-2816.913) (-2818.991) (-2820.157) [-2818.957] * (-2812.265) [-2813.325] (-2819.010) (-2822.115) -- 0:00:38 927000 -- (-2822.912) (-2813.095) [-2810.839] (-2822.365) * [-2823.126] (-2823.943) (-2824.625) (-2809.630) -- 0:00:38 927500 -- [-2817.342] (-2824.787) (-2816.080) (-2821.884) * [-2811.831] (-2814.535) (-2817.456) (-2819.629) -- 0:00:37 928000 -- [-2818.414] (-2812.900) (-2829.062) (-2819.007) * (-2817.242) (-2826.628) [-2812.360] (-2821.877) -- 0:00:37 928500 -- (-2809.390) [-2812.170] (-2821.158) (-2829.899) * (-2817.000) (-2822.778) [-2815.464] (-2814.362) -- 0:00:37 929000 -- (-2817.411) (-2818.093) (-2814.096) [-2820.579] * (-2820.181) [-2813.921] (-2815.972) (-2820.483) -- 0:00:37 929500 -- [-2812.919] (-2824.673) (-2808.607) (-2816.162) * (-2817.417) (-2813.574) (-2823.457) [-2811.937] -- 0:00:36 930000 -- (-2822.161) (-2816.523) [-2812.431] (-2813.070) * (-2813.433) (-2818.605) (-2814.509) [-2811.810] -- 0:00:36 Average standard deviation of split frequencies: 0.001970 930500 -- (-2821.716) [-2816.577] (-2812.529) (-2818.147) * (-2822.656) [-2816.070] (-2814.007) (-2821.257) -- 0:00:36 931000 -- (-2816.183) (-2813.351) (-2814.291) [-2814.820] * (-2819.772) (-2818.309) [-2810.685] (-2819.797) -- 0:00:36 931500 -- [-2810.936] (-2820.214) (-2815.182) (-2813.167) * (-2810.541) (-2821.530) (-2806.737) [-2810.627] -- 0:00:35 932000 -- (-2810.995) [-2808.348] (-2814.147) (-2812.148) * (-2815.614) (-2823.431) [-2815.593] (-2811.469) -- 0:00:35 932500 -- (-2817.268) [-2814.294] (-2823.712) (-2828.035) * (-2807.433) (-2813.607) (-2825.027) [-2807.698] -- 0:00:35 933000 -- [-2808.273] (-2810.228) (-2813.401) (-2819.661) * (-2811.794) (-2808.667) (-2816.772) [-2812.819] -- 0:00:35 933500 -- (-2816.969) (-2809.528) [-2809.166] (-2819.234) * [-2816.236] (-2811.807) (-2809.262) (-2810.845) -- 0:00:34 934000 -- [-2811.290] (-2813.263) (-2814.032) (-2819.050) * (-2813.721) (-2821.216) (-2815.510) [-2816.694] -- 0:00:34 934500 -- (-2815.684) [-2820.697] (-2815.239) (-2816.601) * (-2818.798) (-2820.260) (-2810.893) [-2817.773] -- 0:00:34 935000 -- [-2821.824] (-2812.689) (-2818.628) (-2814.698) * (-2825.829) [-2815.889] (-2813.834) (-2815.621) -- 0:00:33 Average standard deviation of split frequencies: 0.001847 935500 -- (-2812.787) (-2817.240) [-2816.863] (-2819.269) * (-2819.270) (-2816.301) (-2812.167) [-2813.062] -- 0:00:33 936000 -- [-2818.362] (-2822.310) (-2816.120) (-2814.050) * (-2817.680) [-2815.123] (-2815.431) (-2816.710) -- 0:00:33 936500 -- (-2817.537) (-2822.727) (-2810.858) [-2817.421] * (-2817.754) (-2820.784) [-2806.598] (-2813.960) -- 0:00:33 937000 -- (-2825.217) [-2811.863] (-2810.141) (-2810.197) * (-2820.447) (-2824.589) [-2812.579] (-2826.033) -- 0:00:32 937500 -- (-2816.713) (-2811.917) [-2824.885] (-2819.517) * [-2819.447] (-2814.896) (-2819.046) (-2814.232) -- 0:00:32 938000 -- [-2813.169] (-2816.045) (-2832.724) (-2811.659) * (-2822.376) (-2812.349) (-2822.674) [-2821.617] -- 0:00:32 938500 -- [-2811.539] (-2817.897) (-2821.839) (-2811.208) * [-2813.794] (-2815.175) (-2826.754) (-2819.823) -- 0:00:32 939000 -- [-2824.081] (-2823.781) (-2810.788) (-2809.938) * (-2814.340) (-2814.902) [-2807.570] (-2826.133) -- 0:00:31 939500 -- [-2827.644] (-2814.725) (-2818.496) (-2813.620) * (-2817.226) (-2818.999) [-2809.956] (-2816.081) -- 0:00:31 940000 -- (-2828.315) (-2815.186) (-2817.868) [-2817.171] * (-2821.831) [-2815.118] (-2816.436) (-2813.513) -- 0:00:31 Average standard deviation of split frequencies: 0.001726 940500 -- (-2822.854) (-2818.376) [-2818.302] (-2821.464) * (-2820.124) [-2823.867] (-2823.871) (-2821.359) -- 0:00:31 941000 -- [-2818.627] (-2823.727) (-2817.952) (-2818.503) * (-2813.797) (-2820.224) [-2819.202] (-2812.158) -- 0:00:30 941500 -- (-2813.383) (-2821.580) (-2819.782) [-2811.798] * (-2809.201) [-2815.714] (-2816.795) (-2819.337) -- 0:00:30 942000 -- (-2812.903) [-2821.010] (-2815.833) (-2822.437) * [-2819.992] (-2821.885) (-2817.961) (-2811.826) -- 0:00:30 942500 -- (-2819.151) (-2820.106) (-2811.736) [-2819.899] * [-2815.577] (-2820.182) (-2823.914) (-2814.762) -- 0:00:30 943000 -- (-2816.525) (-2827.704) [-2815.845] (-2815.652) * (-2812.384) [-2813.342] (-2817.446) (-2817.260) -- 0:00:29 943500 -- (-2810.920) [-2816.531] (-2816.508) (-2825.242) * (-2831.138) [-2818.013] (-2824.301) (-2812.218) -- 0:00:29 944000 -- [-2813.566] (-2811.940) (-2813.112) (-2810.356) * (-2822.037) (-2817.575) (-2816.968) [-2817.120] -- 0:00:29 944500 -- [-2819.054] (-2816.953) (-2812.168) (-2820.899) * [-2806.538] (-2823.965) (-2821.643) (-2820.006) -- 0:00:29 945000 -- (-2817.121) (-2826.846) (-2810.635) [-2815.742] * (-2812.456) (-2815.194) [-2819.890] (-2822.424) -- 0:00:28 Average standard deviation of split frequencies: 0.001550 945500 -- (-2810.047) (-2821.372) [-2811.199] (-2809.692) * [-2812.251] (-2826.708) (-2825.306) (-2827.683) -- 0:00:28 946000 -- (-2817.636) (-2812.495) (-2813.798) [-2812.594] * (-2820.988) [-2815.930] (-2822.474) (-2825.092) -- 0:00:28 946500 -- (-2812.525) (-2813.777) [-2812.184] (-2810.750) * (-2832.377) (-2816.405) (-2823.617) [-2821.220] -- 0:00:27 947000 -- [-2812.542] (-2830.490) (-2817.674) (-2817.741) * (-2819.105) [-2815.958] (-2815.156) (-2817.590) -- 0:00:27 947500 -- [-2813.201] (-2816.915) (-2817.231) (-2820.465) * (-2815.659) (-2815.628) [-2809.715] (-2814.154) -- 0:00:27 948000 -- (-2821.414) (-2809.685) (-2812.469) [-2817.323] * (-2815.392) (-2815.876) [-2815.361] (-2824.061) -- 0:00:27 948500 -- (-2820.753) (-2821.784) [-2813.545] (-2813.352) * (-2818.793) (-2816.163) [-2815.131] (-2816.257) -- 0:00:26 949000 -- (-2816.110) (-2820.365) (-2822.081) [-2812.118] * (-2813.836) [-2809.117] (-2818.427) (-2815.660) -- 0:00:26 949500 -- (-2820.943) (-2821.070) [-2813.420] (-2811.826) * (-2821.476) (-2817.991) (-2814.233) [-2810.118] -- 0:00:26 950000 -- (-2815.126) (-2814.652) [-2817.641] (-2817.116) * (-2826.306) (-2813.044) (-2814.951) [-2809.788] -- 0:00:26 Average standard deviation of split frequencies: 0.001598 950500 -- (-2814.832) (-2818.322) [-2818.234] (-2818.932) * (-2826.000) [-2816.938] (-2822.478) (-2813.335) -- 0:00:25 951000 -- (-2815.005) [-2813.777] (-2821.055) (-2817.169) * (-2811.772) (-2820.637) [-2815.013] (-2816.192) -- 0:00:25 951500 -- (-2822.480) [-2813.731] (-2816.890) (-2824.063) * (-2822.202) (-2827.858) (-2813.454) [-2814.801] -- 0:00:25 952000 -- (-2816.390) (-2810.227) [-2812.123] (-2809.516) * (-2830.993) (-2820.812) [-2810.711] (-2810.915) -- 0:00:25 952500 -- (-2826.238) (-2821.589) [-2812.593] (-2812.350) * (-2815.731) (-2820.089) (-2811.987) [-2815.904] -- 0:00:24 953000 -- (-2824.865) (-2818.629) (-2812.070) [-2822.408] * (-2821.603) (-2808.648) (-2819.702) [-2811.558] -- 0:00:24 953500 -- (-2828.161) [-2826.383] (-2822.182) (-2820.754) * [-2810.795] (-2812.233) (-2819.245) (-2814.272) -- 0:00:24 954000 -- (-2815.853) (-2824.283) (-2823.371) [-2810.415] * [-2822.141] (-2813.202) (-2819.684) (-2817.783) -- 0:00:24 954500 -- (-2822.591) (-2820.612) (-2821.032) [-2812.883] * [-2814.108] (-2812.144) (-2823.530) (-2821.435) -- 0:00:23 955000 -- (-2818.896) [-2820.081] (-2813.701) (-2808.271) * (-2821.962) [-2812.941] (-2830.735) (-2819.650) -- 0:00:23 Average standard deviation of split frequencies: 0.001589 955500 -- (-2820.743) [-2812.753] (-2820.703) (-2816.151) * (-2828.351) (-2816.866) (-2817.225) [-2814.531] -- 0:00:23 956000 -- [-2813.159] (-2823.875) (-2818.361) (-2819.784) * (-2826.142) (-2821.300) [-2815.893] (-2814.951) -- 0:00:23 956500 -- (-2815.059) (-2815.579) [-2811.062] (-2817.445) * [-2814.885] (-2821.289) (-2814.450) (-2811.665) -- 0:00:22 957000 -- (-2816.683) (-2818.926) [-2814.693] (-2814.467) * (-2817.843) (-2828.344) [-2814.262] (-2817.549) -- 0:00:22 957500 -- (-2814.576) (-2810.255) [-2806.096] (-2814.031) * (-2808.177) (-2815.325) [-2807.585] (-2823.733) -- 0:00:22 958000 -- (-2823.913) (-2822.919) [-2811.059] (-2811.568) * (-2815.485) (-2818.845) (-2812.455) [-2817.061] -- 0:00:21 958500 -- [-2815.928] (-2819.890) (-2815.728) (-2822.132) * (-2814.499) (-2815.828) [-2812.504] (-2822.208) -- 0:00:21 959000 -- [-2814.186] (-2819.918) (-2822.072) (-2814.848) * (-2814.980) (-2825.942) [-2814.837] (-2822.083) -- 0:00:21 959500 -- (-2815.990) (-2816.597) [-2813.149] (-2823.774) * [-2813.869] (-2828.774) (-2818.225) (-2811.824) -- 0:00:21 960000 -- (-2821.728) (-2817.324) [-2819.661] (-2820.326) * (-2818.344) (-2824.841) (-2828.889) [-2820.612] -- 0:00:20 Average standard deviation of split frequencies: 0.001690 960500 -- (-2812.659) [-2810.165] (-2816.982) (-2821.208) * (-2818.406) [-2813.249] (-2821.381) (-2826.147) -- 0:00:20 961000 -- (-2813.940) [-2814.144] (-2825.207) (-2827.860) * (-2808.580) [-2814.371] (-2818.131) (-2814.381) -- 0:00:20 961500 -- (-2811.894) (-2818.942) [-2809.814] (-2818.919) * (-2822.129) [-2817.963] (-2827.184) (-2814.031) -- 0:00:20 962000 -- (-2815.286) [-2819.443] (-2812.191) (-2818.941) * (-2817.296) (-2818.926) (-2816.035) [-2821.668] -- 0:00:19 962500 -- [-2816.912] (-2821.745) (-2810.974) (-2810.265) * (-2827.823) (-2825.833) [-2815.250] (-2830.252) -- 0:00:19 963000 -- (-2818.237) (-2811.032) (-2827.322) [-2815.587] * (-2814.038) (-2818.358) [-2822.933] (-2812.300) -- 0:00:19 963500 -- (-2816.411) (-2815.460) (-2810.010) [-2818.908] * (-2821.276) (-2806.264) (-2818.810) [-2813.661] -- 0:00:19 964000 -- (-2809.435) (-2817.962) (-2815.719) [-2809.481] * (-2819.327) (-2820.333) [-2813.140] (-2822.120) -- 0:00:18 964500 -- [-2820.663] (-2815.427) (-2811.603) (-2827.482) * (-2820.817) [-2816.876] (-2819.581) (-2816.915) -- 0:00:18 965000 -- (-2817.359) (-2806.928) [-2815.620] (-2814.140) * (-2823.766) (-2822.717) (-2820.893) [-2822.747] -- 0:00:18 Average standard deviation of split frequencies: 0.001789 965500 -- (-2822.220) (-2822.966) [-2811.322] (-2825.065) * (-2823.663) (-2824.536) [-2817.392] (-2819.109) -- 0:00:18 966000 -- [-2815.457] (-2818.916) (-2815.792) (-2816.644) * (-2837.488) [-2810.204] (-2818.182) (-2812.630) -- 0:00:17 966500 -- [-2812.273] (-2813.933) (-2817.328) (-2815.328) * (-2844.384) (-2815.230) [-2813.709] (-2816.428) -- 0:00:17 967000 -- [-2815.311] (-2814.812) (-2838.226) (-2816.029) * (-2822.688) [-2818.142] (-2812.853) (-2813.768) -- 0:00:17 967500 -- [-2818.234] (-2818.600) (-2825.000) (-2822.619) * (-2820.266) [-2822.872] (-2814.873) (-2813.314) -- 0:00:16 968000 -- [-2811.386] (-2811.670) (-2833.557) (-2818.974) * (-2814.663) (-2816.361) (-2814.060) [-2809.993] -- 0:00:16 968500 -- (-2820.577) (-2819.027) [-2820.335] (-2829.333) * (-2829.169) (-2816.564) [-2814.417] (-2817.206) -- 0:00:16 969000 -- [-2818.471] (-2812.498) (-2821.814) (-2819.903) * (-2829.793) (-2825.878) [-2823.972] (-2820.003) -- 0:00:16 969500 -- (-2823.536) (-2820.666) [-2821.592] (-2814.220) * [-2821.783] (-2827.945) (-2813.899) (-2817.185) -- 0:00:15 970000 -- (-2817.748) (-2826.361) [-2810.312] (-2824.158) * (-2815.782) (-2821.401) (-2822.549) [-2816.553] -- 0:00:15 Average standard deviation of split frequencies: 0.001673 970500 -- [-2813.958] (-2820.575) (-2818.999) (-2816.567) * (-2816.775) (-2813.971) [-2810.427] (-2824.190) -- 0:00:15 971000 -- [-2807.997] (-2815.815) (-2818.723) (-2817.219) * (-2812.562) [-2812.177] (-2814.537) (-2821.554) -- 0:00:15 971500 -- (-2819.989) (-2809.217) (-2816.222) [-2815.718] * (-2817.475) (-2814.879) (-2822.589) [-2811.848] -- 0:00:14 972000 -- (-2821.942) [-2806.360] (-2814.513) (-2819.765) * (-2825.899) (-2824.172) (-2821.605) [-2819.301] -- 0:00:14 972500 -- (-2825.219) (-2814.754) [-2809.443] (-2814.924) * [-2816.825] (-2821.923) (-2827.363) (-2813.347) -- 0:00:14 973000 -- (-2821.191) (-2818.732) (-2811.001) [-2815.011] * (-2817.077) (-2819.672) [-2817.826] (-2820.528) -- 0:00:14 973500 -- (-2821.229) [-2811.039] (-2815.373) (-2825.861) * (-2817.667) (-2816.860) (-2817.235) [-2818.044] -- 0:00:13 974000 -- [-2816.683] (-2816.122) (-2819.379) (-2819.895) * (-2813.699) [-2814.922] (-2813.350) (-2811.979) -- 0:00:13 974500 -- (-2814.608) [-2817.369] (-2815.057) (-2816.183) * (-2814.241) [-2807.003] (-2819.432) (-2813.733) -- 0:00:13 975000 -- [-2823.653] (-2824.328) (-2813.713) (-2813.514) * (-2822.309) [-2812.781] (-2818.209) (-2813.003) -- 0:00:13 Average standard deviation of split frequencies: 0.001878 975500 -- (-2816.060) (-2818.766) [-2816.631] (-2822.308) * (-2818.935) (-2824.231) [-2820.048] (-2818.770) -- 0:00:12 976000 -- [-2813.884] (-2820.842) (-2811.155) (-2823.018) * (-2824.807) (-2819.485) (-2815.675) [-2820.799] -- 0:00:12 976500 -- (-2821.012) (-2814.663) (-2813.797) [-2813.020] * (-2819.074) (-2820.851) [-2816.470] (-2808.514) -- 0:00:12 977000 -- (-2813.257) [-2817.740] (-2812.168) (-2814.350) * (-2824.528) (-2816.974) [-2819.994] (-2822.002) -- 0:00:12 977500 -- [-2817.187] (-2822.356) (-2816.829) (-2810.422) * [-2810.752] (-2814.256) (-2821.390) (-2821.173) -- 0:00:11 978000 -- (-2815.538) (-2820.507) (-2821.036) [-2818.302] * (-2813.592) (-2816.866) (-2824.803) [-2813.240] -- 0:00:11 978500 -- (-2815.895) (-2815.145) (-2826.324) [-2814.085] * (-2820.676) [-2818.595] (-2828.986) (-2810.267) -- 