--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Mon Dec 05 15:43:53 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/367/Reph-PA/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3791.39 -3806.54 2 -3791.75 -3806.00 -------------------------------------- TOTAL -3791.55 -3806.31 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.818261 0.005606 0.682099 0.973720 0.814690 1156.42 1264.12 1.000 r(A<->C){all} 0.112024 0.000315 0.078845 0.148238 0.111219 974.19 1082.30 1.001 r(A<->G){all} 0.194985 0.000641 0.147241 0.245500 0.194076 880.32 947.91 1.000 r(A<->T){all} 0.087840 0.000487 0.047650 0.130732 0.087114 1014.47 1023.26 1.001 r(C<->G){all} 0.074378 0.000209 0.047224 0.103341 0.073563 1009.64 1113.78 1.000 r(C<->T){all} 0.419273 0.001338 0.351006 0.494734 0.418343 792.34 969.14 1.000 r(G<->T){all} 0.111498 0.000526 0.067259 0.155817 0.109902 962.29 969.03 1.000 pi(A){all} 0.237498 0.000134 0.216282 0.261418 0.237468 881.48 1029.53 1.000 pi(C){all} 0.303736 0.000155 0.279112 0.327142 0.303797 694.05 765.33 1.000 pi(G){all} 0.290525 0.000161 0.265042 0.313314 0.290546 1017.49 1023.65 1.000 pi(T){all} 0.168241 0.000100 0.148884 0.187509 0.168005 961.69 1096.85 1.000 alpha{1,2} 0.259575 0.002964 0.158873 0.362656 0.253171 929.54 1049.12 1.000 alpha{3} 1.656767 0.372235 0.687642 2.916412 1.551977 1214.23 1241.71 1.000 pinvar{all} 0.415405 0.004302 0.285353 0.533822 0.423057 949.05 1005.51 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2803.552013 Model 2: PositiveSelection -2798.277173 Model 0: one-ratio -2883.084352 Model 3: discrete -2797.804133 Model 7: beta -2803.569758 Model 8: beta&w>1 -2797.774649 Model 0 vs 1 159.06467799999973 Model 2 vs 1 10.54968000000008 Additional information for M1 vs M2: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reph-PA) Pr(w>1) post mean +- SE for w 189 T 0.615 4.341 191 A 0.995** 6.407 192 A 0.866 5.706 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reph-PA) Pr(w>1) post mean +- SE for w 10 P 0.712 2.514 +- 1.458 189 T 0.884 3.113 +- 1.722 190 V 0.597 2.181 +- 1.319 191 A 0.990** 3.405 +- 1.706 192 A 0.941 3.298 +- 1.744 194 G 0.558 2.050 +- 1.244 278 T 0.513 1.926 +- 1.114 282 T 0.603 2.165 +- 1.254 288 A 0.525 1.944 +- 1.104 Model 8 vs 7 11.590218000000277 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reph-PA) Pr(w>1) post mean +- SE for w 189 T 0.700 4.152 191 A 0.996** 5.484 192 A 0.896 5.032 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reph-PA) Pr(w>1) post mean +- SE for w 10 P 0.917 2.470 +- 0.751 13 S 0.512 1.539 +- 1.125 180 N 0.759 2.115 +- 0.928 189 T 0.981* 2.599 +- 0.587 190 V 0.854 2.333 +- 0.863 191 A 0.999** 2.631 +- 0.535 192 A 0.991** 2.617 +- 0.560 194 G 0.787 2.177 +- 0.984 275 S 0.536 1.626 +- 1.060 276 G 0.574 1.686 +- 1.129 278 T 0.799 2.209 +- 0.930 281 P 0.655 1.874 +- 1.102 282 T 0.865 2.356 +- 0.843 283 T 0.537 1.597 +- 1.129 288 A 0.815 2.243 +- 0.908
>C1 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQAG QHPGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTLMVE NRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRSTTP LILSEARCGIENIKLCDNSVNEENGDNGGGGGAANSSKCAKIGALAGNAS GTVAATGNGNGGNENEPSVIKACSSSLKMSNSSHHIYQPQPKYSFHYNSS RSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNASGAAGGATTISP SSASSSSGTTTTHNAANSAGNAANVTAVATQRLQRPHRPCLDFDKMQQVS Loooooo >C2 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQAG QHPGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTLMVE NRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRSTTP LILSEARCGIENIKLCDNSVNEENGDNGGGGGVANSSKCAKIGAGNASGT GTATGNGNGGNENEPSVIKACSSSLKMSNSSHHIYQPQPKYSFHYNSSRS SPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNASGAAGGATTISPSS ASSSSATTTTHNAANSAGNAANVTAVATQRLQRPHRPCLDFDKMQQVSLo ooooooo >C3 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQAG QHPGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTLMVE NRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRSTTP LILSEARCGIENIKLCDNSVNEENGDNGGGGGVANSSKCAKIGAGNASGT GTATGNGNGGNENEPSVIKACSSSLKMSNSSHHIYQPQPKYSFHYNSSRS SPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNASGAAGGATTISPSS ASSSSATTTTHNAANSAGNAANVTAVATQRLQRPHRPCLDFDKMQQVSLo ooooooo >C4 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQAG QHPGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTLMVE NRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRSTTP LILSEARCGIENIKLCDNSVNEENGDNGGGVGGGGGVANSSKCAKIGEGN ASGTGVATGNGNGNGGNENEPSVIKACSSSLKMSNSSHHIYQPQPKYSFH YNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNASGTAISPS SATSSSAATATTTTHNAANSNSAGNAANVTAVATQRLQRPHRPCLDFDKM QQVSLoo >C5 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQAG QHPGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTLMVE NRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRSTTP LILSEARCGIENIKLCDNSVNEENGDNGGGVGGGGVANSSKCAKIGAGIA SGTGAATGNGNGGNENEPSVIKACSSSLKMSNSSHHIYQPQPKYSFHYNS SRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAGGGNAGGATTI SPSSASSSSATTTTHNAANSNSAGNAANVTAVATQRLQRPHRPCLDFDKM QQVSLoo >C6 METSVAGQKKISPEMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQAG QHPGGTAATGSTCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTLMV ENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRSTT PLILSEARCGIENIKLCDNSVNEENGDNGGGGSSKCAKIGGGTITGTGNG GNENEPSVIKACSSSLKMSNSSHHIYQPQPKYSFHYNSSRSSPASTTGLD MEVRSVSPPAKLFHCAISPRRRPSNNATTISPPSSAATSSATTTTTQNAA NSAGSAGNPGNAANVTAVATQRLQRPHRPCLDFDKMQQVSLooooooooo ooooooo >C7 METSVAGQKPIAPEMMCHQQTSSCAHLMYDQHSSEEELEVINGPSSQAGQ HSGGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTLMVE NRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRSTTP LILSEARCGIENIKLCDNSVNEENGDNGGGGGGGGNGGKCAKIGAATGTG TGNGGNENEPSVIKACSSSLKMSNSSHHIYQPQPKYSFHYNSSRSSPAST TGLDMEVRSVSPPAKLFHCAISPRRRPSSNATTTSPPSSASASASASAAA TATTTTHNAANVTAVATQRLQRPHRPCLDFDKMQQVSLoooooooooooo ooooooo >C8 METSVAGQKPIAPEMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQAG QHPGGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTLMV ENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRSTT PLILSEARCGIENIKLCDNSVNEENGDNGGGGNGSKCAKIGVAGATGTGN GGNENEPSVIKACSSSLKMSNSSHHIYQPQPKYSFHYNSSRSSPASTTGL DMEVRSVSPPAKLFHCAISPRRRPSNNATTISPPSSASASASASASAAST TTTHNAANSAGNAANVTAVATQRLQRPHRPCLDFDKMQQVSLoooooooo ooooooo >C9 METSVAGQKPIAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQAG QHPGGPTATVSSCASRISNRVCTSSLDTEAPYEERATTSNSKRSSSTLMV ENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRSTT PLILSEARCGIENIKLCDNSVNEENGDNGGGGGCGGVANSSKCAKIGAGN NASGTGTGNGGNENEPSVIKACSSSLKMSNSSHHIYQPQPKYSFHYNSSR SSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNASGSAASATTISPS SSSAAAVSATTTHNSANSAGNAANVTAVATQRLQRPHRPCLDFDKMQQVS Loooooo >C10 METSVAGQKATAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQAG QHPGGTAAAGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTLMV ENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRSTT PLILSEARCGIENIKLCDNSVNEENGDNGGGGGSKCAKIGSAGAAGGATG AAGATGNGGNENEPSAIKACSSSLKMSNSSHHIYQPQPKYSFPYNSSRSS PASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAGGPPATISPSSTTHN AANSAGNAANVTAAATQRLQRPHRPCLDFDKMQQVSLooooooooooooo ooooooo >C11 METSVAGQKPIAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQAG QHPGGTTATGSSCVSRISNRGCTSSLDTEAPYEERATTSNSKRSSSTLMV ENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRSTT PLILSEARCGIENIKLCDNSVNEENGDNGGGGVAANSSKCAKIGAGNTIG TGTGTGNGNGANENEPSASVIKACSSSLKMSNSSHHIYQPQPKYSFHYNS SRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNASGQPGGGATTI SPSSSSSSATTTTHNAANSAGNAANVTAAATQRLQRPHRPCLDFDKMQQV SLooooo >C12 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQGG HGQHPGGTTATGSSCVSRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGVAANSSKCAKIGAANAGG ATSGGNENEPNASASVIKACSSSLKMSNSSHHIYQPQPKYSFHYNSSRSS PASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNASGPSVGATTISPSSS SSLASSSATTTTHNAANSGGNAVNAGNAANVTAAATQRLQRPHRPCLDFD KMQQVSL CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=99, Nseq=12, Len=392 C1 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- C2 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- C3 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- C4 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- C5 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- C6 METSVAGQKKISPEMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- C7 METSVAGQKPIAPEMMCHQQTSS-CAHLMYDQHSSEEELEVINGPSSQ-- C8 METSVAGQKPIAPEMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- C9 METSVAGQKPIAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- C10 METSVAGQKATAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- C11 METSVAGQKPIAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- C12 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQGG ********* :. ********* ************************ C1 AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL C2 AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL C3 AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL C4 AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL C5 AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL C6 AGQHPGGTAATGSTCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL C7 AGQHSGGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL C8 AGQHPGGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL C9 AGQHPGGPTATVSSCASRISNRVCTSSLDTEAPYEERATTSNSKRSSSTL C10 AGQHPGGTAAAGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL C11 AGQHPGGTTATGSSCVSRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL C12 HGQHPGGTTATGSSCVSRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL ***.* .:*: *:*.****** *************************** C1 MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS C2 MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS C3 MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS C4 MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS C5 MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS C6 MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS C7 MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS C8 MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS C9 MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS C10 MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS C11 MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS C12 MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS ************************************************** C1 TTPLILSEARCGIENIKLCDNSVNEENGDNGG----GGGAANSSKCAKIG C2 TTPLILSEARCGIENIKLCDNSVNEENGDNGG----GGGVANSSKCAKIG C3 TTPLILSEARCGIENIKLCDNSVNEENGDNGG----GGGVANSSKCAKIG C4 TTPLILSEARCGIENIKLCDNSVNEENGDNGGGVGGGGGVANSSKCAKIG C5 TTPLILSEARCGIENIKLCDNSVNEENGDNGGGVG-GGGVANSSKCAKIG C6 TTPLILSEARCGIENIKLCDNSVNEENGDNGG--------GGSSKCAKIG C7 TTPLILSEARCGIENIKLCDNSVNEENGDNGGG---GGGGGNGGKCAKIG C8 TTPLILSEARCGIENIKLCDNSVNEENGDNGG-------GGNGSKCAKIG C9 TTPLILSEARCGIENIKLCDNSVNEENGDNGGGGG-CGGVANSSKCAKIG C10 TTPLILSEARCGIENIKLCDNSVNEENGDNGG--------GGGSKCAKIG C11 TTPLILSEARCGIENIKLCDNSVNEENGDNGGG----GVAANSSKCAKIG C12 TTPLILSEARCGIENIKLCDNSVNEENGDNGG------VAANSSKCAKIG ******************************** ....