0:00:11 979000 -- [-2811.384] (-2815.542) (-2809.661) (-2819.244) * (-2819.852) [-2819.632] (-2815.669) (-2818.250) -- 0:00:10 979500 -- (-2827.598) [-2809.607] (-2816.007) (-2817.517) * (-2814.738) (-2821.203) [-2813.005] (-2823.917) -- 0:00:10 980000 -- [-2819.487] (-2811.945) (-2827.613) (-2812.220) * (-2812.935) (-2818.282) [-2816.330] (-2815.550) -- 0:00:10 Average standard deviation of split frequencies: 0.002297 980500 -- (-2819.919) (-2816.756) [-2820.353] (-2809.713) * (-2822.521) (-2816.906) (-2821.264) [-2819.042] -- 0:00:10 981000 -- [-2820.164] (-2820.597) (-2825.848) (-2818.157) * [-2812.069] (-2816.577) (-2824.918) (-2828.058) -- 0:00:09 981500 -- (-2810.122) (-2821.423) (-2818.906) [-2814.078] * [-2809.677] (-2808.234) (-2831.658) (-2821.872) -- 0:00:09 982000 -- (-2826.194) [-2814.943] (-2824.443) (-2811.972) * (-2814.253) [-2817.327] (-2827.848) (-2823.168) -- 0:00:09 982500 -- [-2815.611] (-2818.777) (-2834.599) (-2813.186) * (-2819.384) (-2815.820) [-2809.962] (-2827.197) -- 0:00:09 983000 -- (-2825.238) [-2811.756] (-2821.346) (-2818.113) * (-2815.168) [-2807.204] (-2814.682) (-2820.937) -- 0:00:08 983500 -- (-2818.312) (-2818.073) [-2829.505] (-2824.483) * [-2823.337] (-2825.562) (-2813.829) (-2817.416) -- 0:00:08 984000 -- (-2818.209) (-2818.634) (-2814.363) [-2810.796] * (-2820.608) [-2813.605] (-2822.210) (-2817.735) -- 0:00:08 984500 -- [-2826.987] (-2816.791) (-2825.230) (-2817.493) * [-2811.984] (-2816.857) (-2815.186) (-2817.125) -- 0:00:08 985000 -- (-2815.908) (-2812.364) (-2815.634) [-2828.804] * (-2822.773) (-2812.700) (-2819.654) [-2823.218] -- 0:00:07 Average standard deviation of split frequencies: 0.002656 985500 -- (-2824.648) (-2817.938) [-2813.095] (-2818.739) * (-2819.368) [-2814.524] (-2816.953) (-2810.593) -- 0:00:07 986000 -- (-2818.674) (-2819.876) (-2809.944) [-2811.910] * (-2818.608) [-2818.265] (-2818.747) (-2814.170) -- 0:00:07 986500 -- (-2821.389) [-2814.684] (-2816.343) (-2815.459) * (-2823.539) (-2813.252) [-2815.547] (-2824.037) -- 0:00:07 987000 -- (-2820.653) (-2828.252) (-2813.525) [-2815.884] * (-2816.032) (-2814.289) [-2817.012] (-2812.643) -- 0:00:06 987500 -- (-2826.783) (-2816.878) [-2812.039] (-2810.975) * (-2813.738) (-2808.508) (-2811.445) [-2813.910] -- 0:00:06 988000 -- [-2817.423] (-2812.923) (-2819.154) (-2816.265) * (-2812.444) [-2816.900] (-2818.965) (-2813.872) -- 0:00:06 988500 -- (-2817.946) [-2810.635] (-2817.385) (-2824.142) * (-2823.480) (-2814.653) [-2809.073] (-2820.085) -- 0:00:06 989000 -- [-2817.235] (-2811.163) (-2824.914) (-2825.353) * (-2816.530) (-2811.617) [-2813.153] (-2822.207) -- 0:00:05 989500 -- (-2818.367) (-2812.003) (-2821.265) [-2816.169] * (-2817.000) (-2816.306) (-2820.552) [-2820.681] -- 0:00:05 990000 -- [-2818.375] (-2811.139) (-2810.605) (-2814.920) * (-2822.446) (-2818.882) [-2812.143] (-2819.030) -- 0:00:05 Average standard deviation of split frequencies: 0.002326 990500 -- (-2827.643) (-2809.746) (-2813.687) [-2816.759] * [-2813.277] (-2817.554) (-2813.375) (-2822.237) -- 0:00:04 991000 -- (-2821.027) [-2816.218] (-2816.901) (-2818.271) * (-2812.476) (-2813.027) [-2813.813] (-2815.996) -- 0:00:04 991500 -- (-2819.334) [-2828.814] (-2819.073) (-2817.893) * [-2816.949] (-2821.834) (-2821.261) (-2814.295) -- 0:00:04 992000 -- (-2811.703) [-2822.932] (-2813.304) (-2808.943) * (-2817.136) [-2810.484] (-2818.846) (-2822.870) -- 0:00:04 992500 -- (-2818.647) (-2822.261) (-2813.810) [-2812.829] * (-2814.413) (-2819.871) (-2815.543) [-2818.334] -- 0:00:03 993000 -- (-2814.691) [-2818.389] (-2825.108) (-2812.955) * (-2825.222) (-2823.648) [-2815.622] (-2823.497) -- 0:00:03 993500 -- (-2819.178) [-2818.731] (-2813.235) (-2822.361) * [-2815.349] (-2823.154) (-2822.000) (-2812.758) -- 0:00:03 994000 -- (-2817.137) [-2814.068] (-2817.073) (-2818.730) * (-2812.517) (-2818.473) (-2825.330) [-2811.317] -- 0:00:03 994500 -- (-2821.411) (-2823.550) [-2812.157] (-2820.693) * [-2812.868] (-2830.550) (-2810.908) (-2824.920) -- 0:00:02 995000 -- [-2815.502] (-2818.560) (-2822.532) (-2814.436) * [-2812.999] (-2813.955) (-2819.112) (-2808.258) -- 0:00:02 Average standard deviation of split frequencies: 0.002261 995500 -- (-2828.233) [-2812.512] (-2822.968) (-2818.676) * (-2818.441) (-2818.869) [-2814.546] (-2813.829) -- 0:00:02 996000 -- [-2814.501] (-2831.000) (-2812.474) (-2819.112) * (-2817.266) (-2824.170) (-2816.239) [-2814.296] -- 0:00:02 996500 -- (-2828.145) (-2820.150) [-2814.368] (-2808.293) * [-2814.744] (-2818.671) (-2808.499) (-2820.268) -- 0:00:01 997000 -- (-2818.902) (-2815.632) [-2816.608] (-2823.540) * (-2819.575) [-2813.515] (-2812.218) (-2823.998) -- 0:00:01 997500 -- (-2820.770) (-2821.559) (-2815.769) [-2810.951] * (-2817.589) [-2814.160] (-2818.670) (-2815.150) -- 0:00:01 998000 -- (-2819.482) (-2814.571) (-2814.242) [-2821.524] * (-2819.685) [-2814.478] (-2815.062) (-2831.903) -- 0:00:01 998500 -- [-2813.278] (-2819.319) (-2815.079) (-2820.490) * (-2814.279) [-2814.920] (-2812.026) (-2818.900) -- 0:00:00 999000 -- [-2809.653] (-2814.608) (-2818.729) (-2823.627) * (-2818.454) (-2816.962) (-2819.732) [-2820.462] -- 0:00:00 999500 -- (-2820.815) (-2815.359) [-2813.156] (-2821.861) * (-2818.962) (-2816.402) [-2812.816] (-2811.009) -- 0:00:00 1000000 -- [-2813.480] (-2822.421) (-2825.419) (-2814.494) * (-2812.436) [-2808.419] (-2826.763) (-2835.287) -- 0:00:00 Average standard deviation of split frequencies: 0.002408 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -2813.480327 -- 12.466450 Chain 1 -- -2813.480354 -- 12.466450 Chain 2 -- -2822.421464 -- 9.410962 Chain 2 -- -2822.421464 -- 9.410962 Chain 3 -- -2825.419401 -- 10.747314 Chain 3 -- -2825.419410 -- 10.747314 Chain 4 -- -2814.493611 -- 12.099350 Chain 4 -- -2814.493640 -- 12.099350 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -2812.436196 -- 12.950877 Chain 1 -- -2812.436183 -- 12.950877 Chain 2 -- -2808.419393 -- 14.906724 Chain 2 -- -2808.419391 -- 14.906724 Chain 3 -- -2826.762862 -- 14.290135 Chain 3 -- -2826.762872 -- 14.290135 Chain 4 -- -2835.286919 -- 16.089935 Chain 4 -- -2835.286903 -- 16.089935 Analysis completed in 8 mins 43 seconds Analysis used 522.41 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -2802.28 Likelihood of best state for "cold" chain of run 2 was -2802.79 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 38.8 % ( 27 %) Dirichlet(Revmat{all}) 54.5 % ( 37 %) Slider(Revmat{all}) 25.6 % ( 24 %) Dirichlet(Pi{all}) 28.1 % ( 20 %) Slider(Pi{all}) 27.8 % ( 29 %) Multiplier(Alpha{1,2}) 40.0 % ( 28 %) Multiplier(Alpha{3}) 48.3 % ( 29 %) Slider(Pinvar{all}) 5.9 % ( 2 %) ExtSPR(Tau{all},V{all}) 0.7 % ( 0 %) ExtTBR(Tau{all},V{all}) 7.2 % ( 10 %) NNI(Tau{all},V{all}) 11.6 % ( 10 %) ParsSPR(Tau{all},V{all}) 26.1 % ( 26 %) Multiplier(V{all}) 31.9 % ( 35 %) Nodeslider(V{all}) 24.9 % ( 26 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 37.3 % ( 33 %) Dirichlet(Revmat{all}) 54.3 % ( 38 %) Slider(Revmat{all}) 24.9 % ( 21 %) Dirichlet(Pi{all}) 27.7 % ( 23 %) Slider(Pi{all}) 27.6 % ( 23 %) Multiplier(Alpha{1,2}) 39.9 % ( 23 %) Multiplier(Alpha{3}) 47.9 % ( 12 %) Slider(Pinvar{all}) 6.0 % ( 7 %) ExtSPR(Tau{all},V{all}) 0.7 % ( 0 %) ExtTBR(Tau{all},V{all}) 7.1 % ( 8 %) NNI(Tau{all},V{all}) 11.5 % ( 11 %) ParsSPR(Tau{all},V{all}) 26.0 % ( 31 %) Multiplier(V{all}) 31.8 % ( 31 %) Nodeslider(V{all}) 25.0 % ( 30 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.77 0.58 0.43 2 | 166801 0.79 0.61 3 | 166348 166227 0.81 4 | 167016 166592 167016 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.78 0.59 0.43 2 | 166671 0.79 0.62 3 | 166438 166650 0.81 4 | 166716 166790 166735 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -2812.15 | 1 | | 2 | | | | | | 2 1 2 1 1 2 | | 1 1 2 1 1 2 1 | | 2 2 1 2 2 2 2 2 2| |2 1 * 1 1 2 2 1 1 *2 1 *1 | | 222 1 1 2 1 11 21 1 2 2 *2 2 1 | | * 1 *12 1 *1 1 2 *21 1 1 1 2 | | 22 *212 2 2 12 2 2 1 1 1| | 1 1 22 1 1 2 2 | |1 2 1 11 1 2 | | 2 1 | | 2 2 21 2 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2817.05 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2809.67 -2824.58 2 -2809.37 -2826.18 -------------------------------------- TOTAL -2809.51 -2825.67 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 1.210242 0.010869 1.009106 1.407339 1.205791 1311.16 1406.08 1.000 r(A<->C){all} 0.110616 0.000405 0.070400 0.149331 0.109666 991.31 1028.22 1.000 r(A<->G){all} 0.327096 0.001514 0.254182 0.403331 0.325862 864.55 868.59 1.000 r(A<->T){all} 0.072923 0.000443 0.033245 0.113853 0.071470 1033.54 1061.45 1.000 r(C<->G){all} 0.078483 0.000240 0.050163 0.109557 0.077471 935.11 1110.24 1.004 r(C<->T){all} 0.343127 0.001369 0.267265 0.412214 0.342439 757.30 770.42 1.000 r(G<->T){all} 0.067755 0.000287 0.033964 0.099328 0.066327 1135.62 1171.84 1.000 pi(A){all} 0.234227 0.000219 0.206214 0.262763 0.233738 875.66 915.42 1.000 pi(C){all} 0.270287 0.000213 0.242988 0.300271 0.270243 1053.18 1145.74 1.000 pi(G){all} 0.281226 0.000236 0.251852 0.311382 0.281145 991.39 1054.90 1.000 pi(T){all} 0.214259 0.000185 0.189702 0.242241 0.214067 1018.40 1198.50 1.000 alpha{1,2} 0.129480 0.000229 0.101149 0.159989 0.128659 1501.00 1501.00 1.000 alpha{3} 3.483294 0.922106 1.806939 5.396241 3.358208 1352.04 1426.52 1.000 pinvar{all} 0.247805 0.002633 0.148348 0.347340 0.250910 1289.18 1370.63 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 7 -- C7 8 -- C8 9 -- C9 10 -- C10 11 -- C11 Key to taxon bipartitions (saved to file "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ----------------- 1 -- .********** 2 -- .*......... 3 -- ..*........ 4 -- ...*....... 5 -- ....*...... 6 -- .....*..... 7 -- ......*.... 8 -- .......*... 9 -- ........*.. 10 -- .........*. 11 -- ..........* 12 -- .**........ 13 -- ........**. 14 -- .....****** 15 -- .....**...* 16 -- .....**.... 17 -- ...******** 18 -- ...**...... 19 -- .......***. 20 -- .....**.*** ----------------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 12 3002 1.000000 0.000000 1.000000 1.000000 2 13 3002 1.000000 0.000000 1.000000 1.000000 2 14 3002 1.000000 0.000000 1.000000 1.000000 2 15 2989 0.995670 0.000471 0.995336 0.996003 2 16 2961 0.986342 0.000471 0.986009 0.986676 2 17 2851 0.949700 0.002355 0.948035 0.951366 2 18 2801 0.933045 0.004240 0.930047 0.936043 2 19 1789 0.595936 0.010835 0.588274 0.603598 2 20 1085 0.361426 0.003298 0.359094 0.363757 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.018998 0.000058 0.005381 0.033568 0.017836 1.001 2 length{all}[2] 0.004914 0.000013 0.000018 0.011962 0.004030 1.000 2 length{all}[3] 0.019565 0.000052 0.006491 0.033448 0.018770 1.000 2 length{all}[4] 0.094581 0.000386 0.058846 0.133985 0.093214 1.000 2 length{all}[5] 0.053656 0.000203 0.028937 0.082460 0.052271 1.001 2 length{all}[6] 0.084795 0.000379 0.049609 0.123268 0.083240 1.000 2 length{all}[7] 0.084806 0.000392 0.048453 0.124612 0.082638 1.000 2 length{all}[8] 0.192422 0.001159 0.127743 0.256334 0.189838 1.000 2 length{all}[9] 0.078454 0.000383 0.041895 0.115864 0.077111 1.000 2 length{all}[10] 0.074908 0.000363 0.039648 0.113374 0.073240 1.000 2 length{all}[11] 0.098758 0.000520 0.055873 0.143110 0.097183 1.000 2 length{all}[12] 0.025786 0.000080 0.010711 0.043905 0.024586 1.000 2 length{all}[13] 0.109602 0.000695 0.058404 0.159213 0.107451 1.000 2 length{all}[14] 0.132063 0.000775 0.080320 0.187938 0.130134 1.000 2 length{all}[15] 0.040154 0.000252 0.011055 0.071687 0.038399 1.000 2 length{all}[16] 0.035373 0.000240 0.008813 0.067607 0.033902 1.000 2 length{all}[17] 0.019848 0.000097 0.003332 0.039134 0.018480 1.000 2 length{all}[18] 0.021093 0.000138 0.000772 0.042671 0.019407 1.000 2 length{all}[19] 0.024434 0.000233 0.000076 0.052088 0.022170 1.002 2 length{all}[20] 0.020735 0.000190 0.000005 0.045330 0.018411 0.999 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.002408 Maximum standard deviation of split frequencies = 0.010835 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.002 Clade credibility values: /---------------------------------------------------------------------- C1 (1) | | /-------------- C2 (2) |--------------------------100--------------------------+ | \-------------- C3 (3) | + /-------------- C4 (4) | /--------------------93-------------------+ | | \-------------- C5 (5) | | | | /-------------- C6 (6) | | /------99-----+ \------95-----+ | \-------------- C7 (7) | /-----100-----+ | | \---------------------------- C11 (11) | | \-----100-----+ /---------------------------- C8 (8) | | \------60-----+ /-------------- C9 (9) \-----100-----+ \-------------- C10 (10) Phylogram (based on average branch lengths): /---- C1 (1) | | /- C2 (2) |----+ | \---- C3 (3) | + /------------------ C4 (4) | /---+ | | \---------- C5 (5) | | | | /----------------- C6 (6) | | /------+ \---+ | \---------------- C7 (7) | /------+ | | \-------------------- C11 (11) | | \-------------------------+ /-------------------------------------- C8 (8) | | \---+ /---------------- C9 (9) \--------------------+ \--------------- C10 (10) |--------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (30 trees sampled): 90 % credible set contains 5 trees 95 % credible set contains 7 trees 99 % credible set contains 14 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 11 ls = 744 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Reading seq # 7: C7 Reading seq # 8: C8 Reading seq # 9: C9 Reading seq #10: C10 Reading seq #11: C11 Sites with gaps or missing data are removed. 6 ambiguity characters in seq. 1 6 ambiguity characters in seq. 2 6 ambiguity characters in seq. 3 12 ambiguity characters in seq. 4 6 ambiguity characters in seq. 5 12 ambiguity characters in seq. 6 12 ambiguity characters in seq. 7 12 ambiguity characters in seq. 8 12 ambiguity characters in seq. 9 12 ambiguity characters in seq. 10 12 ambiguity characters in seq. 11 4 sites are removed. 157 158 247 248 Sequences read.. Counting site patterns.. 0:00 201 patterns at 244 / 244 sites (100.0%), 0:00 Counting codons.. NG distances for seqs.: 1 2 3 4 5 6 7 8 9 10 11 440 bytes for distance 196176 bytes for conP 27336 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356 882792 bytes for conP, adjusted 0.031746 0.039010 0.001442 0.032148 0.022539 0.036423 0.149935 0.067160 0.191709 0.019841 0.060733 0.116928 0.146551 0.134998 0.039617 0.308786 0.151006 0.123587 0.109494 0.300000 1.300000 ntime & nrate & np: 19 2 21 Bounds (np=21): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 21 lnL0 = -3252.099866 Iterating by ming2 Initial: fx= 3252.099866 x= 0.03175 0.03901 0.00144 0.03215 0.02254 0.03642 0.14993 0.06716 0.19171 0.01984 0.06073 0.11693 0.14655 0.13500 0.03962 0.30879 0.15101 0.12359 0.10949 0.30000 1.30000 1 h-m-p 0.0000 0.0008 697.3806 +++YYCYCCC 3179.924978 6 0.0007 38 | 0/21 2 h-m-p 0.0003 0.0013 1454.7734 CYCCC 3158.516410 4 0.0002 69 | 0/21 3 h-m-p 0.0002 0.0009 551.0080 ++ 3018.079467 m 0.0009 93 | 0/21 4 h-m-p 0.0000 0.0000 39279.1873 +CCYC 3005.210187 3 0.0000 123 | 0/21 5 h-m-p 0.0000 0.0000 48463.1125 ++ 2962.495608 m 0.0000 147 | 0/21 6 h-m-p 0.0000 0.0000 21968.8801 +YCYCCC 2938.165532 5 0.0000 180 | 0/21 7 h-m-p 0.0000 0.0000 9678.0960 ++ 2844.632524 m 0.0000 204 | 0/21 8 h-m-p 0.0000 0.0000 693.6828 h-m-p: 6.24041792e-18 3.12020896e-17 6.93682768e+02 2844.632524 .. | 0/21 9 h-m-p 0.0000 0.0004 123448.4044 --YCYYCYC 2838.826687 6 0.0000 259 | 0/21 10 h-m-p 0.0000 0.0007 3188.1993 +YYYYCCC 2791.648706 6 0.0000 292 | 0/21 11 h-m-p 0.0001 0.0007 560.5621 +YCYCYCCC 2652.793423 7 0.0006 328 | 0/21 12 h-m-p 0.0000 0.0002 329.1770 YCCCCC 2650.677014 5 0.0000 361 | 0/21 13 h-m-p 0.0001 0.0007 117.7288 YCCCC 2648.815756 4 0.0003 392 | 0/21 14 h-m-p 0.0001 0.0005 197.8216 CCCC 2647.785573 3 0.0001 422 | 0/21 15 h-m-p 0.0004 0.0067 70.6452 CCC 2647.220770 2 0.0004 450 | 0/21 16 h-m-p 0.0004 0.0023 66.4788 CCCC 2646.731831 3 0.0004 480 | 0/21 17 h-m-p 0.0009 0.0045 26.6457 YC 2646.615574 1 0.0005 505 | 0/21 18 h-m-p 0.0003 0.0046 36.9291 +YCC 2646.377114 2 0.0009 533 | 0/21 19 h-m-p 0.0008 0.0040 35.8567 CCC 2646.184618 2 0.0009 561 | 0/21 20 h-m-p 0.0004 0.0137 82.0212 +CYC 2645.419145 2 0.0016 589 | 0/21 21 h-m-p 0.0015 0.0123 86.9080 CCC 2644.533945 2 0.0018 617 | 0/21 22 h-m-p 0.0015 0.0074 48.6907 CYC 2644.212543 2 0.0013 644 | 0/21 23 h-m-p 0.0057 0.0589 11.0818 CC 2644.164572 1 0.0012 670 | 0/21 24 h-m-p 0.0048 0.0866 2.8572 CC 2644.154709 1 0.0016 696 | 0/21 25 h-m-p 0.0038 0.1616 1.1666 YC 2644.115159 1 0.0079 721 | 0/21 26 h-m-p 0.0026 0.0642 3.5099 +CCCC 2643.510212 3 0.0160 752 | 0/21 27 h-m-p 0.0014 0.0068 37.0693 CCCC 2642.869925 3 0.0016 782 | 0/21 28 h-m-p 0.0044 0.0219 6.3367 CC 2642.850790 1 0.0010 808 | 0/21 29 h-m-p 0.0043 0.1617 1.4639 C 2642.849355 0 0.0011 832 | 0/21 30 h-m-p 0.0190 3.0315 0.0821 ++YCC 2642.745499 2 0.2315 861 | 0/21 31 h-m-p 0.0015 0.0458 12.4521 +YC 2642.392319 1 0.0042 908 | 0/21 32 h-m-p 1.6000 8.0000 0.0094 YCCC 2641.649040 3 3.7914 937 | 0/21 33 h-m-p 1.5700 7.9334 0.0226 CCCCC 2640.884678 4 2.0898 990 | 0/21 34 h-m-p 1.5911 7.9556 0.0264 YYC 2640.676147 2 1.2176 1037 | 0/21 35 h-m-p 1.6000 8.0000 0.0154 CYC 2640.596614 2 1.5097 1085 | 0/21 36 h-m-p 1.6000 8.0000 0.0127 YC 2640.582823 1 1.2583 1131 | 0/21 37 h-m-p 1.6000 8.0000 0.0013 YC 2640.581814 1 0.8872 1177 | 0/21 38 h-m-p 1.6000 8.0000 0.0007 YC 2640.580500 1 3.9744 1223 | 0/21 39 h-m-p 1.6000 8.0000 0.0003 ++ 2640.567100 m 8.0000 1268 | 0/21 40 h-m-p 0.8750 8.0000 0.0032 YC 2640.515464 1 2.0473 1314 | 0/21 41 h-m-p 1.6000 8.0000 0.0035 CCC 2640.465925 2 2.1535 1363 | 0/21 42 h-m-p 1.6000 8.0000 0.0037 YC 2640.459202 1 0.8393 1409 | 0/21 43 h-m-p 1.6000 8.0000 0.0002 YC 2640.459094 1 1.0446 1455 | 0/21 44 h-m-p 1.6000 8.0000 0.0001 Y 2640.459092 0 0.9669 1500 | 0/21 45 h-m-p 1.6000 8.0000 0.0000 Y 2640.459092 0 0.8497 1545 | 0/21 46 h-m-p 1.6000 8.0000 0.0000 ---Y 2640.459092 0 0.0120 1593 Out.. lnL = -2640.459092 1594 lfun, 1594 eigenQcodon, 30286 P(t) Time used: 0:13 Model 1: NearlyNeutral TREE # 1 (1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356 0.031746 0.039010 0.001442 0.032148 0.022539 0.036423 0.149935 0.067160 0.191709 0.019841 0.060733 0.116928 0.146551 0.134998 0.039617 0.308786 0.151006 0.123587 0.109494 1.902702 0.822315 0.590611 ntime & nrate & np: 19 2 22 Bounds (np=22): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 6.097438 np = 22 lnL0 = -2887.874481 Iterating by ming2 Initial: fx= 2887.874481 x= 0.03175 0.03901 0.00144 0.03215 0.02254 0.03642 0.14993 0.06716 0.19171 0.01984 0.06073 0.11693 0.14655 0.13500 0.03962 0.30879 0.15101 0.12359 0.10949 1.90270 0.82232 0.59061 1 h-m-p 0.0000 0.0011 556.5500 ++++ 2864.433154 m 0.0011 29 | 0/22 2 h-m-p 0.0000 0.0000 54217.9490 ++ 2804.576416 m 0.0000 54 | 0/22 3 h-m-p 0.0000 0.0001 1447.5864 YCYCCC 2795.028277 5 0.0000 87 | 0/22 4 h-m-p 0.0001 0.0008 249.1477 YCCCC 2789.986506 4 0.0003 119 | 0/22 5 h-m-p 0.0005 0.0052 145.1931 CCCC 2786.744140 3 0.0005 150 | 0/22 6 h-m-p 0.0000 0.0002 145.2913 +YCCC 2786.053268 3 0.0001 181 | 0/22 7 h-m-p 0.0001 0.0003 95.1954 ++ 2785.170820 m 0.0003 206 | 0/22 8 h-m-p 0.0002 0.0032 120.9403 +CCCCC 2782.595475 4 0.0010 240 | 0/22 9 h-m-p 0.0003 0.0016 93.5541 +YCCC 2780.715041 3 0.0011 271 | 0/22 10 h-m-p 0.0004 0.0020 56.4653 CCC 2780.358600 2 0.0005 300 | 0/22 11 h-m-p 0.0016 0.0096 17.7299 YCC 2780.234986 2 0.0009 328 | 0/22 12 h-m-p 0.0023 0.0167 7.0930 CCC 2780.133360 2 0.0025 357 | 0/22 13 h-m-p 0.0009 0.0698 19.6989 ++YCC 2778.924400 2 0.0103 387 | 0/22 14 h-m-p 0.0017 0.0200 116.3924 +YCC 2775.448723 2 0.0050 416 | 0/22 15 h-m-p 0.0008 0.0038 239.9142 YCCC 2773.015570 3 0.0016 446 | 0/22 16 h-m-p 0.0022 0.0109 40.9618 YCC 2772.687253 2 0.0012 474 | 0/22 17 h-m-p 0.0026 0.0131 11.5145 CCC 2772.365807 2 0.0027 503 | 0/22 18 h-m-p 0.0032 0.0492 9.8499 +YYCC 2769.476222 3 0.0117 533 | 0/22 19 h-m-p 0.0020 0.0108 57.6641 YCCCC 2759.071838 4 0.0047 565 | 0/22 20 h-m-p 0.0007 0.0034 193.9067 ++ 2705.316410 m 0.0034 590 | 0/22 21 h-m-p 0.0010 0.0052 7.5702 YYYYC 2702.185490 4 0.0011 619 | 0/22 22 h-m-p 0.0000 0.0005 194.4260 +YYYYC 2699.375516 4 0.0002 649 | 0/22 23 h-m-p 0.0003 0.0025 105.4380 YCCC 2696.230760 3 0.0007 679 | 0/22 24 h-m-p 0.0041 0.0207 8.5508 YCCC 2695.897207 3 0.0028 709 | 0/22 25 h-m-p 0.0057 0.2077 4.2237 +++ 2665.063621 m 0.2077 735 | 0/22 26 h-m-p 0.4057 2.0286 1.4092 CYCCCC 2642.608230 5 0.8014 769 | 0/22 27 h-m-p 0.1798 0.8990 0.4142 +YYCCC 2635.459816 4 0.6265 801 | 0/22 28 h-m-p 0.5747 2.8734 0.0943 YCCC 2631.267689 3 1.2060 853 | 0/22 29 h-m-p 0.4388 2.4153 0.2593 CCCC 2629.900299 3 0.7129 906 | 0/22 30 h-m-p 0.5313 2.6566 0.0820 CCC 2628.839604 2 0.7408 957 | 0/22 31 h-m-p 1.6000 8.0000 0.0270 CYC 2627.828061 2 1.6719 1007 | 0/22 32 h-m-p 1.3604 8.0000 0.0332 CCC 2627.366872 2 1.2073 1058 | 0/22 33 h-m-p 1.6000 8.0000 0.0182 CCC 2627.021215 2 1.3659 1109 | 0/22 34 h-m-p 0.7054 8.0000 0.0352 YCC 2626.845287 2 1.3076 1159 | 0/22 35 h-m-p 1.6000 8.0000 0.0242 YC 2626.609015 1 2.9230 1207 | 0/22 36 h-m-p 1.6000 8.0000 0.0164 CYC 2626.324533 2 1.3799 1257 | 0/22 37 h-m-p 0.6688 8.0000 0.0339 YCC 2626.060804 2 1.2090 1307 | 0/22 38 h-m-p 1.6000 8.0000 0.0066 CC 2625.996498 1 1.5131 1356 | 0/22 39 h-m-p 1.6000 8.0000 0.0031 CC 2625.971359 1 2.3848 1405 | 0/22 40 h-m-p 1.6000 8.0000 0.0039 C 2625.959688 0 1.6000 1452 | 0/22 41 h-m-p 1.6000 8.0000 0.0021 YC 2625.942169 1 3.3691 1500 | 0/22 42 h-m-p 1.4440 8.0000 0.0048 +CC 2625.892085 1 6.0637 1550 | 0/22 43 h-m-p 1.6000 8.0000 0.0106 +YC 2625.728815 1 4.8451 1599 | 0/22 44 h-m-p 1.6000 8.0000 0.0138 CCC 2625.552439 2 2.3667 1650 | 0/22 45 h-m-p 1.6000 8.0000 0.0072 CCC 2625.457628 2 1.8602 1701 | 0/22 46 h-m-p 1.6000 8.0000 0.0050 CC 2625.439538 1 1.3575 1750 | 0/22 47 h-m-p 1.6000 8.0000 0.0012 C 2625.436010 0 1.6000 1797 | 0/22 48 h-m-p 1.6000 8.0000 0.0006 YC 2625.435724 1 1.0996 1845 | 0/22 49 h-m-p 1.6000 8.0000 0.0002 Y 2625.435697 0 1.0893 1892 | 0/22 50 h-m-p 1.6000 8.0000 0.0001 Y 2625.435695 0 1.2661 1939 | 0/22 51 h-m-p 1.6000 8.0000 0.0000 C 2625.435695 0 1.3616 1986 | 0/22 52 h-m-p 1.6000 8.0000 0.0000 Y 2625.435695 0 0.8762 2033 | 0/22 53 h-m-p 1.6000 8.0000 0.0000 C 2625.435695 0 0.4000 2080 | 0/22 54 h-m-p 0.5975 8.0000 0.0000 Y 2625.435695 0 0.5975 2127 | 0/22 55 h-m-p 1.1768 8.0000 0.0000 Y 2625.435695 0 0.2942 2174 | 0/22 56 h-m-p 0.1359 8.0000 0.0000 ---------------.. | 0/22 57 h-m-p 0.0160 8.0000 0.0006 ------------- | 0/22 58 h-m-p 0.0160 8.0000 0.0006 ------------- Out.. lnL = -2625.435695 2351 lfun, 7053 eigenQcodon, 89338 P(t) Time used: 0:54 Model 2: PositiveSelection TREE # 1 (1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356 initial w for M2:NSpselection reset. 0.031746 0.039010 0.001442 0.032148 0.022539 0.036423 0.149935 0.067160 0.191709 0.019841 0.060733 0.116928 0.146551 0.134998 0.039617 0.308786 0.151006 0.123587 0.109494 1.970157 0.862503 0.107410 0.336572 2.818396 ntime & nrate & np: 19 3 24 Bounds (np=24): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 4.264708 np = 24 lnL0 = -2902.012301 Iterating by ming2 Initial: fx= 2902.012301 x= 0.03175 0.03901 0.00144 0.03215 0.02254 0.03642 0.14993 0.06716 0.19171 0.01984 0.06073 0.11693 0.14655 0.13500 0.03962 0.30879 0.15101 0.12359 0.10949 1.97016 0.86250 0.10741 0.33657 2.81840 1 h-m-p 0.0000 0.0015 677.8268 ++++ 2813.897363 m 0.0015 55 | 0/24 2 h-m-p 0.0006 0.0029 666.1148 -YYYYC 2805.758069 4 0.0000 111 | 0/24 3 h-m-p 0.0001 0.0046 191.3570 ++YCCCC 2764.856740 4 0.0028 171 | 0/24 4 h-m-p 0.0020 0.0102 66.3848 CCCC 2761.630936 3 0.0020 228 | 0/24 5 h-m-p 0.0022 0.0124 60.1812 +YCCCC 2753.803844 4 0.0065 287 | 0/24 6 h-m-p 0.0015 0.0073 42.1649 YCCC 2751.790406 3 0.0036 343 | 0/24 7 h-m-p 0.0016 0.0080 73.4323 YCCCC 2749.179092 4 0.0033 401 | 0/24 8 h-m-p 0.0027 0.0288 88.7507 CCCC 2747.251672 3 0.0026 458 | 0/24 9 h-m-p 0.0014 0.0070 73.3102 +YYCCC 2744.031079 4 0.0046 516 | 0/24 10 h-m-p 0.0027 0.0138 125.5571 CYCC 2740.658470 3 0.0037 572 | 0/24 11 h-m-p 0.0052 0.0659 90.1975 +CYCC 2725.691903 3 0.0246 629 | 0/24 12 h-m-p 0.0121 0.0603 130.1794 CYCCC 2713.210190 4 0.0162 687 | 0/24 13 h-m-p 0.0122 0.0610 54.1429 +YYCCCC 2699.319497 5 0.0386 747 | 0/24 14 h-m-p 0.0139 0.0693 65.0761 YCC 2689.834161 2 0.0249 801 | 0/24 15 h-m-p 0.0140 0.0699 25.8545 CCCC 2687.648378 3 0.0177 858 | 0/24 16 h-m-p 0.0321 0.1606 8.3094 CC 2686.719339 1 0.0321 911 | 0/24 17 h-m-p 0.0439 0.5851 6.0646 +YCC 2683.804680 2 0.1325 966 | 0/24 18 h-m-p 0.0538 0.3352 14.9400 +YCCC 2675.135553 3 0.1418 1023 | 0/24 19 h-m-p 0.0138 0.0691 29.0974 +YYCYYCCC 2666.691198 7 0.0599 1085 | 0/24 20 h-m-p 0.0181 0.0906 10.0898 YCCC 2665.424867 3 0.0384 1141 | 0/24 21 h-m-p 0.2155 1.0777 1.7573 CYC 2664.451659 2 0.1897 1195 | 0/24 22 h-m-p 0.1067 0.7568 3.1229 CCC 2662.431134 2 0.1651 1250 | 0/24 23 h-m-p 0.1170 0.6405 4.4061 YCC 2661.653136 2 0.0741 1304 | 0/24 24 h-m-p 0.1028 0.5948 3.1762 CCC 2660.980093 2 0.1266 1359 | 0/24 25 h-m-p 0.0635 0.3173 4.3241 +YYCCC 2659.286046 4 0.2103 1417 | 0/24 26 h-m-p 0.0233 0.1165 11.0775 YCCC 2658.211567 3 0.0604 1473 | 0/24 27 h-m-p 0.1046 0.5231 2.6997 YC 2658.013132 1 0.0535 1525 | 0/24 28 h-m-p 0.1214 1.6407 1.1905 YCCC 2657.277451 3 0.2923 1581 | 0/24 29 h-m-p 1.0302 6.1926 0.3378 CCCC 2655.421568 3 1.4146 1638 | 0/24 30 h-m-p 0.9316 4.6578 0.4146 CYCCC 2653.358995 4 1.8098 1696 | 0/24 31 h-m-p 1.3250 6.7166 0.5662 CCCCC 2651.516507 4 1.9401 1755 | 0/24 32 h-m-p 0.9391 4.6955 0.3568 YCYCCC 2649.066824 5 2.2051 1814 | 0/24 33 h-m-p 0.4756 2.3782 0.4233 YCCCC 2646.470371 4 1.2325 1872 | 0/24 34 h-m-p 0.2857 1.4284 0.8053 YCCCCC 2644.373332 5 0.5990 1932 | 0/24 35 h-m-p 0.2175 1.0877 0.9579 +YCYCCC 2640.755978 5 0.6024 1992 | 0/24 36 h-m-p 0.1979 0.9897 1.9947 YCCCCC 2638.798810 5 0.2233 2052 | 0/24 37 h-m-p 0.2141 1.3051 2.0808 CCC 2636.331622 2 0.3304 2107 | 0/24 38 h-m-p 0.2000 1.0002 1.0670 CCCCC 2635.264629 4 0.2580 2166 | 0/24 39 h-m-p 0.1479 1.6004 1.8615 +YCC 2633.881716 2 0.4108 2221 | 0/24 40 h-m-p 0.2519 1.2595 2.3513 CCCCC 2632.713387 4 0.3374 2280 | 0/24 41 h-m-p 0.2632 1.3269 3.0142 CYCCCC 2631.159391 5 0.3867 2340 | 0/24 42 