****** C1 ALAGNASGTVAATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP C2 --AGNASGTGTATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP C3 --AGNASGTGTATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP C4 --EGNASGTGVATGNGNGNGGNENEP--SVIKACSSSLKMSNSSHHIYQP C5 --AGIASGTGAATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP C6 --------GGTITGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP C7 --------AATGTGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP C8 --------VAGATGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP C9 -----AGNNASGTGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP C10 SAGAAGGATGAAGATGNG--GNENEP--SAIKACSSSLKMSNSSHHIYQP C11 --AGNTIGTGTGTGNGNG--ANENEPSASVIKACSSSLKMSNSSHHIYQP C12 --AAN---AGGATSGGN---ENEPNASASVIKACSSSLKMSNSSHHIYQP . ** ** :. *.******************** C1 QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS C2 QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS C3 QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS C4 QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS C5 QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAG C6 QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAT C7 QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSSNAT C8 QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAT C9 QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS C10 QPKYSFPYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAG C11 QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS C12 QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS ****** ***************************************.** C1 G-AAGGATTISPSSASSS---SGTTTTHNAAN------SAGNAANVTAVA C2 G-AAGGATTISPSSASSS---SATTTTHNAAN------SAGNAANVTAVA C3 G-AAGGATTISPSSASSS---SATTTTHNAAN------SAGNAANVTAVA C4 G------TAISPSSATSSSAATATTTTHNAANSN----SAGNAANVTAVA C5 GGNAGGATTISPSSASSS---SATTTTHNAANSN----SAGNAANVTAVA C6 TISPPSSAATSSATTTTT---QNAANSAGSAGN------PGNAANVTAVA C7 TTSPPSSASASASASAAA---TATTTTHNAAN-------------VTAVA C8 TISPPSSASASASASASA---ASTTTTHNAANS------AGNAANVTAVA C9 G-SAASATTISPSSSSAA--AVSATTTHNSAN------SAGNAANVTAVA C10 G----PPATISP-----------SSTTHNAANS------AGNAANVTAAA C11 GQPGGGATTISPSSSS----SSATTTTHNAANS------AGNAANVTAAA C12 G-PSVGATTISPSSSSSLASSSATTTTHNAANSGGNAVNAGNAANVTAAA :: *. ::.: .:*. ***.* C1 TQRLQRPHRPCLDFDKMQQVSLoooooo-------------- C2 TQRLQRPHRPCLDFDKMQQVSLoooooooo------------ C3 TQRLQRPHRPCLDFDKMQQVSLoooooooo------------ C4 TQRLQRPHRPCLDFDKMQQVSLoo------------------ C5 TQRLQRPHRPCLDFDKMQQVSLoo------------------ C6 TQRLQRPHRPCLDFDKMQQVSLoooooooooooooooo---- C7 TQRLQRPHRPCLDFDKMQQVSLooooooooooooooooooo- C8 TQRLQRPHRPCLDFDKMQQVSLooooooooooooooo----- C9 TQRLQRPHRPCLDFDKMQQVSLoooooo-------------- C10 TQRLQRPHRPCLDFDKMQQVSLoooooooooooooooooooo C11 TQRLQRPHRPCLDFDKMQQVSLooooo--------------- C12 TQRLQRPHRPCLDFDKMQQVSL-------------------- ********************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [69200] Library Relaxation: Multi_proc [72] Relaxation Summary: [69200]--->[62467] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/367/Reph-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.748 Mb, Max= 32.369 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG----GGGAANSSKCAKIG ALAGNASGTVAATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS G-AAGGATTISPSSASSS---SGTTTTHNAAN------SAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSLoooooo-------------- >C2 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG----GGGVANSSKCAKIG --AGNASGTGTATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS G-AAGGATTISPSSASSS---SATTTTHNAAN------SAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSLoooooooo------------ >C3 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG----GGGVANSSKCAKIG --AGNASGTGTATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS G-AAGGATTISPSSASSS---SATTTTHNAAN------SAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSLoooooooo------------ >C4 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGGVGGGGGVANSSKCAKIG --EGNASGTGVATGNGNGNGGNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS G------TAISPSSATSSSAATATTTTHNAANSN----SAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSLoo------------------ >C5 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGGVG-GGGVANSSKCAKIG --AGIASGTGAATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAG GGNAGGATTISPSSASSS---SATTTTHNAANSN----SAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSLoo------------------ >C6 METSVAGQKKISPEMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPGGTAATGSTCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG--------GGSSKCAKIG --------GGTITGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAT TISPPSSAATSSATTTTT---QNAANSAGSAGN------PGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSLoooooooooooooooo---- >C7 METSVAGQKPIAPEMMCHQQTSS-CAHLMYDQHSSEEELEVINGPSSQ-- AGQHSGGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGG---GGGGGNGGKCAKIG --------AATGTGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSSNAT TTSPPSSASASASASAAA---TATTTTHNAAN-------------VTAVA TQRLQRPHRPCLDFDKMQQVSLooooooooooooooooooo- >C8 METSVAGQKPIAPEMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPGGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG-------GGNGSKCAKIG --------VAGATGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAT TISPPSSASASASASASA---ASTTTTHNAANS------AGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSLooooooooooooooo----- >C9 METSVAGQKPIAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPGGPTATVSSCASRISNRVCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGGGG-CGGVANSSKCAKIG -----AGNNASGTGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS G-SAASATTISPSSSSAA--AVSATTTHNSAN------SAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSLoooooo-------------- >C10 METSVAGQKATAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPGGTAAAGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG--------GGGSKCAKIG SAGAAGGATGAAGATGNG--GNENEP--SAIKACSSSLKMSNSSHHIYQP QPKYSFPYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAG G----PPATISP-----------SSTTHNAANS------AGNAANVTAAA TQRLQRPHRPCLDFDKMQQVSLoooooooooooooooooooo >C11 METSVAGQKPIAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPGGTTATGSSCVSRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGG----GVAANSSKCAKIG --AGNTIGTGTGTGNGNG--ANENEPSASVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS GQPGGGATTISPSSSS----SSATTTTHNAANS------AGNAANVTAAA TQRLQRPHRPCLDFDKMQQVSLooooo--------------- >C12 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQGG HGQHPGGTTATGSSCVSRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG------VAANSSKCAKIG --AAN---AGGATSGGN---ENEPNASASVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS G-PSVGATTISPSSSSSLASSSATTTTHNAANSGGNAVNAGNAANVTAAA TQRLQRPHRPCLDFDKMQQVSL-------------------- FORMAT of file /tmp/tmp5595213011445989828aln Not Supported[FATAL:T-COFFEE] >C1 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG----GGGAANSSKCAKIG ALAGNASGTVAATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS G-AAGGATTISPSSASSS---SGTTTTHNAAN------SAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSLoooooo-------------- >C2 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG----GGGVANSSKCAKIG --AGNASGTGTATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS G-AAGGATTISPSSASSS---SATTTTHNAAN------SAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSLoooooooo------------ >C3 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG----GGGVANSSKCAKIG --AGNASGTGTATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS G-AAGGATTISPSSASSS---SATTTTHNAAN------SAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSLoooooooo------------ >C4 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGGVGGGGGVANSSKCAKIG --EGNASGTGVATGNGNGNGGNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS G------TAISPSSATSSSAATATTTTHNAANSN----SAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSLoo------------------ >C5 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGGVG-GGGVANSSKCAKIG --AGIASGTGAATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAG GGNAGGATTISPSSASSS---SATTTTHNAANSN----SAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSLoo------------------ >C6 METSVAGQKKISPEMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPGGTAATGSTCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG--------GGSSKCAKIG --------GGTITGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAT TISPPSSAATSSATTTTT---QNAANSAGSAGN------PGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSLoooooooooooooooo---- >C7 METSVAGQKPIAPEMMCHQQTSS-CAHLMYDQHSSEEELEVINGPSSQ-- AGQHSGGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGG---GGGGGNGGKCAKIG --------AATGTGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSSNAT TTSPPSSASASASASAAA---TATTTTHNAAN-------------VTAVA TQRLQRPHRPCLDFDKMQQVSLooooooooooooooooooo- >C8 METSVAGQKPIAPEMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPGGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG-------GGNGSKCAKIG --------VAGATGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAT TISPPSSASASASASASA---ASTTTTHNAANS------AGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSLooooooooooooooo----- >C9 METSVAGQKPIAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPGGPTATVSSCASRISNRVCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGGGG-CGGVANSSKCAKIG -----AGNNASGTGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS G-SAASATTISPSSSSAA--AVSATTTHNSAN------SAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSLoooooo-------------- >C10 METSVAGQKATAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPGGTAAAGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG--------GGGSKCAKIG SAGAAGGATGAAGATGNG--GNENEP--SAIKACSSSLKMSNSSHHIYQP QPKYSFPYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAG G----PPATISP-----------SSTTHNAANS------AGNAANVTAAA TQRLQRPHRPCLDFDKMQQVSLoooooooooooooooooooo >C11 METSVAGQKPIAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPGGTTATGSSCVSRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGG----GVAANSSKCAKIG --AGNTIGTGTGTGNGNG--ANENEPSASVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS GQPGGGATTISPSSSS----SSATTTTHNAANS------AGNAANVTAAA TQRLQRPHRPCLDFDKMQQVSLooooo--------------- >C12 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQGG HGQHPGGTTATGSSCVSRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG------VAANSSKCAKIG --AAN---AGGATSGGN---ENEPNASASVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS G-PSVGATTISPSSSSSLASSSATTTTHNAANSGGNAVNAGNAANVTAAA TQRLQRPHRPCLDFDKMQQVSL-------------------- input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:392 S:90 BS:392 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # SEQ_INDEX C7 6 # SEQ_INDEX C8 7 # SEQ_INDEX C9 8 # SEQ_INDEX C10 9 # SEQ_INDEX C11 10 # SEQ_INDEX C12 11 # PW_SEQ_DISTANCES BOT 0 1 98.87 C1 C2 98.87 TOP 1 0 98.87 C2 C1 98.87 BOT 0 2 98.87 C1 C3 98.87 TOP 2 0 98.87 C3 C1 98.87 BOT 0 3 97.69 C1 C4 97.69 TOP 3 0 97.69 C4 C1 97.69 BOT 0 4 98.29 C1 C5 98.29 TOP 4 0 98.29 C5 C1 98.29 BOT 0 5 88.37 C1 C6 88.37 TOP 5 0 88.37 C6 C1 88.37 BOT 0 6 90.91 C1 C7 90.91 TOP 6 0 90.91 C7 C1 90.91 BOT 0 7 92.46 C1 C8 92.46 TOP 7 0 92.46 C8 C1 92.46 BOT 0 8 93.18 C1 C9 93.18 TOP 8 0 93.18 C9 C1 93.18 BOT 0 9 91.79 C1 C10 91.79 TOP 9 0 91.79 C10 C1 91.79 BOT 0 10 95.71 C1 C11 95.71 TOP 10 0 95.71 C11 C1 95.71 BOT 0 11 93.59 C1 C12 93.59 TOP 11 0 93.59 C12 C1 93.59 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 98.55 C2 C4 98.55 TOP 3 1 98.55 C4 C2 98.55 BOT 1 4 98.86 C2 C5 98.86 TOP 4 1 98.86 C5 C2 98.86 BOT 1 5 89.02 C2 C6 89.02 TOP 5 1 89.02 C6 C2 89.02 BOT 1 6 91.55 C2 C7 91.55 TOP 6 1 91.55 C7 C2 91.55 BOT 1 7 92.51 C2 C8 92.51 TOP 7 1 92.51 C8 C2 92.51 BOT 1 8 93.47 C2 C9 93.47 TOP 8 1 93.47 C9 C2 93.47 BOT 1 9 92.38 C2 C10 92.38 TOP 9 1 92.38 C10 C2 92.38 BOT 1 10 96.29 C2 C11 96.29 TOP 10 1 96.29 C11 C2 96.29 BOT 1 11 93.88 C2 C12 93.88 TOP 11 1 93.88 C12 C2 93.88 BOT 2 3 98.55 C3 C4 98.55 TOP 3 2 98.55 C4 C3 98.55 BOT 2 4 98.86 C3 C5 98.86 TOP 4 2 98.86 C5 C3 98.86 BOT 2 5 89.02 C3 C6 89.02 TOP 5 2 89.02 C6 C3 89.02 BOT 2 6 91.55 C3 C7 91.55 TOP 6 2 91.55 C7 C3 91.55 BOT 2 7 92.51 C3 C8 92.51 TOP 7 2 92.51 C8 C3 92.51 BOT 2 8 93.47 C3 C9 93.47 TOP 8 2 93.47 C9 C3 93.47 BOT 2 9 92.38 C3 C10 92.38 TOP 9 2 92.38 C10 C3 92.38 BOT 2 10 96.29 C3 C11 96.29 TOP 10 2 96.29 C11 C3 96.29 BOT 2 11 93.88 C3 C12 93.88 TOP 11 2 93.88 C12 C3 93.88 BOT 3 4 98.01 C4 C5 98.01 TOP 4 3 98.01 C5 C4 98.01 BOT 3 5 90.18 C4 C6 90.18 TOP 5 3 90.18 C6 C4 90.18 BOT 3 6 92.79 C4 C7 92.79 TOP 6 3 92.79 C7 C4 92.79 BOT 3 7 93.77 C4 C8 93.77 TOP 7 3 93.77 C8 C4 93.77 BOT 3 8 93.37 C4 C9 93.37 TOP 8 3 93.37 C9 C4 93.37 BOT 3 9 92.51 C4 C10 92.51 TOP 9 3 92.51 C10 C4 92.51 BOT 3 10 95.07 C4 C11 95.07 TOP 10 3 95.07 C11 C4 95.07 BOT 3 11 92.42 C4 C12 92.42 TOP 11 3 92.42 C12 C4 92.42 BOT 4 5 88.01 C5 C6 88.01 TOP 5 4 88.01 C6 C5 88.01 BOT 4 6 90.86 C5 C7 90.86 TOP 6 4 90.86 C7 C5 90.86 BOT 4 7 92.13 C5 C8 92.13 TOP 7 4 92.13 C8 C5 92.13 BOT 4 8 92.88 C5 C9 92.88 TOP 8 4 92.88 C9 C5 92.88 BOT 4 9 92.86 C5 C10 92.86 TOP 9 4 92.86 C10 C5 92.86 BOT 4 10 95.14 C5 C11 95.14 TOP 10 4 95.14 C11 C5 95.14 BOT 4 11 93.04 C5 C12 93.04 TOP 11 4 93.04 C12 C5 93.04 BOT 5 6 91.12 C6 C7 91.12 TOP 6 5 91.12 C7 C6 91.12 BOT 5 7 91.57 C6 C8 91.57 TOP 7 5 91.57 C8 C6 91.57 BOT 5 8 88.99 C6 C9 88.99 TOP 8 5 88.99 C9 C6 88.99 BOT 5 9 90.72 C6 C10 90.72 TOP 9 5 90.72 C10 C6 90.72 BOT 5 10 88.08 C6 C11 88.08 TOP 10 5 88.08 C11 C6 88.08 BOT 5 11 85.55 C6 C12 85.55 TOP 11 5 85.55 C12 C6 85.55 BOT 6 7 97.13 C7 C8 97.13 TOP 7 6 97.13 C8 C7 97.13 BOT 6 8 91.55 C7 C9 91.55 TOP 8 6 91.55 C9 C7 91.55 BOT 6 9 92.35 C7 C10 92.35 TOP 9 6 92.35 C10 C7 92.35 BOT 6 10 91.18 C7 C11 91.18 TOP 10 6 91.18 C11 C7 91.18 BOT 6 11 88.59 C7 C12 88.59 TOP 11 6 88.59 C12 C7 88.59 BOT 7 8 92.49 C8 C9 92.49 TOP 8 7 92.49 C9 C8 92.49 BOT 7 9 93.60 C8 C10 93.60 TOP 9 7 93.60 C10 C8 93.60 BOT 7 10 91.59 C8 C11 91.59 TOP 10 7 91.59 C11 C8 91.59 BOT 7 11 90.29 C8 C12 90.29 TOP 11 7 90.29 C12 C8 90.29 BOT 8 9 91.69 C9 C10 91.69 TOP 9 8 91.69 C10 C9 91.69 BOT 8 10 93.14 C9 C11 93.14 TOP 10 8 93.14 C11 C9 93.14 BOT 8 11 90.94 C9 C12 90.94 TOP 11 8 90.94 C12 C9 90.94 BOT 9 10 91.76 C10 C11 91.76 TOP 10 9 91.76 C11 C10 91.76 BOT 9 11 91.24 C10 C12 91.24 TOP 11 9 91.24 C12 C10 91.24 BOT 10 11 95.94 C11 C12 95.94 TOP 11 10 95.94 C12 C11 95.94 AVG 0 C1 * 94.52 AVG 1 C2 * 95.03 AVG 2 C3 * 95.03 AVG 3 C4 * 94.81 AVG 4 C5 * 94.45 AVG 5 C6 * 89.15 AVG 6 C7 * 91.78 AVG 7 C8 * 92.73 AVG 8 C9 * 92.29 AVG 9 C10 * 92.12 AVG 10 C11 * 93.65 AVG 11 C12 * 91.76 TOT TOT * 93.11 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGAAACTAGTGTTGCTGGCCAAAAACCAATAGCTTCTGCAATGATGTG C2 ATGGAAACTAGTGTTGCTGGCCAAAAACCAATAGCTTCTGCAATGATGTG C3 ATGGAAACTAGTGTTGCTGGCCAAAAACCAATAGCTTCTGCAATGATGTG C4 ATGGAAACTAGTGTTGCTGGCCAAAAACCAATAGCTTCTGCAATGATGTG C5 ATGGAAACTAGTGTTGCTGGCCAAAAACCAATAGCTTCTGCAATGATGTG C6 ATGGAAACTAGTGTTGCTGGCCAAAAGAAAATCTCTCCTGAAATGATGTG C7 ATGGAAACTAGTGTTGCTGGCCAAAAACCAATCGCTCCTGAAATGATGTG C8 ATGGAAACTAGTGTTGCTGGCCAAAAACCAATCGCTCCTGAAATGATGTG C9 ATGGAAACTAGTGTTGCTGGCCAAAAACCAATCGCTCCTGCAATGATGTG C10 ATGGAAACTAGTGTTGCTGGCCAAAAAGCAACCGCTCCTGCAATGATGTG C11 ATGGAAACTAGTGTTGCTGGCCAGAAACCAATCGCTCCTGCAATGATGTG C12 ATGGAAACTAGTGTTGCTGGCCAAAAACCAATAGCTTCTGCAATGATGTG ***********************.**. .** . ** ***.********* C1 TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA C2 TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA C3 TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA C4 TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA C5 TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA C6 TCACCAGCAGACGTCGTCATCCTGTGCCCATCTCATGTACGACCAGCACA C7 TCACCAGCAGACGTCCTCC---TGTGCCCATCTCATGTACGACCAGCACA C8 TCACCAGCAGACGTCGTCATCCTGTGCCCATCTCATGTACGACCAGCACA C9 TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA C10 TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA C11 TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA C12 TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA *************** **. ** ************************* C1 GTTCCGAGGAGGAGTTGGAGGTGATCAACGGGCCGTCCTCGCAG------ C2 GTTCCGAGGAGGAGTTGGAGGTGATCAACGGGCCGTCCTCGCAG------ C3 GTTCCGAGGAGGAGTTGGAGGTGATCAACGGGCCGTCCTCGCAG------ C4 GTTCCGAGGAGGAGTTGGAGGTGATCAATGGGCCGTCCTCGCAG------ C5 GTTCCGAGGAGGAGTTGGAGGTGATCAACGGGCCGTCCTCGCAG------ C6 GTTCCGAGGAGGAGTTGGAGGTGATCAACGGCCCCTCCTCGCAG------ C7 GCTCCGAGGAGGAGCTGGAGGTGATCAACGGGCCGTCCTCGCAG------ C8 GTTCCGAGGAGGAGTTGGAGGTGATCAATGGGCCGTCCTCGCAG------ C9 GTTCCGAAGAGGAGTTGGAGGTGATCAACGGGCCGTCCTCTCAG------ C10 GTTCCGAGGAGGAGTTGGAGGTGATCAACGGGCCGTCCTCGCAG------ C11 GTTCCGAGGAGGAGCTGGAGGTGATCAACGGGCCGTCCTCGCAG------ C12 GTTCGGAGGAGGAGCTGGAGGTGATCAATGGCCCGTCCTCGCAGGGTGGG * ** **.****** ************* ** ** ***** *** C1 GCGGGTCAGCATCCCGGA---ACGGCGGCCACGGGCTCATCGTGTGCCTC C2 GCGGGTCAGCATCCCGGA---ACGGCGGCCACAGGCTCATCGTGCGCCTC C3 GCGGGTCAGCATCCCGGA---ACGGCGGCCACAGGCTCATCGTGCGCCTC C4 GCGGGTCAGCATCCCGGT---ACGGCGGCCACGGGCTCATCGTGTGCCTC C5 GCGGGTCAGCATCCTGGA---ACGGCGGCCACGGGCTCATCGTGTGCCTC C6 GCGGGCCAGCATCCCGGTGGAACGGCGGCCACAGGCTCCACGTGCGCCTC C7 GCGGGTCAGCACTCCGGCGGAACGGCGGCCACGGGCTCCTCGTGCGCCTC C8 GCGGGTCAGCATCCCGGCGGAACAGCGGCCACGGGCTCCTCGTGCGCCTC C9 GCTGGTCAGCATCCCGGCGGACCGACGGCCACGGTCTCCTCGTGTGCCTC C10 GCGGGCCAGCATCCCGGCGGAACGGCGGCCGCGGGCTCCTCGTGCGCCTC C11 GCTGGTCAGCATCCCGGCGGAACGACGGCCACGGGCTCTTCGTGCGTCTC C12 CATGGTCAGCATCCCGGCGGAACGACGGCCACGGGCTCCTCGTGTGTCTC . ** ***** * ** .*..*****.*.* *** :**** * *** C1 CCGGATCTCGAATCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT C2 CCGGATCTCGAATCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT C3 CCGGATCTCGAATCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT C4 CCGGATCTCGAATCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT C5 CCGGATCTCGAATCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCGT C6 CCGAATCTCGAACCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT C7 CCGAATCTCGAACCGCGGGTGCACTTCCTCGCTGGACACGGAGGCGCCCT C8 CCGGATCTCGAACCGCGGATGCACTTCCTCGCTGGACACGGAGGCGCCCT C9 CCGGATCTCGAATCGCGTATGCACCTCCTCGCTGGACACGGAGGCGCCGT C10 GAGGATCTCGAACCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT C11 CCGGATTTCGAATCGCGGATGCACTTCCTCTCTGGACACGGAGGCGCCCT C12 CCGGATCTCGAATCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT .*.** ***** **** .***** ***** ***************** * C1 ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGTTCTAGCTCCACGCTG C2 ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGTTCTAGCTCCACGTTG C3 ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGTTCTAGCTCCACGTTG C4 ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGTTCCAGCTCCACGCTG C5 ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGTTCCAGCTCCACGCTG C6 ACGAGGAGCGGGCCACCACCTCGAACTCGAAGCGTTCCAGCTCCACGCTG C7 ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGCTCCAGCTCCACGCTG C8 ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGCTCCAGCTCCACGCTG C9 ACGAGGAGCGAGCCACCACTTCCAACTCGAAGCGTTCAAGCTCTACGCTG C10 ACGAGGAGCGGGCCACAACCTCCAACTCGAAGCGGTCCAGCTCCACGCTG C11 ACGAGGAGCGGGCCACCACATCCAACTCGAAGCGCTCCAGCTCCACGCTG C12 ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGGTCCAGCTCCACGCTG **********.*****.** ** *********** ** ***** *** ** C1 ATGGTGGAGAACCGCAAGCGATCGCTGGCCCACAGCTCCGACGATGAGTT C2 ATGGTGGAGAACCGCAAGCGATCGCTGGCCCACAGCTCCGACGATGAGTT C3 ATGGTGGAGAACCGCAAGCGATCGCTGGCCCACAGCTCCGACGATGAGTT C4 ATGGTGGAGAATCGCAAGCGATCGCTGGCCCACAGCTCCGACGATGAGTT C5 ATGGTGGAGAATCGCAAGCGATCGCTGGCCCACAGCTCCGACGATGAGTT C6 ATGGTGGAGAACCGCAAGCGATCGCTGGCCCACAGCTCCGACGATGAGTT C7 ATGGTGGAGAACCGCAAGCGGTCGCTGGCCCACAGCTCCGACGACGAGTT C8 ATGGTGGAGAACCGCAAGCGATCGCTGGCCCACAGCTCCGACGACGAGTT C9 ATGGTGGAGAATCGCAAGCGATCGTTGGCCCATAGCTCCGATGATGAGTT C10 ATGGTGGAGAACCGCAAGCGGTCGCTGGCCCACAGCTCCGACGATGAGCT C11 ATGGTGGAGAATCGCAAGCGATCGCTGGCTCACAGCTCCGACGATGAGTT C12 ATGGTGGAGAATCGCAAGCGTTCGCTGGCCCACAGCTCCGACGATGAGTT *********** ******** *** **** ** ******** ** *** * C1 GCGCAACTCGCTGGAGCCGATATTGACGCCCGTGAATTTTCGCACATCGC C2 GCGCAACTCGCTGGAGCCGATATTGACGCCCGTGAATTTTCGCACATCGC C3 GCGCAACTCGCTGGAGCCGATATTGACGCCCGTGAATTTTCGCACATCGC C4 GCGCAACTCGCTGGAGCCGATATTGACGCCCGTGAATTTTCGCACATCGC C5 GCGCAACTCGCTGGAGCCGATATTGACGCCCGTGAATTTTCGCACATCGC C6 GCGCAACTCGCTGGAGCCGATCTTGACGCCCGTGAATTTTCGCACATCGC C7 GCGCAACTCGCTGGAGCCGATCTTGACGCCCGTGAATTTTCGCACATCGC C8 GCGCAACTCGCTGGAGCCGATCTTGACGCCCGTGAATTTTCGCACATCGC C9 GCGCAACTCATTGGAGCCGATCCTGACGCCCGTGAATTTTCGCACATCGC C10 GCGCAACTCGCTGGAGCCCATTTTGACGCCCGTGAATTTCCGCACATCGC C11 GCGCAACTCGCTGGAGCCAATATTGACGCCCGTGAATTTTCGCACATCGC C12 GCGCAACTCGCTGGAGCCAATATTGACGCCCGTGAATTTTCGCACATCGC *********. ******* ** **************** ********** C1 CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC C2 CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC C3 CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC C4 CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC C5 CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC C6 CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC C7 CGCCATTGGAGGCGTTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC C8 CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC C9 CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC C10 CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC C11 CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC C12 CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC *************.