h-m-p 0.1902 0.9512 3.5527 CCCC 2630.361005 3 0.1956 2397 | 0/24 43 h-m-p 0.2585 1.7098 2.6872 CCYC 2629.673512 3 0.2555 2453 | 0/24 44 h-m-p 0.1863 1.4821 3.6860 CYC 2629.169670 2 0.1621 2507 | 0/24 45 h-m-p 0.2199 1.4802 2.7174 CCCC 2628.740754 3 0.2647 2564 | 0/24 46 h-m-p 0.1478 0.9021 4.8684 CCCC 2628.227251 3 0.2138 2621 | 0/24 47 h-m-p 0.2618 1.3458 3.9764 YYCC 2627.905857 3 0.1950 2676 | 0/24 48 h-m-p 0.1799 1.4345 4.3104 YYC 2627.661799 2 0.1512 2729 | 0/24 49 h-m-p 0.1296 1.7792 5.0278 CC 2627.333109 1 0.1855 2782 | 0/24 50 h-m-p 0.1911 1.4323 4.8793 YCCC 2627.064162 3 0.1934 2838 | 0/24 51 h-m-p 0.3064 2.4915 3.0808 CCC 2626.762799 2 0.3314 2893 | 0/24 52 h-m-p 0.1988 1.2943 5.1353 YCC 2626.617472 2 0.1085 2947 | 0/24 53 h-m-p 0.1509 2.3807 3.6918 CCC 2626.435924 2 0.2120 3002 | 0/24 54 h-m-p 0.3742 5.5029 2.0911 YCC 2626.322261 2 0.2555 3056 | 0/24 55 h-m-p 0.1231 0.9028 4.3394 CCC 2626.206692 2 0.1744 3111 | 0/24 56 h-m-p 0.2690 1.6667 2.8135 YYC 2626.129929 2 0.2251 3164 | 0/24 57 h-m-p 0.1857 1.2569 3.4103 CCC 2626.038665 2 0.2362 3219 | 0/24 58 h-m-p 0.3323 4.5716 2.4236 YCCC 2625.932653 3 0.5968 3275 | 0/24 59 h-m-p 0.5267 5.7861 2.7462 YCC 2625.852568 2 0.4321 3329 | 0/24 60 h-m-p 0.5254 8.0000 2.2588 CYC 2625.770448 2 0.6063 3383 | 0/24 61 h-m-p 0.3035 5.1749 4.5124 CCCC 2625.691379 3 0.4141 3440 | 0/24 62 h-m-p 0.8099 7.5848 2.3072 YC 2625.634825 1 0.4755 3492 | 0/24 63 h-m-p 0.2790 5.2377 3.9330 CCC 2625.600062 2 0.3316 3547 | 0/24 64 h-m-p 0.4844 8.0000 2.6925 CC 2625.574586 1 0.4183 3600 | 0/24 65 h-m-p 0.4647 8.0000 2.4234 CC 2625.547595 1 0.5784 3653 | 0/24 66 h-m-p 0.7386 8.0000 1.8977 CC 2625.524073 1 0.8184 3706 | 0/24 67 h-m-p 0.5284 8.0000 2.9393 CC 2625.503221 1 0.5888 3759 | 0/24 68 h-m-p 0.5175 8.0000 3.3443 CCC 2625.488231 2 0.5394 3814 | 0/24 69 h-m-p 0.4868 8.0000 3.7061 CC 2625.475000 1 0.4367 3867 | 0/24 70 h-m-p 0.6974 8.0000 2.3209 C 2625.464690 0 0.6974 3918 | 0/24 71 h-m-p 0.4591 8.0000 3.5251 CC 2625.456972 1 0.6665 3971 | 0/24 72 h-m-p 1.0272 8.0000 2.2871 C 2625.450213 0 1.0272 4022 | 0/24 73 h-m-p 0.5576 8.0000 4.2134 C 2625.446236 0 0.5576 4073 | 0/24 74 h-m-p 0.8503 8.0000 2.7631 CC 2625.443320 1 0.7130 4126 | 0/24 75 h-m-p 0.3968 8.0000 4.9658 CC 2625.440644 1 0.5503 4179 | 0/24 76 h-m-p 1.1721 8.0000 2.3315 CY 2625.438741 1 1.3570 4232 | 0/24 77 h-m-p 1.0746 8.0000 2.9442 C 2625.437680 0 0.9648 4283 | 0/24 78 h-m-p 1.0505 8.0000 2.7039 C 2625.436874 0 1.2508 4334 | 0/24 79 h-m-p 0.9317 8.0000 3.6301 YC 2625.436444 1 0.7346 4386 | 0/24 80 h-m-p 0.9972 8.0000 2.6740 C 2625.436106 0 1.4565 4437 | 0/24 81 h-m-p 1.3972 8.0000 2.7876 C 2625.435912 0 1.5288 4488 | 0/24 82 h-m-p 1.6000 8.0000 2.4392 C 2625.435808 0 1.6000 4539 | 0/24 83 h-m-p 1.3489 8.0000 2.8933 C 2625.435755 0 1.3489 4590 | 0/24 84 h-m-p 1.3953 8.0000 2.7972 C 2625.435724 0 1.8349 4641 | 0/24 85 h-m-p 1.6000 8.0000 2.5339 C 2625.435708 0 1.8580 4692 | 0/24 86 h-m-p 1.6000 8.0000 2.5063 C 2625.435701 0 2.0776 4743 | 0/24 87 h-m-p 1.6000 8.0000 2.2320 C 2625.435698 0 1.7825 4794 | 0/24 88 h-m-p 1.6000 8.0000 2.3841 C 2625.435696 0 2.0826 4845 | 0/24 89 h-m-p 1.6000 8.0000 2.5205 C 2625.435695 0 1.7970 4896 | 0/24 90 h-m-p 1.6000 8.0000 2.4436 C 2625.435695 0 1.9394 4947 | 0/24 91 h-m-p 0.7542 8.0000 6.2836 Y 2625.435695 0 1.6113 4998 | 0/24 92 h-m-p 1.6000 8.0000 1.1563 Y 2625.435695 0 1.2735 5049 | 0/24 93 h-m-p 0.9951 8.0000 1.4797 Y 2625.435695 0 1.7740 5100 | 0/24 94 h-m-p 1.6000 8.0000 0.0995 Y 2625.435695 0 1.1884 5151 | 0/24 95 h-m-p 1.6000 8.0000 0.0176 C 2625.435695 0 1.6000 5202 | 0/24 96 h-m-p 0.3523 8.0000 0.0797 --C 2625.435695 0 0.0055 5255 | 0/24 97 h-m-p 1.6000 8.0000 0.0002 ----------------.. | 0/24 98 h-m-p 0.0103 5.1647 0.0011 --Y 2625.435695 0 0.0002 5373 | 0/24 99 h-m-p 0.0160 8.0000 0.0009 ------------Y 2625.435695 0 0.0000 5436 | 0/24 100 h-m-p 0.0000 0.0000 1255.7341 -------.. | 0/24 101 h-m-p 0.0160 8.0000 0.0061 -----C 2625.435695 0 0.0000 5548 | 0/24 102 h-m-p 0.0160 8.0000 0.0002 ---------C 2625.435695 0 0.0000 5608 Out.. lnL = -2625.435695 5609 lfun, 22436 eigenQcodon, 319713 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2642.963476 S = -2561.867776 -72.148597 Calculating f(w|X), posterior probabilities of site classes. did 10 / 201 patterns 3:17 did 20 / 201 patterns 3:17 did 30 / 201 patterns 3:17 did 40 / 201 patterns 3:17 did 50 / 201 patterns 3:17 did 60 / 201 patterns 3:17 did 70 / 201 patterns 3:17 did 80 / 201 patterns 3:17 did 90 / 201 patterns 3:17 did 100 / 201 patterns 3:17 did 110 / 201 patterns 3:17 did 120 / 201 patterns 3:17 did 130 / 201 patterns 3:17 did 140 / 201 patterns 3:17 did 150 / 201 patterns 3:17 did 160 / 201 patterns 3:17 did 170 / 201 patterns 3:17 did 180 / 201 patterns 3:17 did 190 / 201 patterns 3:17 did 200 / 201 patterns 3:18 did 201 / 201 patterns 3:18 Time used: 3:18 Model 3: discrete TREE # 1 (1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356 0.031746 0.039010 0.001442 0.032148 0.022539 0.036423 0.149935 0.067160 0.191709 0.019841 0.060733 0.116928 0.146551 0.134998 0.039617 0.308786 0.151006 0.123587 0.109494 1.970157 0.335590 0.845675 0.023866 0.061129 0.086153 ntime & nrate & np: 19 4 25 Bounds (np=25): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 16.066008 np = 25 lnL0 = -2641.188783 Iterating by ming2 Initial: fx= 2641.188783 x= 0.03175 0.03901 0.00144 0.03215 0.02254 0.03642 0.14993 0.06716 0.19171 0.01984 0.06073 0.11693 0.14655 0.13500 0.03962 0.30879 0.15101 0.12359 0.10949 1.97016 0.33559 0.84567 0.02387 0.06113 0.08615 1 h-m-p 0.0000 0.0001 517.9526 YCYCC 2640.100538 4 0.0000 61 | 0/25 2 h-m-p 0.0000 0.0001 305.9409 ++ 2633.670805 m 0.0001 114 | 1/25 3 h-m-p 0.0000 0.0003 406.7371 ++ 2621.091854 m 0.0003 167 | 2/25 4 h-m-p 0.0008 0.0041 81.6679 CCC 2620.574921 2 0.0002 223 | 1/25 5 h-m-p 0.0000 0.0004 704.5305 YCC 2620.501888 2 0.0000 277 | 1/25 6 h-m-p 0.0001 0.0018 45.4317 +YCCC 2620.028573 3 0.0004 335 | 0/25 7 h-m-p 0.0003 0.0018 68.0523 YCCC 2619.674523 3 0.0002 392 | 0/25 8 h-m-p 0.0003 0.0013 36.0371 YC 2619.273142 1 0.0006 446 | 0/25 9 h-m-p 0.0005 0.0034 41.9467 CC 2618.828987 1 0.0006 501 | 0/25 10 h-m-p 0.0006 0.0033 39.5562 YCC 2618.523096 2 0.0005 557 | 0/25 11 h-m-p 0.0008 0.0039 23.2028 CCC 2618.465252 2 0.0002 614 | 0/25 12 h-m-p 0.0003 0.0109 17.0596 YC 2618.393292 1 0.0007 668 | 0/25 13 h-m-p 0.0005 0.0072 20.3297 CC 2618.342933 1 0.0005 723 | 0/25 14 h-m-p 0.0016 0.0254 6.5316 YC 2618.324401 1 0.0010 777 | 0/25 15 h-m-p 0.0017 0.0259 4.0804 CC 2618.305633 1 0.0024 832 | 0/25 16 h-m-p 0.0010 0.1043 9.3297 +CC 2618.225638 1 0.0048 888 | 0/25 17 h-m-p 0.0010 0.0220 42.8881 +YCC 2618.000436 2 0.0029 945 | 0/25 18 h-m-p 0.0018 0.0143 66.5735 CC 2617.776985 1 0.0019 1000 | 0/25 19 h-m-p 0.0077 0.0384 9.8898 YC 2617.759018 1 0.0011 1054 | 0/25 20 h-m-p 0.0040 0.1769 2.6094 CC 2617.735077 1 0.0054 1109 | 0/25 21 h-m-p 0.0009 0.0284 14.9248 +YCCC 2617.494888 3 0.0090 1168 | 0/25 22 h-m-p 0.0057 0.0286 10.5810 YC 2617.475676 1 0.0011 1222 | 0/25 23 h-m-p 0.0192 0.3146 0.6174 +YCC 2617.430270 2 0.0560 1279 | 0/25 24 h-m-p 0.0024 0.0122 13.7836 YCC 2617.403686 2 0.0016 1335 | 0/25 25 h-m-p 0.0115 0.1487 1.8684 YC 2617.401788 1 0.0015 1389 | 0/25 26 h-m-p 0.0198 2.2663 0.1405 CC 2617.399843 1 0.0258 1444 | 0/25 27 h-m-p 0.0010 0.1695 3.4981 ++YC 2617.340577 1 0.0283 1500 | 0/25 28 h-m-p 1.6000 8.0000 0.0571 CCC 2617.312026 2 2.1568 1557 | 0/25 29 h-m-p 1.6000 8.0000 0.0685 CC 2617.296938 1 1.7230 1612 | 0/25 30 h-m-p 1.5836 8.0000 0.0745 C 2617.293082 0 0.3622 1665 | 0/25 31 h-m-p 0.8003 8.0000 0.0337 YC 2617.289195 1 1.6382 1719 | 0/25 32 h-m-p 1.6000 8.0000 0.0133 YC 2617.286661 1 3.1908 1773 | 0/25 33 h-m-p 1.6000 8.0000 0.0223 +YCYC 2617.277100 3 4.7623 1831 | 0/25 34 h-m-p 0.1239 0.6195 0.0762 ++ 2617.266505 m 0.6195 1884 | 1/25 35 h-m-p 0.0291 5.1690 1.6210 +YCCC 2617.251375 3 0.0826 1943 | 0/25 36 h-m-p 0.0000 0.0002 33248.7973 --C 2617.251345 0 0.0000 1997 | 0/25 37 h-m-p 0.0923 0.6960 0.0606 ----------Y 2617.251345 0 0.0000 2060 | 0/25 38 h-m-p 0.0034 1.7157 2.1835 +YC 2617.248722 1 0.0088 2115 | 0/25 39 h-m-p 0.3561 8.0000 0.0541 ++YYC 2617.187123 2 5.1908 2172 | 0/25 40 h-m-p 1.4277 8.0000 0.1966 YYC 2617.128052 2 1.2865 2227 | 0/25 41 h-m-p 0.6576 8.0000 0.3846 YCC 2617.097427 2 0.6678 2283 | 0/25 42 h-m-p 1.6000 8.0000 0.0515 YC 2617.087819 1 1.1214 2337 | 0/25 43 h-m-p 1.6000 8.0000 0.0203 CC 2617.085269 1 2.1873 2392 | 0/25 44 h-m-p 0.3866 1.9329 0.0749 YC 2617.083965 1 0.9065 2446 | 0/25 45 h-m-p 0.0713 0.3563 0.1786 YC 2617.083810 1 0.1743 2500 | 0/25 46 h-m-p 0.0066 0.0332 0.8518 Y 2617.083791 0 0.0137 2553 | 0/25 47 h-m-p 0.0002 0.0011 14.9754 C 2617.083790 0 0.0002 2606 | 0/25 48 h-m-p 0.0018 0.0091 1.6904 ------------.. | 0/25 49 h-m-p 0.0000 0.0000 459.7470 ++ 2617.083771 m 0.0000 2722 | 1/25 50 h-m-p 0.0000 0.0047 74.9107 YC 2617.083072 1 0.0000 2776 | 1/25 51 h-m-p 0.0000 0.0048 19.2621 +CC 2617.079198 1 0.0002 2831 | 1/25 52 h-m-p 0.0002 0.0278 15.8431 +CC 2617.063033 1 0.0009 2886 | 1/25 53 h-m-p 0.0004 0.0083 34.1380 CC 2617.043080 1 0.0005 2940 | 1/25 54 h-m-p 0.0007 0.0243 24.7164 YC 2617.033537 1 0.0004 2993 | 1/25 55 h-m-p 0.0007 0.0192 13.0621 CC 2617.025959 1 0.0006 3047 | 1/25 56 h-m-p 0.0010 0.0931 7.7114 YC 2617.021579 1 0.0007 3100 | 1/25 57 h-m-p 0.0003 0.0197 15.0630 CC 2617.016838 1 0.0004 3154 | 1/25 58 h-m-p 0.0008 0.0463 7.2504 YC 2617.008425 1 0.0016 3207 | 1/25 59 h-m-p 0.0008 0.0757 14.1168 C 2617.000901 0 0.0008 3259 | 1/25 60 h-m-p 0.0006 0.0418 17.4466 CC 2616.992030 1 0.0008 3313 | 1/25 61 h-m-p 0.0026 0.0361 5.1686 CC 2616.989578 1 0.0008 3367 | 1/25 62 h-m-p 0.0037 0.3232 1.1161 C 2616.989210 0 0.0009 3419 | 1/25 63 h-m-p 0.0028 1.0928 0.3662 YC 2616.989121 1 0.0016 3472 | 1/25 64 h-m-p 0.0015 0.3697 0.3991 C 2616.989042 0 0.0019 3524 | 1/25 65 h-m-p 0.0020 0.9989 0.6682 +YC 2616.988680 1 0.0061 3578 | 1/25 66 h-m-p 0.0023 1.1568 3.0066 +YC 2616.983704 1 0.0193 3632 | 1/25 67 h-m-p 0.0012 0.2517 48.0767 +CC 2616.961127 1 0.0055 3687 | 1/25 68 h-m-p 0.0018 0.1104 144.7836 CCC 2616.933708 2 0.0022 3743 | 1/25 69 h-m-p 0.0067 0.1136 46.2974 CC 2616.925421 1 0.0021 3797 | 1/25 70 h-m-p 0.0019 0.8912 50.0841 +CCCC 2616.885824 3 0.0080 3856 | 1/25 71 h-m-p 0.0112 0.1008 35.6341 -CC 2616.882832 1 0.0010 3911 | 1/25 72 h-m-p 0.2196 2.5418 0.1562 -YC 2616.882567 1 0.0082 3965 | 1/25 73 h-m-p 0.0033 1.6566 1.4550 ++YC 2616.854107 1 0.1200 4020 | 1/25 74 h-m-p 1.6000 8.0000 0.0655 YC 2616.851566 1 1.2105 4073 | 1/25 75 h-m-p 1.6000 8.0000 0.0093 CC 2616.850989 1 1.3179 4127 | 1/25 76 h-m-p 1.6000 8.0000 0.0044 Y 2616.850975 0 0.8280 4179 | 1/25 77 h-m-p 1.6000 8.0000 0.0001 ----------------.. | 1/25 78 h-m-p 0.0001 0.0450 4.6542 +YC 2616.847818 1 0.0003 4299 | 1/25 79 h-m-p 0.0000 0.0010 37.8415 CC 2616.842929 1 0.0001 4353 | 1/25 80 h-m-p 0.0003 0.0142 8.1607 C 2616.839247 0 0.0003 4405 | 1/25 81 h-m-p 0.0006 0.0410 3.4280 YC 2616.837493 1 0.0005 4458 | 1/25 82 h-m-p 0.0004 0.0525 3.8381 C 2616.836096 0 0.0005 4510 | 1/25 83 h-m-p 0.0004 0.0614 4.5864 +C 2616.831429 0 0.0015 4563 | 1/25 84 h-m-p 0.0004 0.0400 15.9275 YC 2616.822292 1 0.0009 4616 | 1/25 85 h-m-p 0.0005 0.0196 27.8551 CC 2616.811474 1 0.0006 4670 | 1/25 86 h-m-p 0.0004 0.0168 48.7697 C 2616.800619 0 0.0004 4722 | 1/25 87 h-m-p 0.0025 0.0444 7.0730 CC 2616.798625 1 0.0005 4776 | 1/25 88 h-m-p 0.0012 0.0599 2.8047 YC 2616.797906 1 0.0006 4829 | 1/25 89 h-m-p 0.0021 0.5088 0.7432 YC 2616.797712 1 0.0010 4882 | 1/25 90 h-m-p 0.0022 1.0886 0.6040 C 2616.797443 0 0.0026 4934 | 1/25 91 h-m-p 0.0018 0.9101 1.3813 +CC 2616.795408 1 0.0098 4989 | 1/25 92 h-m-p 0.0028 0.2625 4.8738 CC 2616.793822 1 0.0022 5043 | 1/25 93 h-m-p 0.0105 0.2689 1.0294 YC 2616.793610 1 0.0016 5096 | 1/25 94 h-m-p 0.0023 0.7013 0.7312 C 2616.793404 0 0.0026 5148 | 1/25 95 h-m-p 0.0017 0.3718 1.1563 +YC 2616.792897 1 0.0045 5202 | 1/25 96 h-m-p 0.0011 0.5375 5.4213 +YC 2616.787641 1 0.0101 5256 | 1/25 97 h-m-p 0.0009 0.1822 60.5224 +CCC 2616.762087 2 0.0044 5313 | 1/25 98 h-m-p 0.0013 0.1266 208.6232 +YC 2616.687683 1 0.0032 5367 | 1/25 99 h-m-p 0.0222 0.1108 28.3268 -C 2616.683921 0 0.0014 5420 | 1/25 100 h-m-p 0.0107 5.3347 11.7751 +YCC 2616.645440 2 0.0326 5476 | 1/25 101 h-m-p 0.0438 0.2455 8.7729 --YC 2616.644466 1 0.0011 5531 | 1/25 102 h-m-p 0.0323 8.0000 0.2977 +++YCC 2616.499618 2 1.6633 5589 | 1/25 103 h-m-p 1.1465 8.0000 0.4319 CC 2616.440922 1 1.5803 5643 | 1/25 104 h-m-p 1.6000 8.0000 0.1174 YC 2616.422665 1 0.8532 5696 | 1/25 105 h-m-p 1.4014 8.0000 0.0715 YC 2616.396678 1 3.1267 5749 | 0/25 106 h-m-p 0.0002 0.0346 1388.5918 YC 2616.394868 1 0.0000 5802 | 0/25 107 h-m-p 0.2304 1.1518 0.1211 ++ 2616.382842 m 1.1518 5855 | 1/25 108 h-m-p 1.6000 8.0000 0.0385 CC 2616.380423 1 0.4940 5910 | 1/25 109 h-m-p 0.2896 8.0000 0.0657 +YC 2616.379087 1 0.9354 5964 | 1/25 110 h-m-p 1.6000 8.0000 0.0062 Y 2616.379039 0 1.0840 6016 | 1/25 111 h-m-p 1.6000 8.0000 0.0004 Y 2616.379039 0 1.0032 6068 | 1/25 112 h-m-p 1.6000 8.0000 0.0001 Y 2616.379039 0 1.2010 6120 | 1/25 113 h-m-p 