************************************ C1 ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA C2 ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA C3 ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA C4 ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA C5 ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA C6 ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA C7 ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA C8 ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA C9 ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA C10 ACAACGCCACTGATATTGTCGGAGGCCCGCTGTGGCATCGAAAATATTAA C11 ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA C12 ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA *****************.***********.******************** C1 ATTATGTGATAATAGTGTAAACGAGGAGAATGGTGACAACGGCGGT---- C2 ATTATGTGATAATAGTGTAAACGAGGAGAATGGTGACAACGGTGGT---- C3 ATTATGTGATAATAGTGTAAACGAGGAGAATGGTGACAACGGCGGT---- C4 ATTATGTGATAATAGTGTAAACGAGGAGAATGGTGACAACGGCGGTGGCG C5 ATTATGTGATAATAGTGTAAACGAGGAGAATGGTGACAACGGCGGTGGCG C6 ATTATGTGATAATAGTGTAAACGAGGAGAATGGCGACAACGGCGGT---- C7 ATTATGTGATAATAGTGTAAACGAGGAGAACGGCGACAACGGCGGTGGC- C8 ATTATGTGATAATAGTGTAAACGAGGAGAATGGCGACAACGGCGGT---- C9 ATTATGTGATAATAGTGTAAACGAGGAGAATGGCGACAACGGCGGTGGCG C10 ATTATGTGATAATAGTGTAAACGAGGAGAATGGCGACAACGGCGGC---- C11 ATTATGTGATAATAGTGTAAACGAGGAGAATGGCGACAACGGCGGCGGT- C12 ATTATGTGATAATAGTGTAAACGAGGAGAATGGCGACAACGGTGGC---- ****************************** ** ******** ** C1 --------GGCGGTGGCGCGGCCAATAGCAGTAAGTGCGCCAAGATTGGC C2 --------GGCGGTGGCGTGGCCAATAGCAGTAAGTGCGCCAAGATTGGT C3 --------GGCGGTGGCGTGGCCAATAGCAGTAAGTGCGCCAAGATTGGT C4 TCGGAGGCGGCGGCGGCGTGGCCAATAGCAGTAAGTGCGCCAAGATTGGT C5 TCGGC---GGCGGCGGCGTGGCCAATAGCAGTAAGTGCGCCAAGATTGGC C6 --------------------GGCGGTAGCAGTAAGTGTGCTAAGATTGGA C7 --------GGTGGCGGCGGCGGCAACGGCGGCAAGTGTGCCAAGATTGGC C8 -----------------GGCGGCAACGGCAGCAAGTGTGCCAAGATTGGT C9 GTGGC---TGTGGCGGGGTGGCCAATAGCAGCAAGTGTGCTAAGATTGGT C10 --------------------GGCGGCGGCAGCAAGTGTGCTAAGATCGGA C11 -----------GGCGTGGCAGCCAATAGCAGTAAGTGTGCTAAGATTGGT C12 --------------GTGGCGGCCAATAGCAGTAAGTGTGCTAAGATTGGT * *.. .**.* ***** ** ***** ** C1 GCACTGGCAGGGAATGCCAGCGGAACTGTGGCCGCAACCGGAAACGGAAA C2 ------GCAGGTAATGCCAGCGGAACTGGGACCGCAACCGGAAACGGAAA C3 ------GCAGGTAATGCCAGCGGAACTGGGACCGCAACCGGAAACGGAAA C4 ------GAAGGGAATGCCAGCGGAACGGGAGTGGCAACCGGCAACGGAAA C5 ------GCAGGGATTGCCAGCGGAACCGGAGCCGCAACCGGAAACGGAAA C6 ------------------------GGCGGAACCATAACCGGAACCGGAAA C7 ------------------------GCGGCCACCGGAACGGGAACCGGAAA C8 ------------------------GTGGCAGGCGCCACCGGAACCGGAAA C9 ---------------GCGGGAAACAACGCCAGCGGTACCGGAACCGGAAA C10 TCGGCAGGAGCAGCTGGCGGAGCAACTGGGGCAGCTGGGGCAACCGGAAA C11 ------GCAGGAAACACCATCGGAACGGGAACCGGAACCGGAAATGGCAA C12 ------GCGGCCAAT---------GCTGGTGGTGCAACCAGTGGTGGCAA . * . . . . . **.** C1 CGGC------GGCAACGAGAATGAGCCG------AGTGTGATCAAGGCGT C2 CGGC------GGCAACGAGAATGAGCCG------AGTGTGATCAAGGCGT C3 CGGC------GGCAACGAGAATGAGCCG------AGTGTGATCAAGGCGT C4 CGGAAACGGTGGCAACGAGAATGAACCA------AGTGTGATCAAGGCGT C5 CGGT------GGCAACGAGAACGAGCCG------AGTGTGATCAAGGCGT C6 CGGT------GGCAATGAGAACGAACCG------AGTGTGATCAAGGCGT C7 CGGC------GGCAACGAGAACGAGCCG------AGTGTGATCAAGGCGT C8 CGGT------GGCAACGAGAACGAACCG------AGTGTGATCAAGGCGT C9 CGGA------GGCAACGAGAACGAGCCG------AGTGTGATTAAGGCGT C10 TGGC------GGCAACGAGAACGAGCCG------AGTGCAATCAAGGCGT C11 CGGT------GCCAATGAGAACGAGCCGAGCGCGAGTGTGATCAAGGCGT C12 T---------GAAAATGAGCCCAACGCGAGCGCGAGTGTGATTAAGGCGT * .** ***.. .* *. **** .** ******* C1 GCAGCAGCTCGCTAAAGATGAGCAACAGCAGCCACCACATTTACCAGCCG C2 GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATTTACCAGCCG C3 GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATTTACCAGCCG C4 GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATTTACCAGCCG C5 GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATCTACCAGCCG C6 GCAGCAGCTCGCTGAAGATGAGCAATAGCAGCCATCACATCTACCAGCCG C7 GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATCTACCAGCCG C8 GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCATCACATCTACCAGCCG C9 GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATTTACCAGCCG C10 GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATCTACCAGCCG C11 GCAGCAGCTCGCTAAAGATGAGCAACAGCAGCCACCACATTTACCAGCCG C12 GCAGTAGCTCGCTAAAGATGAGCAACAGTAGCCATCACATATACCAGCCG **** ********.*********** ** ***** ***** ********* C1 CAGCCGAAATATAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG C2 CAGCCGAAGTATAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG C3 CAGCCGAAGTATAGTTTTCACTACAACAGCTCGCGGAGCAGTCCGGCCAG C4 CAGCCGAAGTATAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG C5 CAGCCGAAGTATAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG C6 CAGCCAAAGTATAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG C7 CAGCCGAAGTACAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG C8 CAGCCAAAGTACAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG C9 CAGCCGAAGTATAGTTTTCATTACAACAGTTCGCGGAGCAGTCCGGCCAG C10 CAGCCGAAGTACAGCTTCCCGTACAACAGCTCGCGGAGCAGTCCGGCCAG C11 CAGCCGAAGTATAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG C12 CAGCCCAAATACAGTTTCCACTACAATAGCTCGCGCAGCAGTCCGGCCAG ***** **.** ** ** *. ***** ** ***** ************** C1 CACCACTGGCCTGGATATGGAGGTGCGTTCGGTCAGTCCGCCGGCGAAAC C2 CACCACTGGCCTGGATATGGAGGTGCGTTCGGTCAGTCCGCCGGCGAAAC C3 CACCACTGGCCTGGATATGGAGGTGCGTTCGGTCAGTCCGCCGGCGAAAC C4 CACCACTGGCCTGGATATGGAGGTGCGTTCGGTTAGTCCGCCGGCGAAAC C5 CACCACTGGCCTGGATATGGAGGTGCGTTCGGTCAGTCCGCCGGCGAAAC C6 CACCACCGGCTTGGACATGGAGGTGCGATCGGTGAGTCCGCCGGCGAAAC C7 CACCACCGGACTGGACATGGAGGTGCGCTCGGTCAGTCCGCCGGCGAAAC C8 CACCACCGGACTGGACATGGAGGTGCGATCGGTCAGTCCGCCGGCGAAAC C9 CACCACCGGCTTGGACATGGAGGTGCGGTCGGTCAGTCCGCCGGCGAAAC C10 CACCACCGGGCTGGACATGGAGGTGCGGTCGGTCAGTCCGCCGGCGAAGC C11 CACCACCGGCTTGGATATGGAGGTGCGATCGGTCAGTCCGCCGGCGAAAT C12 CACCACCGGTTTGGATATGGAGGTGAGATCGGTGAGTCCGCCGGCGAAAT ****** ** **** *********.* ***** **************. C1 TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCAGT C2 TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCAGT C3 TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCAGT C4 TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCAGT C5 TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCGGT C6 TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGCAACAATGCCACC C7 TGTTCCACTGCGCCATCTCGCCCAGGCGGCGACCCAGCAGCAATGCCACC C8 TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGCAACAATGCCACA C9 TGTTCCACTGCGCCATATCGCCCCGGCGGCGACCCAGTAACAATGCCAGT C10 TGTTCCACTGCGCCATATCGCCCCGGCGGCGACCCAGCAACAATGCCGGC C11 TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCAGT C12 TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCAGC ****************.******.************* *.*******. C1 GGT---GCAGCCGGGGGCGCCACAACAATATCACCATCGTCAGCATCATC C2 GGT---GCAGCCGGGGGCGCCACAACAATATCACCATCGTCAGCATCATC C3 GGT---GCAGCCGGGGGCGCCACAACAATATCACCATCGTCAGCATCATC C4 GGT------------------ACAGCAATATCACCATCGTCAGCAACATC C5 GGTGGCAATGCCGGTGGCGCCACAACAATATCACCATCGTCAGCATCATC C6 ACAATATCACCACCATCATCAGCAGCCACATCATCAGCCACCACGACAAC C7 ACCACGTCGCCACCATCATCCGCATCCGCATCCGCATCTGCGTCAGCCGC C8 ACAATATCACCACCATCATCCGCATCTGCATCTGCATCTGCATCTGCATC C9 GGT---TCAGCCGCGAGCGCCACAACAATATCACCATCATCATCATCAGC C10 GGT------------CCGCCCGCAACAATATCGCCA-------------- C11 GGTCAACCCGGCGGGGGCGCCACAACAATATCACCGTCATCGTCATCA-- C12 GGT---CCATCCGTGGGCGCCACAACAATATCACCATCATCATCATCATC . .** * . *** *. C1 ATCA---------TCAGGCACAACAACGACACACAATGCTGCCAAT---- C2 ATCG---------TCAGCCACAACAACGACACACAATGCTGCCAAT---- C3 ATCA---------TCAGCCACAACAACGACACACAATGCTGCCAAT---- C4 ATCATCAGCCGCCACAGCAACAACAACGACACACAATGCTGCCAATTCGA C5 ATCA---------TCAGCCACAACAACGACACACAATGCTGCCAATTCCA C6 GACA---------CAAAATGCTGCCAATTCCGCCGGAAGTGCCGGGAAT- C7 CGCA---------ACAGCAACAACAACGACACACAACGCTGCCAAC---- C8 AGCC---------GCCTCAACAACAACGACACACAATGCTGCCAATTCC- C9 AGCA------GCAGTCTCAGCAACAACGACACACAATTCTGCCAAC---- C10 -------------------TCGTCAACGACACACAACGCTGCCAACTCC- C11 ----------TCATCAGCCACAACAACGACACACAATGCTGCCAATTCC- C12 ATTGGCATCATCGTCAGCCACAACAACGACACACAATGCTGCCAATTCCG * *.*. :*. .*.. ****.. C1 --------------TCCGCCGGAAATGCCGCTAACGTCACCGCCGTCGCC C2 --------------TCCGCCGGAAATGCCGCTAACGTCACCGCCGTCGCC C3 --------------TCCGCCGGAAATGCCGCTAACGTCACCGCCGTCGCC C4 AT------------TCCGCCGGAAATGCCGCCAATGTCACCGCCGTCGCC C5 AT------------TCCGCCGGAAATGCCGCCAATGTCACCGCCGTCGCC C6 -----------------CCGGGAAATGCCGCCAACGTCACCGCCGTCGCC C7 -----------------------------------GTCACCGCCGTCGCC C8 -----------------GCCGGAAATGCGGCCAACGTCACCGCCGTCGCC C9 --------------TCCGCCGGAAATGCCGCTAACGTCACCGCCGTCGCT C10 -----------------GCCGGAAATGCCGCCAACGTCACCGCCGCCGCC C11 -----------------GCCGGAAATGCCGCCAACGTCACCGCCGCCGCC C12 GGGGAAATGCCGTAAATGCCGGAAATGCCGCCAACGTCACCGCCGCCGCC ********** *** C1 ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT C2 ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT C3 ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT C4 ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT C5 ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT C6 ACACAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT C7 ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT C8 ACCCAGAGACTGCAGCGACCGCACCGGCCGTGTTTAGATTTTGATAAGAT C9 ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT C10 ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT C11 ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT C12 ACACAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT **.******************** ************************** C1 GCAGCAGGTTAGTCTC---------------------------------- C2 GCAGCAGGTTAGTCTC---------------------------------- C3 GCAGCAGGTTAGTCTC---------------------------------- C4 GCAGCAGGTTAGTCTC---------------------------------- C5 GCAGCAGGTTAGTCTC---------------------------------- C6 GCAGCAGGTTAGCCTC---------------------------------- C7 GCAGCAGGTTAGTCTC---------------------------------- C8 GCAGCAGGTTAGTCTC---------------------------------- C9 GCAGCAGGTTAGTCTC---------------------------------- C10 GCAGCAGGTTAGTCTC---------------------------------- C11 GCAGCAGGTTAGTCTC---------------------------------- C12 GCAGCAGGTTAGCCTC---------------------------------- ************ *** C1 -------------------------- C2 -------------------------- C3 -------------------------- C4 -------------------------- C5 -------------------------- C6 -------------------------- C7 -------------------------- C8 -------------------------- C9 -------------------------- C10 -------------------------- C11 -------------------------- C12 -------------------------- >C1 ATGGAAACTAGTGTTGCTGGCCAAAAACCAATAGCTTCTGCAATGATGTG TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA GTTCCGAGGAGGAGTTGGAGGTGATCAACGGGCCGTCCTCGCAG------ GCGGGTCAGCATCCCGGA---ACGGCGGCCACGGGCTCATCGTGTGCCTC CCGGATCTCGAATCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGTTCTAGCTCCACGCTG ATGGTGGAGAACCGCAAGCGATCGCTGGCCCACAGCTCCGACGATGAGTT GCGCAACTCGCTGGAGCCGATATTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGTGACAACGGCGGT---- --------GGCGGTGGCGCGGCCAATAGCAGTAAGTGCGCCAAGATTGGC GCACTGGCAGGGAATGCCAGCGGAACTGTGGCCGCAACCGGAAACGGAAA CGGC------GGCAACGAGAATGAGCCG------AGTGTGATCAAGGCGT GCAGCAGCTCGCTAAAGATGAGCAACAGCAGCCACCACATTTACCAGCCG CAGCCGAAATATAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACTGGCCTGGATATGGAGGTGCGTTCGGTCAGTCCGCCGGCGAAAC TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCAGT GGT---GCAGCCGGGGGCGCCACAACAATATCACCATCGTCAGCATCATC ATCA---------TCAGGCACAACAACGACACACAATGCTGCCAAT---- --------------TCCGCCGGAAATGCCGCTAACGTCACCGCCGTCGCC ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >C2 ATGGAAACTAGTGTTGCTGGCCAAAAACCAATAGCTTCTGCAATGATGTG TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA GTTCCGAGGAGGAGTTGGAGGTGATCAACGGGCCGTCCTCGCAG------ GCGGGTCAGCATCCCGGA---ACGGCGGCCACAGGCTCATCGTGCGCCTC CCGGATCTCGAATCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGTTCTAGCTCCACGTTG ATGGTGGAGAACCGCAAGCGATCGCTGGCCCACAGCTCCGACGATGAGTT GCGCAACTCGCTGGAGCCGATATTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGTGACAACGGTGGT---- --------GGCGGTGGCGTGGCCAATAGCAGTAAGTGCGCCAAGATTGGT ------GCAGGTAATGCCAGCGGAACTGGGACCGCAACCGGAAACGGAAA CGGC------GGCAACGAGAATGAGCCG------AGTGTGATCAAGGCGT GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATTTACCAGCCG CAGCCGAAGTATAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACTGGCCTGGATATGGAGGTGCGTTCGGTCAGTCCGCCGGCGAAAC TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCAGT GGT---GCAGCCGGGGGCGCCACAACAATATCACCATCGTCAGCATCATC ATCG---------TCAGCCACAACAACGACACACAATGCTGCCAAT---- --------------TCCGCCGGAAATGCCGCTAACGTCACCGCCGTCGCC ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >C3 ATGGAAACTAGTGTTGCTGGCCAAAAACCAATAGCTTCTGCAATGATGTG TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA GTTCCGAGGAGGAGTTGGAGGTGATCAACGGGCCGTCCTCGCAG------ GCGGGTCAGCATCCCGGA---ACGGCGGCCACAGGCTCATCGTGCGCCTC CCGGATCTCGAATCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGTTCTAGCTCCACGTTG ATGGTGGAGAACCGCAAGCGATCGCTGGCCCACAGCTCCGACGATGAGTT GCGCAACTCGCTGGAGCCGATATTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGTGACAACGGCGGT---- --------GGCGGTGGCGTGGCCAATAGCAGTAAGTGCGCCAAGATTGGT ------GCAGGTAATGCCAGCGGAACTGGGACCGCAACCGGAAACGGAAA CGGC------GGCAACGAGAATGAGCCG------AGTGTGATCAAGGCGT GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATTTACCAGCCG CAGCCGAAGTATAGTTTTCACTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACTGGCCTGGATATGGAGGTGCGTTCGGTCAGTCCGCCGGCGAAAC TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCAGT GGT---GCAGCCGGGGGCGCCACAACAATATCACCATCGTCAGCATCATC ATCA---------TCAGCCACAACAACGACACACAATGCTGCCAAT---- --------------TCCGCCGGAAATGCCGCTAACGTCACCGCCGTCGCC ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >C4 ATGGAAACTAGTGTTGCTGGCCAAAAACCAATAGCTTCTGCAATGATGTG TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA GTTCCGAGGAGGAGTTGGAGGTGATCAATGGGCCGTCCTCGCAG------ GCGGGTCAGCATCCCGGT---ACGGCGGCCACGGGCTCATCGTGTGCCTC CCGGATCTCGAATCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGTTCCAGCTCCACGCTG ATGGTGGAGAATCGCAAGCGATCGCTGGCCCACAGCTCCGACGATGAGTT GCGCAACTCGCTGGAGCCGATATTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGTGACAACGGCGGTGGCG TCGGAGGCGGCGGCGGCGTGGCCAATAGCAGTAAGTGCGCCAAGATTGGT ------GAAGGGAATGCCAGCGGAACGGGAGTGGCAACCGGCAACGGAAA CGGAAACGGTGGCAACGAGAATGAACCA------AGTGTGATCAAGGCGT GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATTTACCAGCCG CAGCCGAAGTATAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACTGGCCTGGATATGGAGGTGCGTTCGGTTAGTCCGCCGGCGAAAC TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCAGT GGT------------------ACAGCAATATCACCATCGTCAGCAACATC ATCATCAGCCGCCACAGCAACAACAACGACACACAATGCTGCCAATTCGA AT------------TCCGCCGGAAATGCCGCCAATGTCACCGCCGTCGCC ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >C5 ATGGAAACTAGTGTTGCTGGCCAAAAACCAATAGCTTCTGCAATGATGTG TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA GTTCCGAGGAGGAGTTGGAGGTGATCAACGGGCCGTCCTCGCAG------ GCGGGTCAGCATCCTGGA---ACGGCGGCCACGGGCTCATCGTGTGCCTC CCGGATCTCGAATCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCGT ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGTTCCAGCTCCACGCTG ATGGTGGAGAATCGCAAGCGATCGCTGGCCCACAGCTCCGACGATGAGTT GCGCAACTCGCTGGAGCCGATATTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGTGACAACGGCGGTGGCG TCGGC---GGCGGCGGCGTGGCCAATAGCAGTAAGTGCGCCAAGATTGGC ------GCAGGGATTGCCAGCGGAACCGGAGCCGCAACCGGAAACGGAAA CGGT------GGCAACGAGAACGAGCCG------AGTGTGATCAAGGCGT GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATCTACCAGCCG CAGCCGAAGTATAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACTGGCCTGGATATGGAGGTGCGTTCGGTCAGTCCGCCGGCGAAAC TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCGGT GGTGGCAATGCCGGTGGCGCCACAACAATATCACCATCGTCAGCATCATC ATCA---------TCAGCCACAACAACGACACACAATGCTGCCAATTCCA AT------------TCCGCCGGAAATGCCGCCAATGTCACCGCCGTCGCC ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >C6 ATGGAAACTAGTGTTGCTGGCCAAAAGAAAATCTCTCCTGAAATGATGTG TCACCAGCAGACGTCGTCATCCTGTGCCCATCTCATGTACGACCAGCACA GTTCCGAGGAGGAGTTGGAGGTGATCAACGGCCCCTCCTCGCAG------ GCGGGCCAGCATCCCGGTGGAACGGCGGCCACAGGCTCCACGTGCGCCTC CCGAATCTCGAACCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACCACCTCGAACTCGAAGCGTTCCAGCTCCACGCTG ATGGTGGAGAACCGCAAGCGATCGCTGGCCCACAGCTCCGACGATGAGTT GCGCAACTCGCTGGAGCCGATCTTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGCGACAACGGCGGT---- --------------------GGCGGTAGCAGTAAGTGTGCTAAGATTGGA ------------------------GGCGGAACCATAACCGGAACCGGAAA CGGT------GGCAATGAGAACGAACCG------AGTGTGATCAAGGCGT GCAGCAGCTCGCTGAAGATGAGCAATAGCAGCCATCACATCTACCAGCCG CAGCCAAAGTATAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACCGGCTTGGACATGGAGGTGCGATCGGTGAGTCCGCCGGCGAAAC TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGCAACAATGCCACC ACAATATCACCACCATCATCAGCAGCCACATCATCAGCCACCACGACAAC GACA---------CAAAATGCTGCCAATTCCGCCGGAAGTGCCGGGAAT- -----------------CCGGGAAATGCCGCCAACGTCACCGCCGTCGCC ACACAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGCCTC---------------------------------- -------------------------- >C7 ATGGAAACTAGTGTTGCTGGCCAAAAACCAATCGCTCCTGAAATGATGTG TCACCAGCAGACGTCCTCC---TGTGCCCATCTCATGTACGACCAGCACA GCTCCGAGGAGGAGCTGGAGGTGATCAACGGGCCGTCCTCGCAG------ GCGGGTCAGCACTCCGGCGGAACGGCGGCCACGGGCTCCTCGTGCGCCTC CCGAATCTCGAACCGCGGGTGCACTTCCTCGCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGCTCCAGCTCCACGCTG ATGGTGGAGAACCGCAAGCGGTCGCTGGCCCACAGCTCCGACGACGAGTT GCGCAACTCGCTGGAGCCGATCTTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCGTTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAACGGCGACAACGGCGGTGGC- --------GGTGGCGGCGGCGGCAACGGCGGCAAGTGTGCCAAGATTGGC ------------------------GCGGCCACCGGAACGGGAACCGGAAA CGGC------GGCAACGAGAACGAGCCG------AGTGTGATCAAGGCGT GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATCTACCAGCCG CAGCCGAAGTACAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACCGGACTGGACATGGAGGTGCGCTCGGTCAGTCCGCCGGCGAAAC TGTTCCACTGCGCCATCTCGCCCAGGCGGCGACCCAGCAGCAATGCCACC ACCACGTCGCCACCATCATCCGCATCCGCATCCGCATCTGCGTCAGCCGC CGCA---------ACAGCAACAACAACGACACACAACGCTGCCAAC---- -----------------------------------GTCACCGCCGTCGCC ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >C8 ATGGAAACTAGTGTTGCTGGCCAAAAACCAATCGCTCCTGAAATGATGTG TCACCAGCAGACGTCGTCATCCTGTGCCCATCTCATGTACGACCAGCACA GTTCCGAGGAGGAGTTGGAGGTGATCAATGGGCCGTCCTCGCAG------ GCGGGTCAGCATCCCGGCGGAACAGCGGCCACGGGCTCCTCGTGCGCCTC CCGGATCTCGAACCGCGGATGCACTTCCTCGCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGCTCCAGCTCCACGCTG ATGGTGGAGAACCGCAAGCGATCGCTGGCCCACAGCTCCGACGACGAGTT GCGCAACTCGCTGGAGCCGATCTTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGCGACAACGGCGGT---- -----------------GGCGGCAACGGCAGCAAGTGTGCCAAGATTGGT ------------------------GTGGCAGGCGCCACCGGAACCGGAAA CGGT------GGCAACGAGAACGAACCG------AGTGTGATCAAGGCGT GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCATCACATCTACCAGCCG CAGCCAAAGTACAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACCGGACTGGACATGGAGGTGCGATCGGTCAGTCCGCCGGCGAAAC TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGCAACAATGCCACA ACAATATCACCACCATCATCCGCATCTGCATCTGCATCTGCATCTGCATC AGCC---------GCCTCAACAACAACGACACACAATGCTGCCAATTCC- -----------------GCCGGAAATGCGGCCAACGTCACCGCCGTCGCC ACCCAGAGACTGCAGCGACCGCACCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >C9 ATGGAAACTAGTGTTGCTGGCCAAAAACCAATCGCTCCTGCAATGATGTG TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA GTTCCGAAGAGGAGTTGGAGGTGATCAACGGGCCGTCCTCTCAG------ GCTGGTCAGCATCCCGGCGGACCGACGGCCACGGTCTCCTCGTGTGCCTC CCGGATCTCGAATCGCGTATGCACCTCCTCGCTGGACACGGAGGCGCCGT ACGAGGAGCGAGCCACCACTTCCAACTCGAAGCGTTCAAGCTCTACGCTG ATGGTGGAGAATCGCAAGCGATCGTTGGCCCATAGCTCCGATGATGAGTT GCGCAACTCATTGGAGCCGATCCTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGCGACAACGGCGGTGGCG GTGGC---TGTGGCGGGGTGGCCAATAGCAGCAAGTGTGCTAAGATTGGT ---------------GCGGGAAACAACGCCAGCGGTACCGGAACCGGAAA CGGA------GGCAACGAGAACGAGCCG------AGTGTGATTAAGGCGT GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATTTACCAGCCG CAGCCGAAGTATAGTTTTCATTACAACAGTTCGCGGAGCAGTCCGGCCAG CACCACCGGCTTGGACATGGAGGTGCGGTCGGTCAGTCCGCCGGCGAAAC TGTTCCACTGCGCCATATCGCCCCGGCGGCGACCCAGTAACAATGCCAGT GGT---TCAGCCGCGAGCGCCACAACAATATCACCATCATCATCATCAGC AGCA------GCAGTCTCAGCAACAACGACACACAATTCTGCCAAC---- --------------TCCGCCGGAAATGCCGCTAACGTCACCGCCGTCGCT ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >C10 ATGGAAACTAGTGTTGCTGGCCAAAAAGCAACCGCTCCTGCAATGATGTG TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA GTTCCGAGGAGGAGTTGGAGGTGATCAACGGGCCGTCCTCGCAG------ GCGGGCCAGCATCCCGGCGGAACGGCGGCCGCGGGCTCCTCGTGCGCCTC GAGGATCTCGAACCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACAACCTCCAACTCGAAGCGGTCCAGCTCCACGCTG ATGGTGGAGAACCGCAAGCGGTCGCTGGCCCACAGCTCCGACGATGAGCT GCGCAACTCGCTGGAGCCCATTTTGACGCCCGTGAATTTCCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTGTCGGAGGCCCGCTGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGCGACAACGGCGGC---- --------------------GGCGGCGGCAGCAAGTGTGCTAAGATCGGA TCGGCAGGAGCAGCTGGCGGAGCAACTGGGGCAGCTGGGGCAACCGGAAA TGGC------GGCAACGAGAACGAGCCG------AGTGCAATCAAGGCGT GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATCTACCAGCCG CAGCCGAAGTACAGCTTCCCGTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACCGGGCTGGACATGGAGGTGCGGTCGGTCAGTCCGCCGGCGAAGC TGTTCCACTGCGCCATATCGCCCCGGCGGCGACCCAGCAACAATGCCGGC GGT------------CCGCCCGCAACAATATCGCCA-------------- -------------------TCGTCAACGACACACAACGCTGCCAACTCC- -----------------GCCGGAAATGCCGCCAACGTCACCGCCGCCGCC ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >C11 ATGGAAACTAGTGTTGCTGGCCAGAAACCAATCGCTCCTGCAATGATGTG TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA GTTCCGAGGAGGAGCTGGAGGTGATCAACGGGCCGTCCTCGCAG------ GCTGGTCAGCATCCCGGCGGAACGACGGCCACGGGCTCTTCGTGCGTCTC CCGGATTTCGAATCGCGGATGCACTTCCTCTCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACCACATCCAACTCGAAGCGCTCCAGCTCCACGCTG ATGGTGGAGAATCGCAAGCGATCGCTGGCTCACAGCTCCGACGATGAGTT GCGCAACTCGCTGGAGCCAATATTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGCGACAACGGCGGCGGT- -----------GGCGTGGCAGCCAATAGCAGTAAGTGTGCTAAGATTGGT ------GCAGGAAACACCATCGGAACGGGAACCGGAACCGGAAATGGCAA CGGT------GCCAATGAGAACGAGCCGAGCGCGAGTGTGATCAAGGCGT GCAGCAGCTCGCTAAAGATGAGCAACAGCAGCCACCACATTTACCAGCCG CAGCCGAAGTATAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACCGGCTTGGATATGGAGGTGCGATCGGTCAGTCCGCCGGCGAAAT TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCAGT GGTCAACCCGGCGGGGGCGCCACAACAATATCACCGTCATCGTCATCA-- ----------TCATCAGCCACAACAACGACACACAATGCTGCCAATTCC- -----------------GCCGGAAATGCCGCCAACGTCACCGCCGCCGCC ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >C12 ATGGAAACTAGTGTTGCTGGCCAAAAACCAATAGCTTCTGCAATGATGTG TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA GTTCGGAGGAGGAGCTGGAGGTGATCAATGGCCCGTCCTCGCAGGGTGGG CATGGTCAGCATCCCGGCGGAACGACGGCCACGGGCTCCTCGTGTGTCTC CCGGATCTCGAATCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGGTCCAGCTCCACGCTG ATGGTGGAGAATCGCAAGCGTTCGCTGGCCCACAGCTCCGACGATGAGTT GCGCAACTCGCTGGAGCCAATATTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGCGACAACGGTGGC---- --------------GTGGCGGCCAATAGCAGTAAGTGTGCTAAGATTGGT ------GCGGCCAAT---------GCTGGTGGTGCAACCAGTGGTGGCAA T---------GAAAATGAGCCCAACGCGAGCGCGAGTGTGATTAAGGCGT GCAGTAGCTCGCTAAAGATGAGCAACAGTAGCCATCACATATACCAGCCG CAGCCCAAATACAGTTTCCACTACAATAGCTCGCGCAGCAGTCCGGCCAG CACCACCGGTTTGGATATGGAGGTGAGATCGGTGAGTCCGCCGGCGAAAT TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCAGC GGT---CCATCCGTGGGCGCCACAACAATATCACCATCATCATCATCATC ATTGGCATCATCGTCAGCCACAACAACGACACACAATGCTGCCAATTCCG GGGGAAATGCCGTAAATGCCGGAAATGCCGCCAACGTCACCGCCGCCGCC ACACAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGCCTC---------------------------------- -------------------------- >C1 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQoo AGQHPGoTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGooooGGGAANSSKCAKIG ALAGNASGTVAATGNGNGooGNENEPooSVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS GoAAGGATTISPSSASSSoooSGTTTTHNAANooooooSAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSL >C2 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQoo AGQHPGoTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGooooGGGVANSSKCAKIG ooAGNASGTGTATGNGNGooGNENEPooSVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS GoAAGGATTISPSSASSSoooSATTTTHNAANooooooSAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSL >C3 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQoo AGQHPGoTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGooooGGGVANSSKCAKIG ooAGNASGTGTATGNGNGooGNENEPooSVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS GoAAGGATTISPSSASSSoooSATTTTHNAANooooooSAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSL >C4 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQoo AGQHPGoTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGGVGGGGGVANSSKCAKIG ooEGNASGTGVATGNGNGNGGNENEPooSVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS GooooooTAISPSSATSSSAATATTTTHNAANSNooooSAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSL >C5 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQoo AGQHPGoTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGGVGoGGGVANSSKCAKIG ooAGIASGTGAATGNGNGooGNENEPooSVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAG GGNAGGATTISPSSASSSoooSATTTTHNAANSNooooSAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSL >C6 METSVAGQKKISPEMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQoo AGQHPGGTAATGSTCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGooooooooGGSSKCAKIG ooooooooGGTITGTGNGooGNENEPooSVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAT TISPPSSAATSSATTTTToooQNAANSAGSAGNooooooPGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSL >C7 METSVAGQKPIAPEMMCHQQTSSoCAHLMYDQHSSEEELEVINGPSSQoo AGQHSGGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGGoooGGGGGNGGKCAKIG ooooooooAATGTGTGNGooGNENEPooSVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSSNAT TTSPPSSASASASASAAAoooTATTTTHNAANoooooooooooooVTAVA TQRLQRPHRPCLDFDKMQQVSL >C8 METSVAGQKPIAPEMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQoo AGQHPGGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGoooooooGGNGSKCAKIG ooooooooVAGATGTGNGooGNENEPooSVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAT TISPPSSASASASASASAoooASTTTTHNAANSooooooAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSL >C9 METSVAGQKPIAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQoo AGQHPGGPTATVSSCASRISNRVCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGGGGoCGGVANSSKCAKIG oooooAGNNASGTGTGNGooGNENEPooSVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS GoSAASATTISPSSSSAAooAVSATTTHNSANooooooSAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSL >C10 METSVAGQKATAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQoo AGQHPGGTAAAGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGooooooooGGGSKCAKIG SAGAAGGATGAAGATGNGooGNENEPooSAIKACSSSLKMSNSSHHIYQP QPKYSFPYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAG GooooPPATISPoooooooooooSSTTHNAANSooooooAGNAANVTAAA TQRLQRPHRPCLDFDKMQQVSL >C11 METSVAGQKPIAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQoo AGQHPGGTTATGSSCVSRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGGooooGVAANSSKCAKIG ooAGNTIGTGTGTGNGNGooANENEPSASVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS GQPGGGATTISPSSSSooooSSATTTTHNAANSooooooAGNAANVTAAA TQRLQRPHRPCLDFDKMQQVSL >C12 METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQGG HGQHPGGTTATGSSCVSRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGooooooVAANSSKCAKIG ooAANoooAGGATSGGNoooENEPNASASVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS GoPSVGATTISPSSSSSLASSSATTTTHNAANSGGNAVNAGNAANVTAAA TQRLQRPHRPCLDFDKMQQVSL MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 12 taxa and 1176 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Taxon 7 -> C7 Taxon 8 -> C8 Taxon 9 -> C9 Taxon 10 -> C10 Taxon 11 -> C11 Taxon 12 -> C12 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1480950810 Setting output file names to "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 575180235 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 4893734343 Seed = 609329663 Swapseed = 1480950810 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 91 unique site patterns Division 2 has 74 unique site patterns Division 3 has 151 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -5424.575111 -- -24.979900 Chain 2 -- -5444.819460 -- -24.979900 Chain 3 -- -5530.068109 -- -24.979900 Chain 4 -- -5464.035588 -- -24.979900 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -5434.613869 -- -24.979900 Chain 2 -- -5389.320037 -- -24.979900 Chain 3 -- -5537.068490 -- -24.979900 Chain 4 -- -5409.574947 -- -24.979900 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-5424.575] (-5444.819) (-5530.068) (-5464.036) * [-5434.614] (-5389.320) (-5537.068) (-5409.575) 500 -- (-3968.354) (-3936.807) (-4004.182) [-3920.537] * [-3954.480] (-3948.143) (-3973.129) (-3971.523) -- 0:33:19 1000 -- (-3876.234) (-3859.166) (-3889.628) [-3838.911] * [-3843.225] (-3865.264) (-3845.863) (-3891.488) -- 0:16:39 1500 -- (-3826.539) (-3811.134) (-3831.583) [-3798.091] * (-3813.955) (-3832.227) [-3820.690] (-3814.494) -- 0:22:11 2000 -- (-3802.843) (-3802.942) [-3799.195] (-3800.132) * (-3813.879) (-3803.270) (-3820.406) [-3804.536] -- 0:16:38 2500 -- (-3802.554) [-3802.565] (-3796.197) (-3803.484) * (-3808.065) [-3805.347] (-3807.155) (-3798.994) -- 0:13:18 3000 -- (-3803.094) (-3808.210) [-3791.172] (-3800.318) * (-3804.736) (-3808.359) [-3810.681] (-3800.180) -- 0:16:37 3500 -- (-3808.845) [-3796.575] (-3791.381) (-3798.256) * (-3807.788) (-3799.933) [-3799.555] (-3799.614) -- 0:14:14 4000 -- (-3801.150) [-3805.221] (-3803.760) (-3808.083) * [-3794.267] (-3801.360) (-3806.242) (-3803.172) -- 0:16:36 4500 -- [-3802.409] (-3804.483) (-3793.589) (-3817.419) * (-3794.971) (-3803.404) (-3800.978) [-3807.130] -- 0:14:44 5000 -- [-3798.425] (-3804.992) (-3799.148) (-3801.931) * (-3794.852) [-3800.961] (-3804.376) (-3804.694) -- 0:13:16 Average standard deviation of split frequencies: 0.048349 5500 -- (-3797.343) (-3798.732) (-3799.722) [-3792.913] * [-3795.320] (-3810.033) (-3796.519) (-3796.766) -- 0:15:04 6000 -- [-3798.916] (-3795.569) (-3800.633) (-3796.553) * [-3804.353] (-3798.872) (-3798.736) (-3808.375) -- 0:13:48 6500 -- (-3799.337) (-3798.692) (-3802.039) [-3796.391] * [-3802.337] (-3802.291) (-3797.200) (-3794.697) -- 0:12:44 7000 -- (-3808.470) (-3797.378) [-3798.137] (-3801.936) * (-3803.153) (-3809.508) [-3798.603] (-3794.005) -- 0:14:11 7500 -- (-3807.885) [-3791.584] (-3802.894) (-3802.295) * [-3799.116] (-3797.962) (-3799.141) (-3796.988) -- 0:13:14 8000 -- [-3793.634] (-3807.759) (-3803.524) (-3797.243) * (-3807.233) [-3792.443] (-3794.733) (-3798.263) -- 0:14:28 8500 -- (-3797.805) (-3812.000) (-3797.916) [-3798.194] * [-3799.372] (-3793.617) (-3802.837) (-3797.597) -- 0:13:36 9000 -- (-3798.827) (-3806.534) (-3794.752) [-3806.250] * (-3812.462) (-3796.620) (-3801.517) [-3798.749] -- 0:12:50 9500 -- [-3795.740] (-3800.922) (-3790.926) (-3806.712) * (-3792.125) (-3796.145) [-3789.984] (-3800.139) -- 0:13:54 10000 -- (-3793.233) (-3796.539) (-3792.331) [-3790.440] * (-3797.189) (-3792.450) (-3801.499) [-3793.463] -- 0:13:12 Average standard deviation of split frequencies: 0.054393 10500 -- (-3798.831) (-3804.330) (-3799.079) [-3796.158] * (-3792.885) [-3806.003] (-3800.775) (-3805.082) -- 0:12:33 11000 -- (-3796.176) (-3795.300) (-3796.212) [-3797.045] * [-3794.813] (-3803.550) (-3795.915) (-3798.954) -- 0:13:29 11500 -- (-3800.628) [-3794.922] (-3797.465) (-3797.200) * (-3807.006) (-3807.818) (-3796.849) [-3797.632] -- 0:12:53 12000 -- (-3793.127) (-3802.075) [-3798.018] (-3796.578) * (-3798.209) (-3800.855) [-3797.867] (-3798.434) -- 0:13:43 12500 -- (-3794.404) (-3800.258) (-3800.814) [-3796.992] * (-3798.030) [-3799.303] (-3799.237) (-3802.568) -- 0:13:10 13000 -- (-3802.495) [-3796.154] (-3804.386) (-3804.586) * [-3788.485] (-3802.625) (-3800.467) (-3804.609) -- 0:12:39 13500 -- [-3794.999] (-3803.434) (-3801.833) (-3814.876) * (-3791.608) (-3799.754) [-3805.220] (-3795.810) -- 0:13:23 14000 -- (-3798.207) (-3800.236) [-3799.148] (-3804.729) * [-3792.603] (-3791.177) (-3805.028) (-3799.374) -- 0:12:54 14500 -- (-3794.819) [-3795.726] (-3803.662) (-3802.573) * (-3805.585) (-3805.507) (-3803.232) [-3798.401] -- 