1.6000 8.0000 0.0000 --Y 2616.379039 0 0.0250 6174 | 1/25 114 h-m-p 0.0160 8.0000 0.0003 -------------.. | 1/25 115 h-m-p 0.0160 8.0000 0.0002 ------------C 2616.379039 0 0.0000 6301 Out.. lnL = -2616.379039 6302 lfun, 25208 eigenQcodon, 359214 P(t) Time used: 5:56 Model 7: beta TREE # 1 (1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356 0.031746 0.039010 0.001442 0.032148 0.022539 0.036423 0.149935 0.067160 0.191709 0.019841 0.060733 0.116928 0.146551 0.134998 0.039617 0.308786 0.151006 0.123587 0.109494 1.881034 0.637551 1.244267 ntime & nrate & np: 19 1 22 Bounds (np=22): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 9.250535 np = 22 lnL0 = -2729.389111 Iterating by ming2 Initial: fx= 2729.389111 x= 0.03175 0.03901 0.00144 0.03215 0.02254 0.03642 0.14993 0.06716 0.19171 0.01984 0.06073 0.11693 0.14655 0.13500 0.03962 0.30879 0.15101 0.12359 0.10949 1.88103 0.63755 1.24427 1 h-m-p 0.0000 0.0037 562.8337 +YYCCC 2726.543894 4 0.0001 56 | 0/22 2 h-m-p 0.0001 0.0012 329.6735 ++ 2682.294300 m 0.0012 103 | 0/22 3 h-m-p 0.0002 0.0008 466.6226 +YCYCCC 2653.101905 5 0.0005 159 | 0/22 4 h-m-p 0.0001 0.0007 102.6965 +YYYCC 2650.232003 4 0.0005 212 | 0/22 5 h-m-p 0.0004 0.0020 65.3014 YCCC 2649.362376 3 0.0006 264 | 0/22 6 h-m-p 0.0004 0.0029 91.7463 +YCCC 2647.101976 3 0.0013 317 | 0/22 7 h-m-p 0.0005 0.0024 106.4777 +YCCC 2644.597219 3 0.0014 370 | 0/22 8 h-m-p 0.0005 0.0027 254.2976 CCCC 2641.703269 3 0.0008 423 | 0/22 9 h-m-p 0.0002 0.0009 316.0759 +YCCC 2639.466331 3 0.0005 476 | 0/22 10 h-m-p 0.0005 0.0025 141.6633 YCCC 2637.308956 3 0.0011 528 | 0/22 11 h-m-p 0.0003 0.0017 77.8526 CCC 2636.854213 2 0.0005 579 | 0/22 12 h-m-p 0.0010 0.0051 28.7632 YCC 2636.675890 2 0.0007 629 | 0/22 13 h-m-p 0.0016 0.0253 13.1973 YC 2636.598211 1 0.0010 677 | 0/22 14 h-m-p 0.0038 0.0428 3.4149 CCC 2636.415420 2 0.0057 728 | 0/22 15 h-m-p 0.0015 0.0171 12.6186 +YC 2635.550050 1 0.0042 777 | 0/22 16 h-m-p 0.0011 0.0059 47.1607 YCCCC 2632.672623 4 0.0028 831 | 0/22 17 h-m-p 0.0006 0.0029 109.4606 YCCC 2630.363735 3 0.0010 883 | 0/22 18 h-m-p 0.0018 0.0088 48.9107 YCCC 2629.460151 3 0.0011 935 | 0/22 19 h-m-p 0.0040 0.0198 12.9132 CCC 2629.324760 2 0.0012 986 | 0/22 20 h-m-p 0.0034 0.1637 4.4684 ++YCC 2626.680618 2 0.0415 1038 | 0/22 21 h-m-p 0.0007 0.0033 162.4978 YCCCC 2622.760104 4 0.0015 1092 | 0/22 22 h-m-p 0.0006 0.0028 103.8494 YCCCC 2620.965912 4 0.0011 1146 | 0/22 23 h-m-p 0.0132 0.0661 6.5326 YC 2620.896961 1 0.0022 1194 | 0/22 24 h-m-p 0.0026 0.1302 5.7156 ++CCCC 2619.941037 3 0.0460 1249 | 0/22 25 h-m-p 0.4503 2.2517 0.5760 CCC 2618.046615 2 0.4022 1300 | 0/22 26 h-m-p 0.9128 4.5638 0.1182 YCC 2617.679183 2 0.7178 1350 | 0/22 27 h-m-p 1.6000 8.0000 0.0354 YCC 2617.597930 2 1.3338 1400 | 0/22 28 h-m-p 0.7185 8.0000 0.0658 +YC 2617.471596 1 2.2689 1449 | 0/22 29 h-m-p 1.0828 8.0000 0.1378 YCC 2617.276833 2 1.9977 1499 | 0/22 30 h-m-p 1.6000 8.0000 0.1323 YCC 2617.194286 2 0.9347 1549 | 0/22 31 h-m-p 1.6000 8.0000 0.0262 YC 2617.181520 1 0.7391 1597 | 0/22 32 h-m-p 1.6000 8.0000 0.0044 YC 2617.180101 1 0.6848 1645 | 0/22 33 h-m-p 1.5811 8.0000 0.0019 YC 2617.179852 1 0.8726 1693 | 0/22 34 h-m-p 1.6000 8.0000 0.0006 C 2617.179817 0 1.3340 1740 | 0/22 35 h-m-p 1.6000 8.0000 0.0003 +Y 2617.179713 0 4.4324 1788 | 0/22 36 h-m-p 0.5638 8.0000 0.0027 +C 2617.179541 0 2.1016 1836 | 0/22 37 h-m-p 1.6000 8.0000 0.0010 Y 2617.179515 0 0.9656 1883 | 0/22 38 h-m-p 1.6000 8.0000 0.0002 Y 2617.179514 0 0.8704 1930 | 0/22 39 h-m-p 1.6000 8.0000 0.0000 Y 2617.179514 0 0.7657 1977 | 0/22 40 h-m-p 1.6000 8.0000 0.0000 Y 2617.179514 0 0.9022 2024 | 0/22 41 h-m-p 1.6000 8.0000 0.0000 Y 2617.179514 0 0.7882 2071 | 0/22 42 h-m-p 0.2273 8.0000 0.0000 ---------------.. | 0/22 43 h-m-p 0.0160 8.0000 0.0000 Y 2617.179514 0 0.0126 2178 | 0/22 44 h-m-p 0.0160 8.0000 0.0002 -------------.. | 0/22 45 h-m-p 0.0160 8.0000 0.0094 ------------- Out.. lnL = -2617.179514 2295 lfun, 25245 eigenQcodon, 436050 P(t) Time used: 9:12 Model 8: beta&w>1 TREE # 1 (1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356 initial w for M8:NSbetaw>1 reset. 0.031746 0.039010 0.001442 0.032148 0.022539 0.036423 0.149935 0.067160 0.191709 0.019841 0.060733 0.116928 0.146551 0.134998 0.039617 0.308786 0.151006 0.123587 0.109494 1.892537 0.900000 0.681712 1.353905 2.843187 ntime & nrate & np: 19 2 24 Bounds (np=24): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 6.656957 np = 24 lnL0 = -2776.043793 Iterating by ming2 Initial: fx= 2776.043793 x= 0.03175 0.03901 0.00144 0.03215 0.02254 0.03642 0.14993 0.06716 0.19171 0.01984 0.06073 0.11693 0.14655 0.13500 0.03962 0.30879 0.15101 0.12359 0.10949 1.89254 0.90000 0.68171 1.35390 2.84319 1 h-m-p 0.0000 0.0002 826.2393 +++ 2730.839566 m 0.0002 54 | 1/24 2 h-m-p 0.0005 0.0030 229.6758 +CYCCCC 2666.650579 5 0.0023 115 | 0/24 3 h-m-p 0.0000 0.0001 2114.7639 +CYYYYCCCC 2651.793891 8 0.0001 178 | 0/24 4 h-m-p 0.0001 0.0003 344.2322 CCCC 2650.037846 3 0.0001 235 | 0/24 5 h-m-p 0.0003 0.0014 84.2899 YCCC 2649.525450 3 0.0002 291 | 0/24 6 h-m-p 0.0002 0.0025 76.3449 +YYC 2648.524303 2 0.0006 345 | 0/24 7 h-m-p 0.0003 0.0013 150.9427 CCCC 2647.333871 3 0.0004 402 | 0/24 8 h-m-p 0.0001 0.0005 621.4755 +YC 2644.623043 1 0.0003 455 | 0/24 9 h-m-p 0.0016 0.0081 92.0638 CYCCC 2643.175594 4 0.0012 513 | 0/24 10 h-m-p 0.0018 0.0261 59.5996 YCCC 2640.798750 3 0.0038 569 | 0/24 11 h-m-p 0.0045 0.0253 50.0070 CYC 2638.764931 2 0.0043 623 | 0/24 12 h-m-p 0.0022 0.0108 38.2676 CCCC 2637.702014 3 0.0036 680 | 0/24 13 h-m-p 0.0021 0.0107 37.2462 CCC 2637.301883 2 0.0018 735 | 0/24 14 h-m-p 0.0045 0.0454 14.5978 YCC 2637.065133 2 0.0038 789 | 0/24 15 h-m-p 0.0094 0.1299 5.8542 YC 2636.999007 1 0.0042 841 | 0/24 16 h-m-p 0.0066 0.3235 3.7615 YC 2636.875111 1 0.0137 893 | 0/24 17 h-m-p 0.0042 0.1404 12.3155 +YCC 2636.412715 2 0.0144 948 | 0/24 18 h-m-p 0.0087 0.0693 20.4249 YC 2636.110520 1 0.0056 1000 | 0/24 19 h-m-p 0.0251 0.1868 4.5201 CCC 2635.992459 2 0.0078 1055 | 0/24 20 h-m-p 0.0049 0.1403 7.2290 +CC 2635.403686 1 0.0184 1109 | 0/24 21 h-m-p 0.0040 0.0426 33.4594 +YCC 2633.310897 2 0.0129 1164 | 0/24 22 h-m-p 0.0035 0.0173 20.5020 CYC 2632.969270 2 0.0031 1218 | 0/24 23 h-m-p 0.0132 0.0661 3.7254 YCCC 2632.067201 3 0.0249 1274 | 0/24 24 h-m-p 0.0043 0.0311 21.7438 +CYCCC 2625.486955 4 0.0225 1334 | 0/24 25 h-m-p 0.0014 0.0068 25.0576 CCCC 2625.189986 3 0.0016 1391 | 0/24 26 h-m-p 0.0264 0.1538 1.4734 +CYCC 2623.651902 3 0.1123 1448 | 0/24 27 h-m-p 0.0595 0.2976 0.6583 ++ 2621.962096 m 0.2976 1499 | 0/24 28 h-m-p 0.2290 1.4297 0.8556 YCCCC 2620.995742 4 0.1213 1557 | 0/24 29 h-m-p 0.3799 2.2714 0.2732 YCCC 2619.195723 3 0.9705 1613 | 0/24 30 h-m-p 0.1762 0.8812 0.4341 +YCYCC 2617.923627 4 0.5263 1671 | 0/24 31 h-m-p 0.2452 1.2259 0.2111 CCCC 2617.561925 3 0.4100 1728 | 0/24 32 h-m-p 0.4235 2.9540 0.2043 CCC 2617.361790 2 0.3476 1783 | 0/24 33 h-m-p 0.8158 4.7500 0.0870 YC 2617.298213 1 0.5903 1835 | 0/24 34 h-m-p 0.4611 7.7656 0.1114 +YCC 2617.227906 2 1.4074 1890 | 0/24 35 h-m-p 0.3867 3.7171 0.4055 YC 2617.100009 1 0.8337 1942 | 0/24 36 h-m-p 0.6281 3.1405 0.3745 CC 2617.017156 1 0.7131 1995 | 0/24 37 h-m-p 0.5161 2.5805 0.3520 YC 2616.906341 1 1.1096 2047 | 0/24 38 h-m-p 0.5628 2.8141 0.1878 CC 2616.849299 1 0.7255 2100 | 0/24 39 h-m-p 1.6000 8.0000 0.0176 YC 2616.830622 1 0.7254 2152 | 0/24 40 h-m-p 0.8929 8.0000 0.0143 YC 2616.828698 1 0.5911 2204 | 0/24 41 h-m-p 0.6062 8.0000 0.0139 YC 2616.827470 1 0.9879 2256 | 0/24 42 h-m-p 1.6000 8.0000 0.0066 YC 2616.827140 1 0.8118 2308 | 0/24 43 h-m-p 1.1182 8.0000 0.0048 Y 2616.826962 0 0.8141 2359 | 0/24 44 h-m-p 0.7327 8.0000 0.0053 YC 2616.826840 1 1.6275 2411 | 0/24 45 h-m-p 1.3841 8.0000 0.0063 C 2616.826624 0 1.8512 2462 | 0/24 46 h-m-p 0.7235 8.0000 0.0161 CC 2616.826306 1 1.1428 2515 | 0/24 47 h-m-p 1.6000 8.0000 0.0085 Y 2616.826193 0 1.1627 2566 | 0/24 48 h-m-p 1.6000 8.0000 0.0055 Y 2616.826134 0 0.7769 2617 | 0/24 49 h-m-p 1.6000 8.0000 0.0017 Y 2616.826108 0 0.9432 2668 | 0/24 50 h-m-p 0.7870 8.0000 0.0020 Y 2616.826104 0 0.5951 2719 | 0/24 51 h-m-p 1.6000 8.0000 0.0005 C 2616.826104 0 0.4732 2770 | 0/24 52 h-m-p 1.6000 8.0000 0.0001 Y 2616.826104 0 0.7592 2821 | 0/24 53 h-m-p 1.6000 8.0000 0.0000 C 2616.826104 0 0.3595 2872 | 0/24 54 h-m-p 1.6000 8.0000 0.0000 -Y 2616.826104 0 0.1000 2924 | 0/24 55 h-m-p 0.0188 8.0000 0.0000 Y 2616.826104 0 0.0188 2975 | 0/24 56 h-m-p 0.1200 8.0000 0.0000 C 2616.826104 0 0.1200 3026 | 0/24 57 h-m-p 0.0907 8.0000 0.0000 -Y 2616.826104 0 0.0057 3078 | 0/24 58 h-m-p 0.0160 8.0000 0.0002 -------------.. | 0/24 59 h-m-p 0.0058 2.8860 0.0029 ------------ Out.. lnL = -2616.826104 3202 lfun, 38424 eigenQcodon, 669218 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2649.437393 S = -2564.445767 -76.392455 Calculating f(w|X), posterior probabilities of site classes. did 10 / 201 patterns 14:08 did 20 / 201 patterns 14:08 did 30 / 201 patterns 14:08 did 40 / 201 patterns 14:09 did 50 / 201 patterns 14:09 did 60 / 201 patterns 14:09 did 70 / 201 patterns 14:09 did 80 / 201 patterns 14:09 did 90 / 201 patterns 14:10 did 100 / 201 patterns 14:10 did 110 / 201 patterns 14:10 did 120 / 201 patterns 14:10 did 130 / 201 patterns 14:10 did 140 / 201 patterns 14:11 did 150 / 201 patterns 14:11 did 160 / 201 patterns 14:11 did 170 / 201 patterns 14:11 did 180 / 201 patterns 14:11 did 190 / 201 patterns 14:12 did 200 / 201 patterns 14:12 did 201 / 201 patterns 14:12 Time used: 14:12 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=248 D_melanogaster_RPA2-PB MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY D_sechellia_RPA2-PB MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY D_simulans_RPA2-PB MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY D_yakuba_RPA2-PB MNDSFGDFNATQTAPSGAASSQKGEGIAPLVVKQIVDAPEGNIEMFGMQY D_erecta_RPA2-PB MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY D_biarmipes_RPA2-PB MNDSFGDFNATQTAPTGAASNQKGEGIVPLVIKQVVDAPEGNIELFGMQY D_suzukii_RPA2-PB MNDSFGDFNATQTAPAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY D_eugracilis_RPA2-PB MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY D_rhopaloa_RPA2-PB MNDSFGDFNATQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY D_elegans_RPA2-PB MNDSFGDFNAIQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY D_takahashii_RPA2-PB MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIEMFGMQY ********** ***.:****.******.***:**:*********:***** D_melanogaster_RPA2-PB AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN D_sechellia_RPA2-PB AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN D_simulans_RPA2-PB AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN D_yakuba_RPA2-PB AMACVVAIVRNIETSSTKITYALEDHSGRIDAHYWLEEGDALKAPEVMIN D_erecta_RPA2-PB AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN D_biarmipes_RPA2-PB AMVCVVGIVRNVETSSTKITYTVEDHSGRIDAHYWLEEGDALKAPEVMVN D_suzukii_RPA2-PB AMACVVGIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN D_eugracilis_RPA2-PB AMACVVGIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN D_rhopaloa_RPA2-PB AMACVVAIVRNIETSSTKITYTLEDHSGRMDAHYWLEEGDALKAPEVMLN D_elegans_RPA2-PB AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN D_takahashii_RPA2-PB GMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN .*.***.****:*********::******:******************:* D_melanogaster_RPA2-PB NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ D_sechellia_RPA2-PB NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ D_simulans_RPA2-PB NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ D_yakuba_RPA2-PB NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ D_erecta_RPA2-PB NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEALNARYRAEDYQ D_biarmipes_RPA2-PB NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYK D_suzukii_RPA2-PB NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ D_eugracilis_RPA2-PB NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEVLNARYRAEDYQ D_rhopaloa_RPA2-PB NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEALNARYRAEDYQ D_elegans_RPA2-PB NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEALNARYRAEDYQ D_takahashii_RPA2-PB NYVKVYGTTRSQAGQKTLMVFKLLPVLDPNELCTHLLEVLNARYRAEDYQ ************.*.****:*****:*****:******.**********: D_melanogaster_RPA2-PB SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE D_sechellia_RPA2-PB SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE D_simulans_RPA2-PB SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE D_yakuba_RPA2-PB SKGGAG--AGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKINVSE D_erecta_RPA2-PB SKGGAGGGAGASSGSGPIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE D_biarmipes_RPA2-PB NKGGSG--AVASSGSGSIADFTTSQSSAIVSGLDPKQQAVFQAIKSNVSE D_suzukii_RPA2-PB NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE D_eugracilis_RPA2-PB SKGGSG--AGASSGGGSISDFTASQSTAIVSGLDPKQQAVFQAIKSNVSE D_rhopaloa_RPA2-PB NKGGSS--GVAPSGTGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE D_elegans_RPA2-PB NKGGSS--AVAPSGSGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE D_takahashii_RPA2-PB NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE .***:. . *.** *.*:***:***:******:*********** **** D_melanogaster_RPA2-PB EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM-- D_sechellia_RPA2-PB EGISRKQLKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM-- D_simulans_RPA2-PB EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM-- D_yakuba_RPA2-PB EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo D_erecta_RPA2-PB EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM-- D_biarmipes_RPA2-PB EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo D_suzukii_RPA2-PB EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo D_eugracilis_RPA2-PB EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo D_rhopaloa_RPA2-PB EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo D_elegans_RPA2-PB EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo D_takahashii_RPA2-PB EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo ******:****************:**********************
>D_melanogaster_RPA2-PB ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCAACTGG AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC AGATTGTGGACGCCCCAGAGGGAAACATCGAGTTGTTCGGCATGCAGTAC GCCATGGCATGTGTTGTGGCCATAGTGCGGAACGTGGAGACTTCCTCGAC GAAGATCACCTACACCCTGGAGGATCATAGCGGCAGGATCGATGCGCACT ACTGGCTTGAGGAGGGCGACGCTCTCAAGGCACCCGAAGTAATGGTCAAC AACTACGTGAAGGTCTACGGCACCACCCGGTCGCAAGGCGGTTCCAAAAC CCTAATGATCTTCAAGCTACTGCCCGTTTTGGATCCCAACGAGGTGTGCA CCCACCTGCTGGAAGTACTCAATGCCCGCTACAGGGCCGAGGACTACCAG AGCAAGGGTGGAGCTGGAGCTGGTGCAGGGGCTTCTTCCGGCTCAGGCTC CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTCAGTGGGCTGG AGCCCAAGCAGCAGGCCGTATTCCAGGCCATCAAGAGCAATGTTTCCGAG GAGGGCATCTCCCGCAAGGAACTGAAAGCCAAATTCTCCCACATCAGCGA CTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAGGGACACATTT ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------ >D_sechellia_RPA2-PB ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCGCTGG AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC AGATTGTGGACGCCCCGGAGGGAAACATCGAGTTGTTCGGCATGCAGTAC GCCATGGCCTGTGTTGTGGCCATAGTGCGAAACGTGGAGACTTCCTCGAC GAAGATCACCTATACACTGGAGGATCATAGCGGCAGGATCGATGCGCACT ACTGGCTGGAGGAGGGCGACGCTCTCAAGGCACCCGAGGTCATGGTCAAC AACTACGTGAAGGTCTACGGCACCACCCGGTCGCAAGGCGGTTCCAAAAC CCTAATGATATTCAAGCTACTGCCCGTCTTGGATCCCAACGAGGTGTGCA CCCACCTGCTGGAAGTACTCAATGCCCGCTACAGGGCCGAGGACTACCAG AGCAAGGGTGGAGCTGGAGCTGGTGCAGGGGCTTCTTCCGGCTCAGGCTC CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTCAGTGGGCTAG ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAA GAGGGCATCTCCCGCAAGCAACTGAAAGCCAAATTCTCCCACATCAGCGA CTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAGGGACACATTT ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------ >D_simulans_RPA2-PB ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCGCTGG AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC AGATTGTGGACGCCCCGGAGGGAAACATCGAGTTGTTCGGCATGCAGTAC GCCATGGCCTGTGTTGTGGCCATAGTGCGAAACGTGGAGACTTCCTCAAC GAAGATCACCTATACACTGGAGGACCATAGCGGCAGGATCGATGCGCACT ACTGGCTGGAGGAGGGCGACGCTCTCAAGGCACCCGAGGTCATGGTCAAC AACTACGTGAAGGTCTACGGCACCACCCGGTCGCAAGGCGGTTCCAAAAC CCTAATGATATTCAAGCTACTGCCCGTCTTGGATCCCAACGAGGTGTGCA CGCACCTGCTGGAAGTACTCAATGCCCGCTACAGGGCCGAGGACTACCAG AGCAAGGGTGGAGCTGGAGCTGGTGCAGGCGCTTCTTCCGGCTCAGGCTC CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTTAGTGGGCTAG ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAA GAGGGCATCTCTCGCAAGGAACTGAAAGCCAAATTCTCCCACATCAGCGA TTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAGGGACACATTT ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------ >D_yakuba_RPA2-PB ATGAATGACTCATTTGGAGATTTCAATGCCACACAAACGGCGCCCAGTGG AGCCGCCAGTTCTCAAAAGGGAGAAGGAATAGCGCCCCTGGTGGTGAAAC AGATTGTGGACGCCCCGGAGGGAAACATCGAGATGTTCGGCATGCAGTAC GCAATGGCCTGTGTTGTGGCCATAGTGCGGAACATCGAGACTTCCTCGAC AAAGATTACCTACGCCCTGGAGGATCATAGCGGCAGAATCGATGCGCACT ACTGGTTGGAGGAGGGCGACGCTCTGAAGGCACCCGAAGTCATGATCAAC AACTACGTAAAGGTCTACGGCACCACCCGATCGCAAGGAGGTTCTAAAAC CCTAATGATCTTCAAGTTACTGCCTGTTTTGGATCCCAACGAGGTCTGCA CCCACCTGCTGGAAGTACTCAATGCCCGTTACAGGGCCGAGGACTACCAG AGTAAGGGTGGAGCTGGT------GCAGGCGCTTCCTCCGGCTCCGGCTC CATAGCTGATTTCACAGCCTCCCAGAGCTCGGCCATTGTCAGTGGACTGG AGCCCAAGCAGCAGGCCGTTTTCCAGGCTATCAAGATCAATGTTTCCGAG GAGGGCATCTCCCGCAAGGAGCTGAAAGCCAAATTTTCCCATATCAGCGA CTCTGAGTTGACCAACATTCTGGACTTTATGATATCTGAGGGACACATTT ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------ >D_erecta_RPA2-PB ATGAATGACTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCGCTGG AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC AGATCGTGGACGCCCCGGAGGGCAACATCGAGTTGTTCGGCATGCAGTAC GCGATGGCCTGTGTTGTGGCCATAGTGCGGAACATCGAGACTTCCTCGAC CAAGATCACCTACACGCTGGAGGATCATAGCGGCAGAATCGATGCGCACT ACTGGCTGGAAGAGGGCGACGCTCTGAAGGCACCCGAAGTCATGGTCAAC AACTACGTGAAGGTCTACGGCACCACCAGATCGCAAGGCGGCTCTAAGAC CCTGATGATCTTCAAGCTGCTGCCTGTTCTCGATCCCAACGAGGTGTGCA CCCACCTGCTGGAAGCACTCAATGCCCGCTACAGGGCCGAGGACTACCAG AGCAAGGGTGGAGCTGGTGGTGGTGCAGGGGCTTCTTCCGGCTCAGGCCC CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTCAGTGGACTGG AGCCCAAGCAGCAGGCCGTGTTCCAGGCCATCAAGAGCAATGTTTCCGAG GAGGGCATCTCCCGCAAGGAGCTGAAAGCCAAATTCTCCCACATCAGCGA CTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAAGGACACATTT ATTCCAGCATTGACGCAGACCACTTTATTTGCACAATG------ >D_biarmipes_RPA2-PB ATGAACGATTCATTTGGAGATTTCAATGCCACACAAACGGCGCCCACTGG AGCAGCCAGCAATCAGAAGGGAGAGGGAATAGTTCCACTGGTGATAAAGC AAGTTGTGGATGCCCCCGAGGGCAACATCGAGCTGTTCGGCATGCAATAT GCCATGGTCTGTGTGGTGGGCATAGTGCGCAACGTCGAGACCTCCTCGAC GAAGATTACCTACACCGTGGAGGATCACAGTGGCAGGATCGATGCGCACT ACTGGCTGGAGGAGGGCGACGCGCTGAAGGCCCCCGAGGTCATGGTCAAC AACTATGTTAAGGTCTACGGCACCACGCGATCGCAGGGGGGTCAGAAAAC CCTGATGGTCTTCAAGCTGCTGCCCGTGCTGGACCCCAACGAGGTGTGCA CCCATCTCCTGGAGGTGCTCAATGCCCGCTACAGGGCCGAGGACTACAAG AACAAGGGGGGATCTGGT------GCAGTGGCTTCATCCGGCTCTGGCTC CATAGCCGACTTCACCACCTCCCAGAGCTCGGCCATTGTGAGTGGGCTGG ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTCTCCGAG GAGGGCATCTCGCGCAAGGAGCTGAAAGCCAAGTTCTCACACATCAGCGA TTCGGAACTGACCAACATTCTGGACTTCATGATTTCCGAGGGGCACATTT ATTCCAGCATTGATGCTGATCACTTTATCTGCACCATG------ >D_suzukii_RPA2-PB ATGAACGATTCATTTGGAGATTTTAATGCCACACAAACTGCGCCCGCTGG AGCGGCCAGCAATCAGAAGGGAGAGGGAATAGTGCCGCTGGTGATTAAGC AGATTGTGGATGCCCCCGAGGGCAACATCGAGTTGTTTGGCATGCAATAT GCGATGGCCTGTGTGGTGGGCATAGTGCGAAATGTCGAGACTTCCTCAAC GAAGATTACTTACACCCTGGAGGATCACAGTGGCAGGATCGATGCGCACT ATTGGCTAGAAGAAGGCGACGCCCTGAAGGCCCCCGAAGTCATGGTCAAC AACTATGTGAAGGTCTATGGCACCACACGATCGCAGGGGGGGCAGAAAAC ACTGATGGTCTTCAAGCTGCTGCCCGTTTTGGACCCCAACGAGGTGTGCA CCCATCTCCTGGAGGTGCTCAATGCCCGCTACAGGGCCGAGGATTACCAG AACAAGGGGGGATCTGGT------GCAGTGGCTTCTTCAGGCTCCGGCTC CATAGCCGATTTTACCGCCTCCCAGAGCTCAGCCATTGTGAGTGGGCTGG ATCCCAAGCAGCAGGCTGTCTTCCAAGCCATTAAGAGCAATGTCTCCGAG GAGGGTATCTCGCGCAAGGAGCTGAAAGCCAAGTTCTCACACATCAGCGA CTCGGAGTTGACCAACATTCTGGACTTCATGATTTCCGAGGGACACATTT ATTCCAGCATTGATGCAGATCATTTCATATGCACCATG------ >D_eugracilis_RPA2-PB ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCACTGG AGCCGCCAGCAATCAAAAGGGAGAGGGAATAGTACCATTGGTGGTAAAGC AAATTGTGGATGCCCCAGAGGGAAACATTGAGCTGTTCGGCATGCAATAT GCCATGGCCTGTGTGGTGGGCATTGTGCGAAACATCGAGACTTCCTCGAC AAAGATTACCTACACCCTAGAGGATCACAGTGGTAGGATCGATGCACACT ATTGGCTGGAGGAGGGCGACGCCCTGAAGGCGCCCGAAGTGATGGTCAAT AACTATGTAAAGGTCTATGGCACTACGCGTTCACAAGCGGGCCAGAAAAC CCTGATGGTCTTTAAACTCCTGCCCATTCTGGATCCCAATGAGGTGTGCA CCCATCTTCTTGAAGTTCTAAATGCCCGCTACAGGGCCGAGGATTACCAG AGCAAAGGTGGATCTGGC------GCTGGAGCTTCTTCTGGAGGTGGCTC CATATCCGATTTCACCGCCTCCCAGAGCACGGCTATTGTTAGTGGGCTTG ATCCCAAGCAGCAGGCCGTTTTCCAGGCCATTAAGAGCAATGTTTCCGAG GAGGGTATTTCCCGTAAGGAGCTAAAAGCGAAGTTCTCTCATATTAGCGA TTCTGAGTTGACCAACATTTTGGACTTTATGATTTCCGAGGGACACATTT ACTCCAGCATTGATGCGGATCATTTTATTTGCACAATG------ >D_rhopaloa_RPA2-PB ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGACCGCTGG AGCCGCCAGCAATCAAAAGGGAGAGGGAATTGTGCCATTGGTCATTAAGC AGATTGTGGATGCGCCAGAGGGAAACATCGAGTTGTTTGGCATGCAATAT GCAATGGCCTGTGTGGTGGCCATAGTGCGAAATATCGAGACTTCCTCGAC CAAGATTACTTACACCCTGGAGGATCACAGTGGCCGGATGGATGCCCATT ATTGGCTGGAGGAGGGCGATGCTCTGAAGGCCCCCGAAGTCATGCTCAAT AACTATGTGAAAGTGTATGGAACCACGCGATCGCAGGGAGGTCAGAAAAC CCTGATGGTGTTCAAACTGCTGCCCGTTTTGGATCCCAACGAGGTGTGCA CACATCTCCTAGAAGCTCTCAATGCCCGCTATAGGGCAGAGGATTACCAG AACAAGGGAGGATCTTCG------GGAGTGGCTCCTTCTGGCACCGGCTC CATATCCGATTTCACCGCCTCTCAGAGCTCGGCCATCGTCAGTGGGCTGG ATCCCAAGCAGCAGGCAGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAG GAGGGCATCTCTCGCAAGGAACTAAAGGCCAAGTTCTCCCACATCAGCGA CTCGGAGTTGACCAATATTGTGGACTTCATGATTTCCGAGGGTCATATAT ACTCCAGCATTGATGCCGATCACTTTATTTGCACTATG------ >D_elegans_RPA2-PB ATGAATGATTCGTTTGGAGATTTCAATGCCATACAAACTGCGACCGCTGG AGCCGCCAGCAATCAAAAGGGAGAGGGAATTGTGCCATTGGTAATAAAGC AGATTGTGGATGCGCCGGAGGGAAACATCGAGTTGTTCGGCATGCAATAT GCCATGGCCTGTGTGGTGGCCATAGTGCGAAACATCGAGACCTCATCGAC CAAGATCACTTACACCCTGGAGGATCACAGTGGCCGAATCGATGCACATT ATTGGCTGGAGGAGGGCGATGCTCTGAAGGCCCCCGAGGTCATGCTCAAT AACTATGTGAAGGTCTATGGCACAACGCGATCTCAGGCAGGTCAGAAAAC GCTGATGGTCTTCAAATTGCTACCCATTTTGGATCCCAACGAGGTGTGCA CCCATCTCCTGGAAGCTCTCAATGCCCGCTATAGGGCAGAGGACTACCAG AACAAGGGAGGATCCTCA------GCAGTTGCTCCGTCGGGCTCCGGCTC CATATCCGATTTCACAGCCTCCCAGAGCTCGGCCATCGTCAGTGGGCTGG ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAG GAGGGCATCTCCCGCAAGGAACTCAAAGCCAAATTCTCTCACATCAGCGA CTCCGAGTTGACCAATATTGTGGACTTCATGATTTCCGAGGGACATATTT ACTCCAGCATTGATGCCGATCACTTCATTTGCACTATG------ >D_takahashii_RPA2-PB ATGAACGATTCATTTGGAGATTTCAACGCCACACAAACGGCGCCCACGGG AGCAGCCAGCAATCAGAAGGGAGAGGGAATAGTGCCACTGGTGGTGAAGC AGATTGTGGATGCCCCGGAGGGCAACATCGAGATGTTCGGCATGCAATAC GGCATGGCCTGTGTGGTGGCCATAGTGCGAAACATCGAGACTTCCTCGAC GAAGATTACCTACACCCTGGAGGACCACAGCGGCAGGATCGATGCGCACT ATTGGTTGGAGGAGGGCGACGCCCTCAAGGCCCCCGAGGTCATGCTGAAC AACTACGTGAAGGTCTATGGCACCACGCGATCGCAGGCGGGCCAGAAGAC CCTAATGGTCTTCAAACTGCTGCCCGTTTTGGACCCAAACGAGCTGTGCA CCCATCTCCTAGAAGTGCTCAATGCGCGCTACAGGGCCGAGGATTACCAG AACAAGGGCGGATCTGGC------GCAGTGGCTTCTTCCGGCTCCGGCTC CATAGCTGACTTCACCGCCTCCCAGAGCTCGGCCATTGTAAGTGGGCTGG ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTCTCCGAG GAGGGCATCTCCCGCAAGGAACTGAAAGCCAAGTTCTCGCACATCAGTGA CTCGGAGTTGACCAACATTCTGGACTTTATGATTTCCGAAGGACACATTT ACTCCAGCATTGATGCTGATCATTTTATTTGCACAATG------
>D_melanogaster_RPA2-PB MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >D_sechellia_RPA2-PB MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKQLKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >D_simulans_RPA2-PB MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >D_yakuba_RPA2-PB MNDSFGDFNATQTAPSGAASSQKGEGIAPLVVKQIVDAPEGNIEMFGMQY AMACVVAIVRNIETSSTKITYALEDHSGRIDAHYWLEEGDALKAPEVMIN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAG--AGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKINVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >D_erecta_RPA2-PB MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEALNARYRAEDYQ SKGGAGGGAGASSGSGPIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >D_biarmipes_RPA2-PB MNDSFGDFNATQTAPTGAASNQKGEGIVPLVIKQVVDAPEGNIELFGMQY AMVCVVGIVRNVETSSTKITYTVEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYK NKGGSG--AVASSGSGSIADFTTSQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >D_suzukii_RPA2-PB MNDSFGDFNATQTAPAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY AMACVVGIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >D_eugracilis_RPA2-PB MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVGIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEVLNARYRAEDYQ SKGGSG--AGASSGGGSISDFTASQSTAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >D_rhopaloa_RPA2-PB MNDSFGDFNATQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY AMACVVAIVRNIETSSTKITYTLEDHSGRMDAHYWLEEGDALKAPEVMLN NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEALNARYRAEDYQ NKGGSS--GVAPSGTGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTM >D_elegans_RPA2-PB MNDSFGDFNAIQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEALNARYRAEDYQ NKGGSS--AVAPSGSGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTM >D_takahashii_RPA2-PB MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIEMFGMQY GMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN NYVKVYGTTRSQAGQKTLMVFKLLPVLDPNELCTHLLEVLNARYRAEDYQ NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
#NEXUS [ID: 3876820848] begin taxa; dimensions ntax=11; taxlabels D_melanogaster_RPA2-PB D_sechellia_RPA2-PB D_simulans_RPA2-PB D_yakuba_RPA2-PB D_erecta_RPA2-PB D_biarmipes_RPA2-PB D_suzukii_RPA2-PB D_eugracilis_RPA2-PB D_rhopaloa_RPA2-PB D_elegans_RPA2-PB D_takahashii_RPA2-PB ; end; begin trees; translate 1 D_melanogaster_RPA2-PB, 2 D_sechellia_RPA2-PB, 3 D_simulans_RPA2-PB, 4 D_yakuba_RPA2-PB, 5 D_erecta_RPA2-PB, 6 D_biarmipes_RPA2-PB, 7 D_suzukii_RPA2-PB, 8 D_eugracilis_RPA2-PB, 9 D_rhopaloa_RPA2-PB, 10 D_elegans_RPA2-PB, 11 D_takahashii_RPA2-PB ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.0178362,(2:0.004029588,3:0.01876985)1.000:0.02458587,((4:0.09321422,5:0.05227052)0.933:0.01940653,(((6:0.08323978,7:0.08263758)0.986:0.03390215,11:0.09718325)0.996:0.03839865,(8:0.1898381,(9:0.07711137,10:0.07323976)1.000:0.1074507)0.596:0.02217019)1.000:0.1301344)0.950:0.01848031); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.0178362,(2:0.004029588,3:0.01876985):0.02458587,((4:0.09321422,5:0.05227052):0.01940653,(((6:0.08323978,7:0.08263758):0.03390215,11:0.09718325):0.03839865,(8:0.1898381,(9:0.07711137,10:0.07323976):0.1074507):0.02217019):0.1301344):0.01848031); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2809.67 -2824.58 2 -2809.37 -2826.18 -------------------------------------- TOTAL -2809.51 -2825.67 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/373/RPA2-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 1.210242 0.010869 1.009106 1.407339 1.205791 1311.16 1406.08 1.000 r(A<->C){all} 0.110616 0.000405 0.070400 0.149331 0.109666 991.31 1028.22 1.000 r(A<->G){all} 0.327096 0.001514 0.254182 0.403331 0.325862 864.55 868.59 1.000 r(A<->T){all} 0.072923 0.000443 0.033245 0.113853 0.071470 1033.54 1061.45 1.000 r(C<->G){all} 0.078483 0.000240 0.050163 0.109557 0.077471 935.11 1110.24 1.004 r(C<->T){all} 0.343127 0.001369 0.267265 0.412214 0.342439 757.30 770.42 1.000 r(G<->T){all} 0.067755 0.000287 0.033964 0.099328 0.066327 1135.62 1171.84 1.000 pi(A){all} 0.234227 0.000219 0.206214 0.262763 0.233738 875.66 915.42 1.000 pi(C){all} 0.270287 0.000213 0.242988 0.300271 0.270243 1053.18 1145.74 1.000 pi(G){all} 0.281226 0.000236 0.251852 0.311382 0.281145 991.39 1054.90 1.000 pi(T){all} 0.214259 0.000185 0.189702 0.242241 0.214067 1018.40 1198.50 1.000 alpha{1,2} 0.129480 0.000229 0.101149 0.159989 0.128659 1501.00 1501.00 1.000 alpha{3} 3.483294 0.922106 1.806939 5.396241 3.358208 1352.04 1426.52 1.000 pinvar{all} 0.247805 0.002633 0.148348 0.347340 0.250910 1289.18 1370.63 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/373/RPA2-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 11 ls = 244 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 3 3 3 4 3 2 | Ser TCT 2 2 3 4 3 2 | Tyr TAT 1 2 2 1 1 3 | Cys TGT 1 1 1 1 1 1 TTC 6 6 6 5 6 7 | TCC 10 10 9 10 8 7 | TAC 7 6 6 7 7 5 | TGC 2 2 2 2 2 2 Leu TTA 0 0 0 1 0 0 | TCA 2 2 3 1 2 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 3 3 3 3 2 0 | TCG 3 3 2 3 3 5 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 1 0 0 0 0 0 | Pro CCT 0 0 0 1 1 0 | His CAT 1 1 1 2 1 1 | Arg CGT 0 0 0 1 0 0 CTC 2 2 2 1 2 2 | CCC 5 6 6 5 6 6 | CAC 5 5 5 4 5 5 | CGC 2 2 2 1 2 3 CTA 2 3 3 1 0 0 | CCA 2 0 0 0 0 1 | Gln CAA 3 4 3 3 3 3 | CGA 0 1 1 1 0 1 CTG 8 8 8 9 12 13 | CCG 0 1 1 1 1 0 | CAG 7 7 7 7 7 7 | CGG 2 1 1 1 1 0 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 7 7 7 7 6 6 | Thr ACT 3 2 2 1 2 1 | Asn AAT 5 5 5 4 5 4 | Ser AGT 1 1 1 4 1 2 ATC 7 6 6 9 9 6 | ACC 8 7 6 6 8 10 | AAC 6 6 6 6 6 8 | AGC 7 7 7 4 7 5 ATA 3 4 4 4 3 4 | ACA 2 3 3 4 2 1 | Lys AAA 3 3 3 4 2 2 | Arg AGA 0 0 0 1 2 0 Met ATG 7 7 7 8 7 7 | ACG 1 1 2 1 1 3 | AAG 10 10 10 9 11 12 | AGG 2 2 2 1 1 2 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 3 2 3 4 3 3 | Ala GCT 4 5 5 5 5 2 | Asp GAT 7 8 8 6 5 9 | Gly GGT 2 2 2 3 2 2 GTC 3 6 5 4 4 8 | GCC 13 14 14 13 13 12 | GAC 6 6 6 7 8 5 | GGC 8 8 9 8 10 9 GTA 3 1 1 2 0 0 | GCA 4 3 3 4 4 2 | Glu GAA 4 3 4 3 5 1 | GGA 8 8 8 9 7 5 GTG 9 9 9 5 9 11 | GCG 2 2 2 3 3 3 | GAG 13 12 12 14 12 15 | GGG 2 2 1 0 1 4 -------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------- Phe TTT 4 4 3 1 3 | Ser TCT 2 5 4 2 2 | Tyr TAT 5 4 5 5 2 | Cys TGT 1 1 1 1 1 TTC 5 5 6 8 6 | TCC 7 8 7 10 9 | TAC 3 4 3 3 6 | TGC 2 2 2 2 2 Leu TTA 0 0 0 0 0 | TCA 5 2 1 2 1 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0 TTG 3 3 4 5 3 | TCG 3 1 5 4 5 | TAG 0 0 0 0 0 | Trp TGG 1 1 1 1 1 ---------------------------------------------------------------------------------------------------------------------- Leu CTT 0 3 0 0 0 | Pro CCT 0 0 1 0 0 | His CAT 2 3 3 3 2 | Arg CGT 0 2 0 0 0 CTC 2 1 3 4 3 | CCC 6 5 4 4 4 | CAC 4 3 3 3 4 | CGC 2 1 2 2 2 CTA 1 3 2 1 2 | CCA 0 2 2 1 2 | Gln CAA 3 5 3 3 2 | CGA 2 1 2 3 2 CTG 10 6 7 6 9 | CCG 1 0 0 2 1 | CAG 8 6 8 8 9 | CGG 0 0 1 0 0 ---------------------------------------------------------------------------------------------------------------------- Ile ATT 9 14 8 8 8 | Thr ACT 3 4 4 3 1 | Asn AAT 5 7 8 7 3 | Ser AGT 2 2 2 2 2 ATC 4 2 6 8 6 | ACC 6 6 8 6 7 | AAC 7 4 4 5 9 | AGC 5 6 5 5 5 ATA 4 2 3 4 3 | ACA 3 3 2 2 2 | Lys AAA 2 4 3 4 2 | Arg AGA 0 0 0 0 0 Met ATG 7 7 8 7 8 | ACG 1 2 1 2 4 | AAG 11 9 10 9 11 | AGG 2 2 1 1 2 ---------------------------------------------------------------------------------------------------------------------- Val GTT 1 4 2 2 1 | Ala GCT 3 3 4 4 3 | Asp GAT 10 12 12 11 8 | Gly GGT 2 4 2 1 0 GTC 7 3 4 5 5 | GCC 13 12 13 14 13 | GAC 4 2 2 3 6 | GGC 8 7 6 7 12 GTA 0 3 0 1 1 | GCA 2 1 3 4 2 | Glu GAA 3 2 3 2 3 | GGA 6 9 10 8 6 GTG 11 7 11 8 10 | GCG 4 5 2 2 4 | GAG 13 14 13 14 13 | GGG 4 1 1 1 1 ---------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: D_melanogaster_RPA2-PB position 1: T:0.16803 C:0.16393 A:0.29508 G:0.37295 position 2: T:0.27459 C:0.25000 A:0.31967 G:0.15574 position 3: T:0.16803 C:0.39754 A:0.14754 G:0.28689 Average T:0.20355 C:0.27049 A:0.25410 G:0.27186 #2: D_sechellia_RPA2-PB position 1: T:0.16803 C:0.16803 A:0.29098 G:0.37295 position 2: T:0.27459 C:0.25000 A:0.31967 G:0.15574 position 3: T:0.16803 C:0.40574 A:0.14344 G:0.28279 Average T:0.20355 C:0.27459 A:0.25137 G:0.27049 #3: D_simulans_RPA2-PB position 1: T:0.16803 C:0.16393 A:0.29098 G:0.37705 position 2: T:0.27459 C:0.25000 A:0.31967 G:0.15574 position 3: T:0.17623 C:0.39754 A:0.14754 G:0.27869 Average T:0.20628 C:0.27049 A:0.25273 G:0.27049 #4: D_yakuba_RPA2-PB position 1: T:0.17623 C:0.15574 A:0.29918 G:0.36885 position 2: T:0.27459 C:0.25410 A:0.31557 G:0.15574 position 3: T:0.19672 C:0.37705 A:0.15574 G:0.27049 Average T:0.21585 C:0.26230 A:0.25683 G:0.26503 #5: D_erecta_RPA2-PB position 1: T:0.15984 C:0.16803 A:0.29918 G:0.37295 position 2: T:0.27049 C:0.25410 A:0.31967 G:0.15574 position 3: T:0.15984 C:0.42213 A:0.12295 G:0.29508 Average T:0.19672 C:0.28142 A:0.24727 G:0.27459 #6: D_biarmipes_RPA2-PB position 1: T:0.15574 C:0.17213 A:0.29918 G:0.37295 position 2: T:0.28279 C:0.23770 A:0.32787 G:0.15164 position 3: T:0.15574 C:0.40984 A:0.09426 G:0.34016 Average T:0.19809 C:0.27322 A:0.24044 G:0.28825 #7: D_suzukii_RPA2-PB position 1: T:0.16803 C:0.16803 A:0.29098 G:0.37295 position 2: T:0.27869 C:0.24180 A:0.32787 G:0.15164 position 3: T:0.20082 C:0.34836 A:0.12705 G:0.32377 Average T:0.21585 C:0.25273 A:0.24863 G:0.28279 #8: D_eugracilis_RPA2-PB position 1: T:0.16393 C:0.16803 A:0.30328 G:0.36475 position 2: T:0.27459 C:0.24180 A:0.32377 G:0.15984 position 3: T:0.29508 C:0.29098 A:0.15164 G:0.26230 Average T:0.24454 C:0.23361 A:0.25956 G:0.26230 #9: D_rhopaloa_RPA2-PB position 1: T:0.17213 C:0.16803 A:0.29918 G:0.36066 position 2: T:0.27459 C:0.25000 A:0.32787 G:0.14754 position 3: T:0.24180 C:0.31967 A:0.13934 G:0.29918 Average T:0.22951 C:0.24590 A:0.25546 G:0.26913 #10: D_elegans_RPA2-PB position 1: T:0.18033 C:0.16393 A:0.29918 G:0.35656 position 2: T:0.27869 C:0.25410 A:0.32787 G:0.13934 position 3: T:0.20492 C:0.36475 A:0.14344 G:0.28689 Average T:0.22131 C:0.26093 A:0.25683 G:0.26093 #11: D_takahashii_RPA2-PB position 1: T:0.16803 C:0.17213 A:0.29918 G:0.36066 position 2: T:0.27869 C:0.24590 A:0.32787 G:0.14754 position 3: T:0.14754 C:0.40574 A:0.11475 G:0.33197 Average T:0.19809 C:0.27459 A:0.24727 G:0.28005 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 33 | Ser S TCT 31 | Tyr Y TAT 31 | Cys C TGT 11 TTC 66 | TCC 95 | TAC 57 | TGC 22 Leu L TTA 1 | TCA 24 | *** * TAA 0 | *** * TGA 0 TTG 32 | TCG 37 | TAG 0 | Trp W TGG 11 ------------------------------------------------------------------------------ Leu L CTT 4 | Pro P CCT 3 | His H CAT 20 | Arg R CGT 3 CTC 24 | CCC 57 | CAC 46 | CGC 21 CTA 18 | CCA 10 | Gln Q CAA 35 | CGA 14 CTG 96 | CCG 8 | CAG 81 | CGG 7 ------------------------------------------------------------------------------ Ile I ATT 87 | Thr T ACT 26 | Asn N AAT 58 | Ser S AGT 20 ATC 69 | ACC 78 | AAC 67 | AGC 63 ATA 38 | ACA 27 | Lys K AAA 32 | Arg R AGA 3 Met M ATG 80 | ACG 19 | AAG 112 | AGG 18 ------------------------------------------------------------------------------ Val V GTT 28 | Ala A GCT 43 | Asp D GAT 96 | Gly G GGT 22 GTC 54 | GCC 144 | GAC 55 | GGC 92 GTA 12 | GCA 32 | Glu E GAA 33 | GGA 84 GTG 99 | GCG 32 | GAG 145 | GGG 18 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.16803 C:0.16654 A:0.29694 G:0.36848 position 2: T:0.27608 C:0.24814 A:0.32340 G:0.15238 position 3: T:0.19225 C:0.37630 A:0.13525 G:0.29620 Average T:0.21212 C:0.26366 A:0.25186 G:0.27235 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_RPA2-PB D_sechellia_RPA2-PB 0.0633 (0.0054 0.0852) D_simulans_RPA2-PB 0.0273 (0.0036 0.1318) 0.0434 (0.0018 0.0414) D_yakuba_RPA2-PB 0.0767 (0.0190 0.2480) 0.0809 (0.0227 0.2806) 0.0644 (0.0209 0.3237) D_erecta_RPA2-PB 0.0514 (0.0099 0.1927) 0.0565 (0.0117 0.2075) 0.0378 (0.0099 0.2626) 0.0922 (0.0218 0.2360) D_biarmipes_RPA2-PB 0.0497 (0.0274 0.5511) 0.0543 (0.0293 0.5384) 0.0477 (0.0274 0.5744) 0.0673 (0.0443 0.6580) 0.0606 (0.0349 0.5754) D_suzukii_RPA2-PB 0.0317 (0.0200 0.6298) 0.0276 (0.0181 0.6559) 0.0233 (0.0163 0.6982) 0.0449 (0.0367 0.8161) 0.0414 (0.0255 0.6166) 0.0324 (0.0108 0.3342) D_eugracilis_RPA2-PB 0.0346 (0.0255 0.7362) 0.0349 (0.0273 0.7827) 0.0312 (0.0255 0.8160) 0.0453 (0.0394 0.8692) 0.0364 (0.0301 0.8265) 0.0434 (0.0283 0.6518) 0.0265 (0.0199 0.7513) D_rhopaloa_RPA2-PB 0.0640 (0.0423 0.6615) 0.0599 (0.0404 0.6745) 0.0526 (0.0385 0.7332) 0.0614 (0.0530 0.8642) 0.0527 (0.0398 0.7556) 0.0559 (0.0351 0.6281) 0.0441 (0.0239 0.5429) 0.0495 (0.0350 0.7080) D_elegans_RPA2-PB 0.0642 (0.0413 0.6436) 0.0641 (0.0395 0.6158) 0.0538 (0.0376 0.6990) 0.0681 (0.0517 0.7596) 0.0544 (0.0385 0.7078) 0.0595 (0.0357 0.6002) 0.0355 (0.0236 0.6640) 0.0434 (0.0310 0.7138) 0.0365 (0.0108 0.2959) D_takahashii_RPA2-PB 0.0586 (0.0273 0.4659) 0.0601 (0.0273 0.4546) 0.0512 (0.0255 0.4981) 0.0547 (0.0338 0.6184) 0.0583 (0.0301 0.5160) 0.0685 (0.0246 0.3589) 0.0401 (0.0172 0.4289) 0.0319 (0.0217 0.6813) 0.0515 (0.0304 0.5898) 0.0415 (0.0263 0.6340) Model 0: one-ratio TREE # 1: (1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356 lnL(ntime: 19 np: 21): -2640.459092 +0.000000 12..1 12..13 13..2 13..3 12..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..7 17..11 16..19 19..8 19..20 20..9 20..10 0.026019 0.045105 0.004417 0.029945 0.029542 0.025425 0.148980 0.086420 0.203904 0.043226 0.067776 0.140349 0.126994 0.156812 0.035084 0.280186 0.165793 0.109110 0.125448 1.902702 0.047733 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.85053 (1: 0.026019, (2: 0.004417, 3: 0.029945): 0.045105, ((4: 0.148980, 5: 0.086420): 0.025425, (((6: 0.140349, 7: 0.126994): 0.067776, 11: 0.156812): 0.043226, (8: 0.280186, (9: 0.109110, 10: 0.125448): 0.165793): 0.035084): 0.203904): 0.029542); (D_melanogaster_RPA2-PB: 0.026019, (D_sechellia_RPA2-PB: 0.004417, D_simulans_RPA2-PB: 0.029945): 0.045105, ((D_yakuba_RPA2-PB: 0.148980, D_erecta_RPA2-PB: 0.086420): 0.025425, (((D_biarmipes_RPA2-PB: 0.140349, D_suzukii_RPA2-PB: 0.126994): 0.067776, D_takahashii_RPA2-PB: 0.156812): 0.043226, (D_eugracilis_RPA2-PB: 0.280186, (D_rhopaloa_RPA2-PB: 0.109110, D_elegans_RPA2-PB: 0.125448): 0.165793): 0.035084): 0.203904): 0.029542); Detailed output identifying parameters kappa (ts/tv) = 1.90270 omega (dN/dS) = 0.04773 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 12..1 0.026 561.4 170.6 0.0477 0.0015 0.0322 0.9 5.5 12..13 0.045 561.4 170.6 0.0477 0.0027 0.0557 1.5 9.5 13..2 0.004 561.4 170.6 0.0477 0.0003 0.0055 0.1 0.9 13..3 0.030 561.4 170.6 0.0477 0.0018 0.0370 1.0 6.3 12..14 0.030 561.4 170.6 0.0477 0.0017 0.0365 1.0 6.2 14..15 0.025 561.4 170.6 0.0477 0.0015 0.0314 0.8 5.4 15..4 0.149 561.4 170.6 0.0477 0.0088 0.1841 4.9 31.4 15..5 0.086 561.4 170.6 0.0477 0.0051 0.1068 2.9 18.2 14..16 0.204 561.4 170.6 0.0477 0.0120 0.2520 6.8 43.0 16..17 0.043 561.4 170.6 0.0477 0.0026 0.0534 1.4 9.1 17..18 0.068 561.4 170.6 0.0477 0.0040 0.0838 2.2 14.3 18..6 0.140 561.4 170.6 0.0477 0.0083 0.1735 4.6 29.6 18..7 0.127 561.4 170.6 0.0477 0.0075 0.1570 4.2 26.8 17..11 0.157 561.4 170.6 0.0477 0.0093 0.1938 5.2 33.1 16..19 0.035 561.4 170.6 0.0477 0.0021 0.0434 1.2 7.4 19..8 0.280 561.4 170.6 0.0477 0.0165 0.3463 9.3 59.1 19..20 0.166 561.4 170.6 0.0477 0.0098 0.2049 5.5 35.0 20..9 0.109 561.4 170.6 0.0477 0.0064 0.1348 3.6 23.0 20..10 0.125 561.4 170.6 0.0477 0.0074 0.1550 4.2 26.5 tree length for dN: 0.1092 tree length for dS: 2.2871 Time used: 0:13 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356 check convergence.. lnL(ntime: 19 np: 22): -2625.435695 +0.000000 12..1 12..13 13..2 13..3 12..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..7 17..11 16..19 19..8 19..20 20..9 20..10 0.027399 0.044871 0.004478 0.030370 0.028495 0.027897 0.152839 0.087461 0.211751 0.045860 0.064143 0.144019 0.129677 0.160089 0.038768 0.293699 0.162046 0.112772 0.128823 1.970157 0.951225 0.027909 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.89546 (1: 0.027399, (2: 0.004478, 3: 0.030370): 0.044871, ((4: 0.152839, 5: 0.087461): 0.027897, (((6: 0.144019, 7: 0.129677): 0.064143, 11: 0.160089): 0.045860, (8: 0.293699, (9: 0.112772, 10: 0.128823): 0.162046): 0.038768): 0.211751): 0.028495); (D_melanogaster_RPA2-PB: 0.027399, (D_sechellia_RPA2-PB: 0.004478, D_simulans_RPA2-PB: 0.030370): 0.044871, ((D_yakuba_RPA2-PB: 0.152839, D_erecta_RPA2-PB: 0.087461): 0.027897, (((D_biarmipes_RPA2-PB: 0.144019, D_suzukii_RPA2-PB: 0.129677): 0.064143, D_takahashii_RPA2-PB: 0.160089): 0.045860, (D_eugracilis_RPA2-PB: 0.293699, (D_rhopaloa_RPA2-PB: 0.112772, D_elegans_RPA2-PB: 0.128823): 0.162046): 0.038768): 0.211751): 0.028495); Detailed output identifying parameters kappa (ts/tv) = 1.97016 dN/dS (w) for site classes (K=2) p: 0.95122 0.04878 w: 0.02791 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 12..1 0.027 560.6 171.4 0.0753 0.0024 0.0313 1.3 5.4 12..13 0.045 560.6 171.4 0.0753 0.0039 0.0512 2.2 8.8 13..2 0.004 560.6 171.4 0.0753 0.0004 0.0051 0.2 0.9 13..3 0.030 560.6 171.4 0.0753 0.0026 0.0347 1.5 5.9 12..14 0.028 560.6 171.4 0.0753 0.0025 0.0325 1.4 5.6 14..15 0.028 560.6 171.4 0.0753 0.0024 0.0319 1.3 5.5 15..4 0.153 560.6 171.4 0.0753 0.0131 0.1745 7.4 29.9 15..5 0.087 560.6 171.4 0.0753 0.0075 0.0999 4.2 17.1 14..16 0.212 560.6 171.4 0.0753 0.0182 0.2418 10.2 41.5 16..17 0.046 560.6 171.4 0.0753 0.0039 0.0524 2.2 9.0 17..18 0.064 560.6 171.4 0.0753 0.0055 0.0732 3.1 12.6 18..6 0.144 560.6 171.4 0.0753 0.0124 0.1645 6.9 28.2 18..7 0.130 560.6 171.4 0.0753 0.0112 0.1481 6.3 25.4 17..11 0.160 560.6 171.4 0.0753 0.0138 0.1828 7.7 31.3 16..19 0.039 560.6 171.4 0.0753 0.0033 0.0443 1.9 7.6 19..8 0.294 560.6 171.4 0.0753 0.0253 0.3354 14.2 57.5 19..20 0.162 560.6 171.4 0.0753 0.0139 0.1851 7.8 31.7 20..9 0.113 560.6 171.4 0.0753 0.0097 0.1288 5.4 22.1 20..10 0.129 560.6 171.4 0.0753 0.0111 0.1471 6.2 25.2 Time used: 0:54 Model 2: PositiveSelection (3 categories) TREE # 1: (1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356 lnL(ntime: 19 np: 24): -2625.435695 +0.000000 12..1 12..13 13..2 13..3 12..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..7 17..11 16..19 19..8 19..20 20..9 20..10 0.027399 0.044871 0.004478 0.030370 0.028495 0.027897 0.152839 0.087461 0.211751 0.045860 0.064143 0.144019 0.129677 0.160089 0.038768 0.293699 0.162046 0.112772 0.128823 1.970157 0.951225 0.048775 0.027909 135.778812 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.89546 (1: 0.027399, (2: 0.004478, 3: 0.030370): 0.044871, ((4: 0.152839, 5: 0.087461): 0.027897, (((6: 0.144019, 7: 0.129677): 0.064143, 11: 0.160089): 0.045860, (8: 0.293699, (9: 0.112772, 10: 0.128823): 0.162046): 0.038768): 0.211751): 0.028495); (D_melanogaster_RPA2-PB: 0.027399, (D_sechellia_RPA2-PB: 0.004478, D_simulans_RPA2-PB: 0.030370): 0.044871, ((D_yakuba_RPA2-PB: 0.152839, D_erecta_RPA2-PB: 0.087461): 0.027897, (((D_biarmipes_RPA2-PB: 0.144019, D_suzukii_RPA2-PB: 0.129677): 0.064143, D_takahashii_RPA2-PB: 0.160089): 0.045860, (D_eugracilis_RPA2-PB: 0.293699, (D_rhopaloa_RPA2-PB: 0.112772, D_elegans_RPA2-PB: 0.128823): 0.162046): 0.038768): 0.211751): 0.028495); Detailed output identifying parameters kappa (ts/tv) = 1.97016 dN/dS (w) for site classes (K=3) p: 0.95122 0.04878 0.00000 w: 0.02791 1.00000 135.77881 (note that p[2] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 12..1 0.027 560.6 171.4 0.0753 0.0024 0.0313 1.3 5.4 12..13 0.045 560.6 171.4 0.0753 0.0039 0.0512 2.2 8.8 13..2 0.004 560.6 171.4 0.0753 0.0004 0.0051 0.2 0.9 13..3 0.030 560.6 171.4 0.0753 0.0026 0.0347 1.5 5.9 12..14 0.028 560.6 171.4 0.0753 0.0025 0.0325 1.4 5.6 14..15 0.028 560.6 171.4 0.0753 0.0024 0.0319 1.3 5.5 15..4 0.153 560.6 171.4 0.0753 0.0131 0.1745 7.4 29.9 15..5 0.087 560.6 171.4 0.0753 0.0075 0.0999 4.2 17.1 14..16 0.212 560.6 171.4 0.0753 0.0182 0.2418 10.2 41.5 16..17 0.046 560.6 171.4 0.0753 0.0039 0.0524 2.2 9.0 17..18 0.064 560.6 171.4 0.0753 0.0055 0.0732 3.1 12.6 18..6 0.144 560.6 171.4 0.0753 0.0124 0.1645 6.9 28.2 18..7 0.130 560.6 171.4 0.0753 0.0112 0.1481 6.3 25.4 17..11 0.160 560.6 171.4 0.0753 0.0138 0.1828 7.7 31.3 16..19 0.039 560.6 171.4 0.0753 0.0033 0.0443 1.9 7.6 19..8 0.294 560.6 171.4 0.0753 0.0253 0.3354 14.2 57.5 19..20 0.162 560.6 171.4 0.0753 0.0139 0.1851 7.8 31.7 20..9 0.113 560.6 171.4 0.0753 0.0097 0.1288 5.4 22.1 20..10 0.129 560.6 171.4 0.0753 0.0111 0.1471 6.2 25.2 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_RPA2-PB) Pr(w>1) post mean +- SE for w 16 T 0.588 1.433 +- 0.677 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.769 0.081 0.033 0.022 0.018 0.016 0.016 0.015 0.015 0.015 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 sum of density on p0-p1 = 1.000000 Time used: 3:18 Model 3: discrete (3 categories) TREE # 1: (1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356 lnL(ntime: 19 np: 25): -2616.379039 +0.000000 12..1 12..13 13..2 13..3 12..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..7 17..11 16..19 19..8 19..20 20..9 20..10 0.027375 0.045032 0.004443 0.030547 0.029001 0.027395 0.152833 0.086892 0.209243 0.044447 0.067453 0.143634 0.128910 0.160273 0.035977 0.288431 0.166971 0.110988 0.127916 1.881034 0.757508 0.236748 0.000001 0.200426 1.369527 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.88776 (1: 0.027375, (2: 0.004443, 3: 0.030547): 0.045032, ((4: 0.152833, 5: 0.086892): 0.027395, (((6: 0.143634, 7: 0.128910): 0.067453, 11: 0.160273): 0.044447, (8: 0.288431, (9: 0.110988, 10: 0.127916): 0.166971): 0.035977): 0.209243): 0.029001); (D_melanogaster_RPA2-PB: 0.027375, (D_sechellia_RPA2-PB: 0.004443, D_simulans_RPA2-PB: 0.030547): 0.045032, ((D_yakuba_RPA2-PB: 0.152833, D_erecta_RPA2-PB: 0.086892): 0.027395, (((D_biarmipes_RPA2-PB: 0.143634, D_suzukii_RPA2-PB: 0.128910): 0.067453, D_takahashii_RPA2-PB: 0.160273): 0.044447, (D_eugracilis_RPA2-PB: 0.288431, (D_rhopaloa_RPA2-PB: 0.110988, D_elegans_RPA2-PB: 0.127916): 0.166971): 0.035977): 0.209243): 0.029001); Detailed output identifying parameters kappa (ts/tv) = 1.88103 dN/dS (w) for site classes (K=3) p: 0.75751 0.23675 0.00574 w: 0.00000 0.20043 1.36953 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 12..1 0.027 561.6 170.4 0.0553 0.0018 0.0332 1.0 5.6 12..13 0.045 561.6 170.4 0.0553 0.0030 0.0545 1.7 9.3 13..2 0.004 561.6 170.4 0.0553 0.0003 0.0054 0.2 0.9 13..3 0.031 561.6 170.4 0.0553 0.0020 0.0370 1.1 6.3 12..14 0.029 561.6 170.4 0.0553 0.0019 0.0351 1.1 6.0 14..15 0.027 561.6 170.4 0.0553 0.0018 0.0332 1.0 5.7 15..4 0.153 561.6 170.4 0.0553 0.0102 0.1851 5.8 31.5 15..5 0.087 561.6 170.4 0.0553 0.0058 0.1053 3.3 17.9 14..16 0.209 561.6 170.4 0.0553 0.0140 0.2535 7.9 43.2 16..17 0.044 561.6 170.4 0.0553 0.0030 0.0538 1.7 9.2 17..18 0.067 561.6 170.4 0.0553 0.0045 0.0817 2.5 13.9 18..6 0.144 561.6 170.4 0.0553 0.0096 0.1740 5.4 29.6 18..7 0.129 561.6 170.4 0.0553 0.0086 0.1562 4.9 26.6 17..11 0.160 561.6 170.4 0.0553 0.0107 0.1941 6.0 33.1 16..19 0.036 561.6 170.4 0.0553 0.0024 0.0436 1.4 7.4 19..8 0.288 561.6 170.4 0.0553 0.0193 0.3494 10.9 59.5 19..20 0.167 561.6 170.4 0.0553 0.0112 0.2023 6.3 34.5 20..9 0.111 561.6 170.4 0.0553 0.0074 0.1344 4.2 22.9 20..10 0.128 561.6 170.4 0.0553 0.0086 0.1549 4.8 26.4 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_RPA2-PB) Pr(w>1) post mean +- SE for w 16 T 0.917 1.272 Time used: 5:56 Model 7: beta (10 categories) TREE # 1: (1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356 check convergence.. lnL(ntime: 19 np: 22): -2617.179514 +0.000000 12..1 12..13 13..2 13..3 12..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..7 17..11 16..19 19..8 19..20 20..9 20..10 0.026793 0.045430 0.004436 0.030436 0.028586 0.027464 0.151716 0.087338 0.209091 0.044644 0.066217 0.143044 0.129468 0.160237 0.036035 0.287795 0.167468 0.110889 0.127566 1.892537 0.120782 1.874184 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.88465 (1: 0.026793, (2: 0.004436, 3: 0.030436): 0.045430, ((4: 0.151716, 5: 0.087338): 0.027464, (((6: 0.143044, 7: 0.129468): 0.066217, 11: 0.160237): 0.044644, (8: 0.287795, (9: 0.110889, 10: 0.127566): 0.167468): 0.036035): 0.209091): 0.028586); (D_melanogaster_RPA2-PB: 0.026793, (D_sechellia_RPA2-PB: 0.004436, D_simulans_RPA2-PB: 0.030436): 0.045430, ((D_yakuba_RPA2-PB: 0.151716, D_erecta_RPA2-PB: 0.087338): 0.027464, (((D_biarmipes_RPA2-PB: 0.143044, D_suzukii_RPA2-PB: 0.129468): 0.066217, D_takahashii_RPA2-PB: 0.160237): 0.044644, (D_eugracilis_RPA2-PB: 0.287795, (D_rhopaloa_RPA2-PB: 0.110889, D_elegans_RPA2-PB: 0.127566): 0.167468): 0.036035): 0.209091): 0.028586); Detailed output identifying parameters kappa (ts/tv) = 1.89254 Parameters in M7 (beta): p = 0.12078 q = 1.87418 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00007 0.00057 0.00300 0.01204 0.04023 0.12087 0.37252 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 12..1 0.027 561.5 170.5 0.0549 0.0018 0.0325 1.0 5.5 12..13 0.045 561.5 170.5 0.0549 0.0030 0.0551 1.7 9.4 13..2 0.004 561.5 170.5 0.0549 0.0003 0.0054 0.2 0.9 13..3 0.030 561.5 170.5 0.0549 0.0020 0.0369 1.1 6.3 12..14 0.029 561.5 170.5 0.0549 0.0019 0.0346 1.1 5.9 14..15 0.027 561.5 170.5 0.0549 0.0018 0.0333 1.0 5.7 15..4 0.152 561.5 170.5 0.0549 0.0101 0.1839 5.7 31.3 15..5 0.087 561.5 170.5 0.0549 0.0058 0.1058 3.3 18.0 14..16 0.209 561.5 170.5 0.0549 0.0139 0.2534 7.8 43.2 16..17 0.045 561.5 170.5 0.0549 0.0030 0.0541 1.7 9.2 17..18 0.066 561.5 170.5 0.0549 0.0044 0.0802 2.5 13.7 18..6 0.143 561.5 170.5 0.0549 0.0095 0.1733 5.3 29.6 18..7 0.129 561.5 170.5 0.0549 0.0086 0.1569 4.8 26.8 17..11 0.160 561.5 170.5 0.0549 0.0107 0.1942 6.0 33.1 16..19 0.036 561.5 170.5 0.0549 0.0024 0.0437 1.3 7.4 19..8 0.288 561.5 170.5 0.0549 0.0192 0.3488 10.8 59.5 19..20 0.167 561.5 170.5 0.0549 0.0111 0.2029 6.3 34.6 20..9 0.111 561.5 170.5 0.0549 0.0074 0.1344 4.1 22.9 20..10 0.128 561.5 170.5 0.0549 0.0085 0.1546 4.8 26.4 Time used: 9:12 Model 8: beta&w>1 (11 categories) TREE # 1: (1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356 check convergence.. lnL(ntime: 19 np: 24): -2616.826104 +0.000000 12..1 12..13 13..2 13..3 12..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..7 17..11 16..19 19..8 19..20 20..9 20..10 0.027237 0.045002 0.004446 0.030442 0.028745 0.027516 0.152484 0.086898 0.209403 0.044544 0.066594 0.143534 0.129001 0.160267 0.036307 0.288506 0.166586 0.111051 0.127806 1.888808 0.995511 0.134717 2.329188 1.382117 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.88637 (1: 0.027237, (2: 0.004446, 3: 0.030442): 0.045002, ((4: 0.152484, 5: 0.086898): 0.027516, (((6: 0.143534, 7: 0.129001): 0.066594, 11: 0.160267): 0.044544, (8: 0.288506, (9: 0.111051, 10: 0.127806): 0.166586): 0.036307): 0.209403): 0.028745); (D_melanogaster_RPA2-PB: 0.027237, (D_sechellia_RPA2-PB: 0.004446, D_simulans_RPA2-PB: 0.030442): 0.045002, ((D_yakuba_RPA2-PB: 0.152484, D_erecta_RPA2-PB: 0.086898): 0.027516, (((D_biarmipes_RPA2-PB: 0.143534, D_suzukii_RPA2-PB: 0.129001): 0.066594, D_takahashii_RPA2-PB: 0.160267): 0.044544, (D_eugracilis_RPA2-PB: 0.288506, (D_rhopaloa_RPA2-PB: 0.111051, D_elegans_RPA2-PB: 0.127806): 0.166586): 0.036307): 0.209403): 0.028745); Detailed output identifying parameters kappa (ts/tv) = 1.88881 Parameters in M8 (beta&w>1): p0 = 0.99551 p = 0.13472 q = 2.32919 (p1 = 0.00449) w = 1.38212 dN/dS (w) for site classes (K=11) p: 0.09955 0.09955 0.09955 0.09955 0.09955 0.09955 0.09955 0.09955 0.09955 0.09955 0.00449 w: 0.00000 0.00000 0.00001 0.00013 0.00087 0.00386 0.01349 0.04026 0.11071 0.32393 1.38212 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 12..1 0.027 561.5 170.5 0.0553 0.0018 0.0330 1.0 5.6 12..13 0.045 561.5 170.5 0.0553 0.0030 0.0545 1.7 9.3 13..2 0.004 561.5 170.5 0.0553 0.0003 0.0054 0.2 0.9 13..3 0.030 561.5 170.5 0.0553 0.0020 0.0369 1.1 6.3 12..14 0.029 561.5 170.5 0.0553 0.0019 0.0348 1.1 5.9 14..15 0.028 561.5 170.5 0.0553 0.0018 0.0333 1.0 5.7 15..4 0.152 561.5 170.5 0.0553 0.0102 0.1846 5.7 31.5 15..5 0.087 561.5 170.5 0.0553 0.0058 0.1052 3.3 17.9 14..16 0.209 561.5 170.5 0.0553 0.0140 0.2535 7.9 43.2 16..17 0.045 561.5 170.5 0.0553 0.0030 0.0539 1.7 9.2 17..18 0.067 561.5 170.5 0.0553 0.0045 0.0806 2.5 13.7 18..6 0.144 561.5 170.5 0.0553 0.0096 0.1738 5.4 29.6 18..7 0.129 561.5 170.5 0.0553 0.0086 0.1562 4.9 26.6 17..11 0.160 561.5 170.5 0.0553 0.0107 0.1941 6.0 33.1 16..19 0.036 561.5 170.5 0.0553 0.0024 0.0440 1.4 7.5 19..8 0.289 561.5 170.5 0.0553 0.0193 0.3493 10.8 59.5 19..20 0.167 561.5 170.5 0.0553 0.0112 0.2017 6.3 34.4 20..9 0.111 561.5 170.5 0.0553 0.0074 0.1345 4.2 22.9 20..10 0.128 561.5 170.5 0.0553 0.0086 0.1547 4.8 26.4 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_RPA2-PB) Pr(w>1) post mean +- SE for w 16 T 0.732 1.098 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_RPA2-PB) Pr(w>1) post mean +- SE for w 16 T 0.836 1.601 +- 0.852 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.000 0.000 0.001 0.010 0.063 0.242 0.684 ws: 0.778 0.104 0.038 0.020 0.013 0.011 0.010 0.009 0.009 0.009 Time used: 14:12
Model 1: NearlyNeutral -2625.435695 Model 2: PositiveSelection -2625.435695 Model 0: one-ratio -2640.459092 Model 3: discrete -2616.379039 Model 7: beta -2617.179514 Model 8: beta&w>1 -2616.826104 Model 0 vs 1 30.046793999999863 Model 2 vs 1 0.0 Model 8 vs 7 0.7068199999994249