0:13:35 15000 -- (-3805.728) (-3793.485) (-3804.994) [-3791.699] * (-3796.554) (-3803.582) [-3792.507] (-3803.033) -- 0:13:08 Average standard deviation of split frequencies: 0.036828 15500 -- (-3793.980) (-3798.711) (-3810.388) [-3789.964] * (-3800.165) (-3796.399) [-3793.378] (-3798.279) -- 0:12:42 16000 -- (-3797.923) (-3792.692) [-3803.393] (-3794.071) * (-3806.025) [-3799.472] (-3804.249) (-3793.619) -- 0:13:19 16500 -- [-3798.397] (-3806.218) (-3796.555) (-3802.352) * [-3799.243] (-3799.150) (-3807.368) (-3798.487) -- 0:12:54 17000 -- (-3800.142) (-3804.345) [-3796.556] (-3801.680) * (-3800.290) (-3803.849) (-3814.368) [-3791.397] -- 0:12:31 17500 -- (-3803.201) [-3795.073] (-3801.739) (-3799.303) * (-3798.520) (-3798.200) [-3790.028] (-3794.340) -- 0:13:06 18000 -- (-3806.760) (-3796.992) [-3798.010] (-3792.358) * (-3797.813) (-3793.651) [-3792.405] (-3798.849) -- 0:12:43 18500 -- (-3795.881) [-3793.818] (-3805.631) (-3801.891) * (-3805.921) (-3804.770) (-3794.558) [-3798.220] -- 0:13:15 19000 -- (-3802.891) (-3798.544) (-3810.689) [-3799.499] * [-3796.280] (-3800.423) (-3795.142) (-3796.942) -- 0:12:54 19500 -- (-3806.510) [-3798.711] (-3813.776) (-3798.316) * (-3801.819) (-3807.424) (-3799.033) [-3798.155] -- 0:12:34 20000 -- (-3803.368) (-3793.976) (-3798.054) [-3804.456] * (-3799.101) (-3808.558) (-3794.662) [-3796.769] -- 0:13:04 Average standard deviation of split frequencies: 0.015207 20500 -- [-3804.030] (-3795.029) (-3794.758) (-3816.898) * (-3806.297) (-3795.196) (-3815.458) [-3803.834] -- 0:12:44 21000 -- (-3801.608) (-3792.903) (-3797.235) [-3803.085] * (-3795.949) (-3803.213) [-3791.456] (-3799.883) -- 0:12:25 21500 -- [-3794.560] (-3793.263) (-3805.199) (-3804.931) * [-3794.458] (-3805.333) (-3800.964) (-3799.233) -- 0:12:53 22000 -- (-3800.632) [-3792.896] (-3807.867) (-3809.382) * (-3795.117) (-3808.144) (-3796.163) [-3802.022] -- 0:12:35 22500 -- (-3796.437) (-3795.597) [-3792.857] (-3798.866) * (-3796.264) (-3797.019) (-3797.061) [-3793.490] -- 0:13:02 23000 -- (-3795.792) [-3793.896] (-3805.555) (-3797.882) * (-3797.541) [-3797.619] (-3792.491) (-3803.218) -- 0:12:44 23500 -- (-3795.366) (-3812.102) [-3794.961] (-3798.017) * (-3800.179) (-3818.684) [-3793.530] (-3796.297) -- 0:12:27 24000 -- (-3797.464) (-3800.620) (-3791.721) [-3796.187] * [-3786.302] (-3800.528) (-3804.212) (-3792.812) -- 0:12:52 24500 -- (-3796.898) [-3798.481] (-3800.681) (-3799.000) * (-3799.587) (-3801.861) [-3806.811] (-3802.863) -- 0:12:36 25000 -- [-3794.334] (-3798.935) (-3810.546) (-3793.413) * (-3808.761) (-3800.695) (-3790.515) [-3801.605] -- 0:12:21 Average standard deviation of split frequencies: 0.027196 25500 -- [-3797.581] (-3803.441) (-3806.069) (-3795.477) * (-3801.290) (-3797.055) (-3794.704) [-3789.961] -- 0:12:44 26000 -- (-3793.950) (-3801.194) [-3800.001] (-3808.067) * [-3798.240] (-3801.108) (-3802.766) (-3800.628) -- 0:12:29 26500 -- (-3799.037) (-3799.144) (-3796.264) [-3794.325] * (-3807.733) (-3800.766) [-3799.754] (-3798.133) -- 0:12:51 27000 -- [-3797.963] (-3793.574) (-3795.030) (-3799.279) * [-3792.996] (-3800.804) (-3804.146) (-3803.590) -- 0:12:36 27500 -- (-3795.753) [-3795.221] (-3803.843) (-3805.500) * [-3792.970] (-3795.469) (-3809.964) (-3806.424) -- 0:12:22 28000 -- (-3803.628) (-3797.342) [-3792.603] (-3801.857) * [-3792.535] (-3800.209) (-3801.233) (-3796.927) -- 0:12:43 28500 -- (-3809.511) (-3803.452) [-3794.669] (-3793.909) * [-3793.033] (-3791.526) (-3809.404) (-3806.447) -- 0:12:29 29000 -- (-3810.559) (-3799.917) (-3804.680) [-3795.118] * (-3790.328) [-3796.058] (-3812.135) (-3805.576) -- 0:12:16 29500 -- (-3800.963) [-3796.040] (-3797.835) (-3793.408) * (-3797.190) [-3794.578] (-3794.427) (-3799.755) -- 0:12:36 30000 -- (-3801.560) [-3798.167] (-3791.868) (-3796.766) * (-3793.087) [-3795.503] (-3794.533) (-3803.176) -- 0:12:23 Average standard deviation of split frequencies: 0.019215 30500 -- (-3798.232) (-3801.560) [-3804.415] (-3799.706) * (-3806.937) (-3806.218) (-3798.604) [-3804.113] -- 0:12:42 31000 -- [-3795.771] (-3802.194) (-3797.682) (-3798.627) * (-3801.105) [-3792.721] (-3793.076) (-3798.518) -- 0:12:30 31500 -- [-3804.385] (-3792.440) (-3797.406) (-3798.255) * (-3794.289) (-3799.396) [-3797.038] (-3797.322) -- 0:12:17 32000 -- (-3796.495) (-3790.406) [-3793.969] (-3790.354) * (-3800.545) (-3793.818) [-3804.291] (-3808.376) -- 0:12:36 32500 -- (-3804.789) (-3789.488) (-3798.820) [-3796.327] * [-3803.660] (-3799.066) (-3800.447) (-3800.996) -- 0:12:24 33000 -- (-3804.538) [-3796.229] (-3798.137) (-3800.608) * (-3800.851) (-3802.641) [-3797.882] (-3796.230) -- 0:12:41 33500 -- (-3807.653) [-3788.696] (-3792.948) (-3795.213) * (-3802.475) [-3795.139] (-3807.133) (-3806.941) -- 0:12:30 34000 -- (-3802.747) (-3801.975) (-3797.831) [-3795.426] * (-3804.381) (-3794.961) [-3793.164] (-3815.154) -- 0:12:18 34500 -- [-3790.279] (-3804.001) (-3800.475) (-3790.218) * (-3794.376) (-3804.766) [-3793.967] (-3798.805) -- 0:12:35 35000 -- (-3800.907) (-3797.715) (-3797.150) [-3795.383] * [-3799.385] (-3803.214) (-3795.262) (-3804.523) -- 0:12:24 Average standard deviation of split frequencies: 0.005456 35500 -- (-3803.008) [-3797.256] (-3798.622) (-3801.015) * (-3803.071) (-3804.881) [-3798.289] (-3816.880) -- 0:12:13 36000 -- (-3800.663) (-3812.489) [-3797.973] (-3800.481) * (-3800.261) (-3799.449) [-3795.666] (-3799.505) -- 0:12:29 36500 -- (-3799.604) (-3802.135) [-3795.462] (-3806.830) * (-3801.882) (-3803.231) [-3792.969] (-3790.924) -- 0:12:19 37000 -- (-3804.964) (-3804.796) [-3796.949] (-3800.603) * (-3793.110) (-3793.269) [-3792.587] (-3801.652) -- 0:12:34 37500 -- [-3799.526] (-3804.288) (-3802.742) (-3798.442) * [-3791.925] (-3797.369) (-3794.597) (-3794.070) -- 0:12:24 38000 -- (-3798.246) [-3797.000] (-3805.230) (-3796.755) * (-3792.705) (-3800.661) (-3801.563) [-3802.469] -- 0:12:14 38500 -- (-3806.296) [-3791.240] (-3804.368) (-3800.829) * (-3792.199) (-3812.450) (-3798.279) [-3794.030] -- 0:12:29 39000 -- (-3801.574) [-3795.365] (-3804.072) (-3805.775) * (-3797.857) (-3795.942) (-3797.991) [-3798.243] -- 0:12:19 39500 -- (-3810.158) [-3799.543] (-3807.585) (-3800.178) * (-3797.401) (-3805.640) [-3790.524] (-3796.707) -- 0:12:09 40000 -- (-3799.568) (-3793.687) [-3795.147] (-3802.487) * (-3790.547) (-3798.971) [-3796.990] (-3809.108) -- 0:12:24 Average standard deviation of split frequencies: 0.005796 40500 -- [-3798.110] (-3798.347) (-3802.317) (-3795.332) * [-3796.413] (-3802.102) (-3802.284) (-3806.183) -- 0:12:14 41000 -- (-3802.651) (-3802.952) [-3790.652] (-3799.370) * [-3792.297] (-3795.567) (-3802.264) (-3798.199) -- 0:12:28 41500 -- (-3807.783) (-3793.318) (-3791.876) [-3792.864] * (-3787.551) (-3808.548) [-3798.435] (-3805.171) -- 0:12:19 42000 -- (-3796.791) (-3792.655) (-3792.849) [-3803.522] * (-3798.102) (-3800.829) (-3798.434) [-3794.391] -- 0:12:09 42500 -- [-3794.976] (-3794.988) (-3794.725) (-3796.584) * (-3797.797) (-3797.645) (-3796.088) [-3795.282] -- 0:12:23 43000 -- [-3796.136] (-3788.864) (-3801.400) (-3794.419) * (-3794.289) (-3802.986) (-3795.297) [-3798.656] -- 0:12:14 43500 -- (-3795.792) (-3791.448) (-3808.835) [-3796.714] * [-3795.354] (-3800.641) (-3796.350) (-3791.649) -- 0:12:27 44000 -- (-3795.409) [-3790.801] (-3797.901) (-3798.019) * [-3799.301] (-3807.104) (-3801.648) (-3800.297) -- 0:12:18 44500 -- (-3796.522) (-3801.512) [-3794.474] (-3796.465) * (-3797.619) (-3803.750) [-3793.372] (-3796.703) -- 0:12:10 45000 -- (-3807.569) [-3796.775] (-3791.347) (-3810.292) * [-3793.432] (-3812.994) (-3801.845) (-3797.720) -- 0:12:22 Average standard deviation of split frequencies: 0.006832 45500 -- (-3803.266) [-3798.199] (-3791.514) (-3807.173) * (-3802.526) [-3795.352] (-3813.966) (-3812.945) -- 0:12:14 46000 -- (-3793.645) (-3799.162) (-3801.428) [-3798.692] * (-3803.781) (-3800.526) (-3803.491) [-3798.591] -- 0:12:26 46500 -- (-3792.973) [-3795.530] (-3798.141) (-3795.726) * [-3802.408] (-3800.562) (-3807.467) (-3799.309) -- 0:12:18 47000 -- (-3805.337) [-3804.660] (-3798.673) (-3803.406) * (-3808.648) [-3804.170] (-3800.134) (-3805.245) -- 0:12:09 47500 -- [-3792.797] (-3799.672) (-3794.907) (-3794.725) * (-3798.437) (-3798.010) (-3808.589) [-3801.118] -- 0:12:21 48000 -- (-3794.766) (-3804.848) [-3799.015] (-3809.972) * [-3795.176] (-3800.882) (-3798.431) (-3801.452) -- 0:12:13 48500 -- (-3795.670) (-3797.459) [-3799.733] (-3800.089) * (-3798.365) (-3803.993) [-3790.171] (-3801.179) -- 0:12:25 49000 -- (-3802.810) (-3792.617) (-3797.502) [-3802.114] * (-3795.684) [-3792.799] (-3794.757) (-3801.834) -- 0:12:17 49500 -- (-3798.419) (-3796.722) (-3808.681) [-3800.286] * (-3798.816) (-3805.054) [-3799.364] (-3799.337) -- 0:12:09 50000 -- [-3791.254] (-3794.107) (-3802.645) (-3794.077) * (-3803.467) [-3794.524] (-3800.781) (-3797.863) -- 0:12:21 Average standard deviation of split frequencies: 0.008529 50500 -- (-3799.502) [-3800.009] (-3807.582) (-3793.765) * [-3790.516] (-3800.053) (-3799.593) (-3801.711) -- 0:12:13 51000 -- (-3804.362) (-3798.926) (-3795.298) [-3792.317] * (-3796.515) (-3795.131) (-3798.805) [-3803.992] -- 0:12:24 51500 -- (-3793.353) (-3793.696) (-3802.103) [-3798.001] * (-3795.323) (-3800.383) [-3794.049] (-3811.604) -- 0:12:16 52000 -- [-3792.310] (-3798.047) (-3796.066) (-3815.678) * (-3802.041) (-3799.189) (-3793.512) [-3797.596] -- 0:12:09 52500 -- (-3798.846) (-3810.886) (-3793.997) [-3803.408] * (-3794.002) [-3798.488] (-3790.813) (-3798.123) -- 0:12:19 53000 -- (-3798.938) [-3795.973] (-3792.695) (-3799.396) * (-3800.314) (-3801.921) (-3793.675) [-3800.411] -- 0:12:12 53500 -- (-3794.398) (-3799.536) (-3800.436) [-3796.138] * (-3806.195) (-3798.077) [-3792.827] (-3797.899) -- 0:12:05 54000 -- (-3797.524) (-3798.013) [-3793.355] (-3801.895) * (-3806.778) [-3798.458] (-3795.352) (-3795.865) -- 0:12:15 54500 -- (-3802.295) (-3794.677) (-3798.600) [-3790.988] * (-3790.310) [-3798.456] (-3802.409) (-3802.329) -- 0:12:08 55000 -- (-3799.962) [-3796.118] (-3788.897) (-3791.021) * (-3803.781) (-3791.929) [-3798.495] (-3808.501) -- 0:12:18 Average standard deviation of split frequencies: 0.011925 55500 -- [-3800.864] (-3802.872) (-3802.971) (-3794.471) * (-3795.061) [-3794.639] (-3799.231) (-3795.306) -- 0:12:11 56000 -- (-3796.787) (-3801.712) (-3795.261) [-3795.981] * (-3790.523) (-3787.942) [-3796.125] (-3804.057) -- 0:12:04 56500 -- (-3799.771) [-3800.362] (-3795.282) (-3810.202) * [-3798.175] (-3801.177) (-3799.280) (-3796.491) -- 0:12:14 57000 -- (-3797.188) (-3802.083) [-3794.935] (-3794.904) * (-3803.170) (-3810.945) [-3800.582] (-3798.777) -- 0:12:07 57500 -- (-3800.173) (-3803.735) [-3793.014] (-3792.407) * [-3803.586] (-3795.441) (-3807.413) (-3801.059) -- 0:12:17 58000 -- [-3799.815] (-3806.806) (-3792.789) (-3794.356) * (-3794.982) (-3800.029) (-3795.176) [-3798.275] -- 0:12:10 58500 -- (-3796.676) (-3801.806) [-3793.445] (-3799.032) * (-3797.622) (-3806.561) [-3791.885] (-3801.219) -- 0:12:04 59000 -- (-3790.116) [-3792.058] (-3800.756) (-3799.945) * [-3798.946] (-3801.241) (-3794.323) (-3794.251) -- 0:12:13 59500 -- (-3809.689) [-3792.918] (-3803.125) (-3808.444) * [-3793.858] (-3796.450) (-3794.785) (-3799.494) -- 0:12:07 60000 -- (-3801.930) (-3807.820) [-3799.417] (-3803.363) * (-3801.350) [-3795.379] (-3800.924) (-3799.356) -- 0:12:00 Average standard deviation of split frequencies: 0.014246 60500 -- (-3800.497) (-3803.802) [-3791.050] (-3798.960) * [-3797.422] (-3796.677) (-3793.154) (-3795.490) -- 0:12:09 61000 -- [-3801.215] (-3795.925) (-3798.809) (-3800.843) * (-3801.158) (-3808.205) (-3798.131) [-3799.274] -- 0:12:03 61500 -- (-3797.516) [-3796.224] (-3799.322) (-3814.935) * [-3804.371] (-3790.888) (-3794.677) (-3800.100) -- 0:12:12 62000 -- [-3793.207] (-3800.698) (-3799.090) (-3803.884) * (-3791.711) (-3792.167) (-3800.458) [-3796.212] -- 0:12:06 62500 -- (-3804.444) (-3796.425) (-3794.418) [-3801.550] * (-3792.722) [-3790.725] (-3797.073) (-3800.111) -- 0:12:00 63000 -- (-3788.365) (-3799.017) (-3811.903) [-3808.785] * (-3798.189) (-3802.469) [-3795.337] (-3794.335) -- 0:12:08 63500 -- (-3803.415) [-3806.045] (-3801.500) (-3806.049) * [-3794.773] (-3805.264) (-3802.864) (-3804.722) -- 0:12:02 64000 -- (-3795.420) [-3790.910] (-3798.412) (-3804.041) * (-3796.481) (-3798.753) [-3799.788] (-3805.801) -- 0:12:11 64500 -- (-3803.220) (-3796.549) (-3802.243) [-3797.894] * (-3796.156) [-3795.981] (-3794.006) (-3802.135) -- 0:12:05 65000 -- (-3814.136) (-3791.031) [-3803.685] (-3799.578) * [-3793.692] (-3801.599) (-3798.971) (-3810.129) -- 0:11:59 Average standard deviation of split frequencies: 0.014285 65500 -- (-3789.348) [-3792.327] (-3803.154) (-3796.759) * (-3793.266) (-3794.893) [-3793.779] (-3797.433) -- 0:12:07 66000 -- (-3801.076) [-3799.705] (-3797.411) (-3796.762) * (-3796.581) (-3800.887) (-3802.943) [-3793.600] -- 0:12:01 66500 -- (-3795.584) (-3801.702) [-3798.200] (-3806.165) * (-3808.903) (-3807.916) [-3800.492] (-3796.137) -- 0:11:55 67000 -- (-3798.092) (-3802.193) (-3792.490) [-3797.086] * (-3797.898) (-3804.111) [-3794.129] (-3803.473) -- 0:12:04 67500 -- (-3801.889) (-3794.177) (-3796.074) [-3796.729] * [-3804.785] (-3802.949) (-3800.741) (-3801.792) -- 0:11:58 68000 -- [-3797.529] (-3790.461) (-3799.940) (-3806.090) * [-3803.075] (-3808.096) (-3801.939) (-3796.914) -- 0:12:06 68500 -- (-3800.517) [-3798.429] (-3803.232) (-3800.460) * (-3806.979) (-3811.866) [-3799.423] (-3798.020) -- 0:12:00 69000 -- (-3801.138) (-3801.232) (-3803.078) [-3800.197] * (-3801.837) (-3793.364) [-3803.350] (-3802.660) -- 0:11:55 69500 -- (-3796.183) [-3793.451] (-3798.126) (-3805.820) * [-3799.021] (-3795.115) (-3808.035) (-3793.944) -- 0:12:02 70000 -- (-3796.727) [-3806.332] (-3797.822) (-3815.356) * [-3802.278] (-3801.484) (-3800.298) (-3802.619) -- 0:11:57 Average standard deviation of split frequencies: 0.016121 70500 -- (-3802.100) (-3801.023) [-3802.341] (-3805.557) * [-3795.465] (-3798.998) (-3788.351) (-3814.098) -- 0:11:51 71000 -- [-3792.554] (-3798.007) (-3810.665) (-3807.800) * (-3805.890) (-3802.358) [-3795.910] (-3798.041) -- 0:11:59 71500 -- [-3795.432] (-3800.367) (-3795.564) (-3814.256) * [-3797.953] (-3792.645) (-3795.120) (-3795.625) -- 0:11:54 72000 -- (-3791.956) [-3796.671] (-3818.320) (-3809.557) * (-3803.917) (-3794.967) [-3789.512] (-3801.251) -- 0:12:01 72500 -- (-3798.527) [-3794.588] (-3803.338) (-3812.601) * (-3804.150) (-3797.819) (-3791.673) [-3795.469] -- 0:11:56 73000 -- [-3791.536] (-3800.006) (-3801.580) (-3798.566) * (-3798.378) (-3807.456) (-3795.500) [-3795.466] -- 0:11:51 73500 -- (-3798.716) [-3798.177] (-3798.852) (-3797.121) * (-3804.885) (-3802.823) [-3799.840] (-3802.756) -- 0:11:58 74000 -- (-3797.852) [-3796.809] (-3794.146) (-3797.121) * (-3803.126) (-3801.322) (-3802.769) [-3800.088] -- 0:11:53 74500 -- [-3795.524] (-3799.556) (-3799.337) (-3795.468) * (-3800.858) (-3807.178) (-3805.508) [-3796.840] -- 0:12:00 75000 -- (-3795.983) (-3800.465) [-3798.134] (-3796.332) * (-3797.497) (-3796.226) (-3803.226) [-3793.477] -- 0:11:55 Average standard deviation of split frequencies: 0.011888 75500 -- (-3793.028) [-3798.691] (-3806.222) (-3804.976) * (-3797.180) (-3803.954) [-3796.267] (-3792.230) -- 0:11:50 76000 -- (-3800.439) [-3798.574] (-3795.750) (-3803.682) * (-3806.788) [-3792.890] (-3797.075) (-3802.933) -- 0:11:57 76500 -- (-3796.089) (-3793.611) (-3796.563) [-3802.710] * (-3796.276) (-3795.905) [-3791.194] (-3797.235) -- 0:11:52 77000 -- (-3801.360) (-3794.629) (-3796.406) [-3793.462] * (-3800.803) (-3802.840) [-3794.930] (-3799.580) -- 0:11:47 77500 -- (-3795.433) (-3796.317) (-3800.732) [-3796.812] * (-3807.781) (-3809.657) [-3797.814] (-3804.735) -- 0:11:54 78000 -- [-3794.552] (-3796.772) (-3793.548) (-3805.877) * (-3797.161) [-3798.223] (-3798.553) (-3801.390) -- 0:11:49 78500 -- (-3797.547) [-3796.894] (-3801.326) (-3801.599) * (-3798.938) [-3796.498] (-3792.541) (-3796.481) -- 0:11:56 79000 -- [-3790.153] (-3796.595) (-3796.505) (-3795.903) * (-3810.658) (-3794.425) (-3803.975) [-3797.571] -- 0:11:51 79500 -- [-3792.802] (-3794.595) (-3790.115) (-3798.148) * (-3800.051) (-3795.682) [-3796.424] (-3799.973) -- 0:11:46 80000 -- (-3794.488) [-3797.116] (-3796.814) (-3795.662) * (-3803.569) (-3804.448) [-3802.276] (-3795.060) -- 0:11:53 Average standard deviation of split frequencies: 0.016558 80500 -- (-3804.827) (-3797.825) (-3804.835) [-3798.286] * (-3798.476) (-3791.067) [-3794.616] (-3798.844) -- 0:11:48 81000 -- (-3800.434) (-3797.839) (-3801.574) [-3795.884] * (-3811.337) [-3796.562] (-3801.239) (-3791.129) -- 0:11:43 81500 -- (-3798.318) [-3795.102] (-3805.465) (-3793.648) * (-3808.175) (-3798.222) (-3795.029) [-3798.204] -- 0:11:50 82000 -- [-3807.186] (-3796.450) (-3811.222) (-3801.407) * (-3801.914) (-3805.050) [-3793.906] (-3797.870) -- 0:11:45 82500 -- (-3809.445) (-3805.575) [-3796.760] (-3799.251) * [-3802.788] (-3797.754) (-3800.604) (-3801.310) -- 0:11:51 83000 -- (-3805.017) (-3803.860) (-3797.708) [-3798.636] * (-3810.329) (-3798.816) [-3801.564] (-3801.905) -- 0:11:47 83500 -- (-3798.870) (-3801.661) (-3800.233) [-3800.856] * (-3798.761) [-3798.203] (-3798.023) (-3800.802) -- 0:11:42 84000 -- (-3789.772) [-3793.986] (-3799.662) (-3801.995) * (-3798.036) (-3796.262) (-3796.282) [-3801.003] -- 0:11:48 84500 -- (-3797.426) (-3792.960) [-3793.680] (-3803.420) * (-3802.179) (-3802.576) [-3797.134] (-3796.268) -- 0:11:44 85000 -- [-3799.976] (-3807.298) (-3799.000) (-3791.927) * [-3796.617] (-3805.471) (-3799.737) (-3799.354) -- 0:11:50 Average standard deviation of split frequencies: 0.018728 85500 -- (-3805.645) (-3795.672) (-3800.680) [-3791.260] * (-3799.089) (-3797.689) [-3796.997] (-3800.575) -- 0:11:45 86000 -- (-3801.957) [-3791.140] (-3797.745) (-3797.607) * (-3814.142) (-3796.478) [-3794.177] (-3804.838) -- 0:11:41 86500 -- (-3800.498) (-3802.647) (-3814.118) [-3799.587] * (-3794.274) [-3797.704] (-3795.223) (-3802.344) -- 0:11:47 87000 -- (-3805.121) (-3804.969) (-3805.306) [-3792.971] * (-3805.118) (-3803.155) (-3796.558) [-3795.047] -- 0:11:43 87500 -- [-3793.996] (-3807.507) (-3800.347) (-3802.445) * (-3801.224) [-3796.210] (-3802.831) (-3800.991) -- 0:11:38 88000 -- (-3790.008) [-3798.968] (-3806.486) (-3803.683) * (-3801.304) [-3800.733] (-3794.959) (-3801.277) -- 0:11:44 88500 -- (-3789.043) (-3794.235) [-3793.831] (-3795.629) * [-3801.875] (-3795.458) (-3808.506) (-3791.948) -- 0:11:40 89000 -- [-3796.616] (-3802.088) (-3792.376) (-3800.127) * (-3798.075) [-3792.303] (-3798.088) (-3794.489) -- 0:11:46 89500 -- (-3794.803) [-3799.008] (-3813.603) (-3800.546) * [-3799.649] (-3788.967) (-3803.998) (-3796.108) -- 0:11:41 90000 -- [-3793.841] (-3802.548) (-3805.622) (-3802.101) * (-3797.434) (-3804.206) [-3795.641] (-3805.679) -- 0:11:37 Average standard deviation of split frequencies: 0.021231 90500 -- [-3789.907] (-3800.925) (-3805.691) (-3798.700) * [-3800.917] (-3801.603) (-3794.199) (-3797.963) -- 0:11:43 91000 -- (-3796.080) (-3793.938) (-3812.967) [-3803.120] * (-3799.152) [-3800.524] (-3812.484) (-3800.494) -- 0:11:39 91500 -- (-3801.334) (-3795.109) [-3793.349] (-3799.833) * (-3800.884) (-3801.003) [-3793.723] (-3795.490) -- 0:11:35 92000 -- (-3792.449) [-3793.052] (-3799.161) (-3796.813) * [-3802.506] (-3809.125) (-3802.657) (-3805.508) -- 0:11:40 92500 -- (-3807.044) [-3795.455] (-3793.800) (-3805.597) * [-3799.470] (-3793.196) (-3790.508) (-3801.126) -- 0:11:36 93000 -- (-3815.426) (-3802.912) [-3810.969] (-3803.049) * (-3811.547) (-3798.070) [-3797.251] (-3811.989) -- 0:11:42 93500 -- [-3795.716] (-3798.753) (-3804.824) (-3799.625) * [-3792.445] (-3812.164) (-3792.277) (-3806.705) -- 0:11:38 94000 -- (-3796.990) (-3790.729) [-3793.323] (-3801.251) * (-3802.642) (-3801.202) (-3800.727) [-3802.921] -- 0:11:33 94500 -- (-3798.519) (-3801.833) [-3791.488] (-3797.225) * (-3793.674) (-3812.853) [-3802.337] (-3801.550) -- 0:11:39 95000 -- (-3807.393) [-3794.906] (-3802.369) (-3805.092) * [-3799.557] (-3799.908) (-3804.443) (-3798.446) -- 0:11:35 Average standard deviation of split frequencies: 0.022915 95500 -- [-3794.011] (-3795.413) (-3802.958) (-3806.399) * (-3791.508) (-3811.717) [-3791.097] (-3794.289) -- 0:11:40 96000 -- (-3793.035) [-3798.189] (-3806.889) (-3797.209) * (-3793.969) (-3796.414) [-3790.926] (-3806.575) -- 0:11:36 96500 -- (-3794.656) [-3802.409] (-3801.572) (-3794.592) * [-3792.290] (-3795.632) (-3794.043) (-3802.263) -- 0:11:32 97000 -- (-3799.843) (-3798.033) (-3798.348) [-3796.051] * (-3795.950) (-3792.621) [-3795.490] (-3797.507) -- 0:11:38 97500 -- (-3804.180) (-3798.469) (-3799.649) [-3800.430] * (-3811.134) (-3800.199) [-3801.280] (-3797.714) -- 0:11:34 98000 -- (-3803.754) (-3796.091) [-3788.720] (-3800.619) * (-3795.732) (-3793.822) [-3794.855] (-3798.908) -- 0:11:30 98500 -- (-3796.929) [-3801.539] (-3801.739) (-3802.863) * (-3792.217) (-3796.611) (-3792.192) [-3799.285] -- 0:11:35 99000 -- (-3790.424) (-3804.868) [-3790.722] (-3801.478) * [-3793.587] (-3799.790) (-3801.133) (-3797.255) -- 0:11:31 99500 -- (-3792.561) [-3799.986] (-3792.556) (-3791.745) * [-3797.975] (-3801.042) (-3798.337) (-3793.494) -- 0:11:36 100000 -- (-3794.559) (-3795.434) (-3797.470) [-3798.223] * (-3804.018) [-3801.363] (-3795.872) (-3801.764) -- 0:11:33 Average standard deviation of split frequencies: 0.021073 100500 -- (-3804.027) [-3804.266] (-3790.619) (-3798.445) * [-3797.133] (-3796.288) (-3806.151) (-3797.936) -- 0:11:29 101000 -- (-3803.097) [-3800.976] (-3799.178) (-3801.777) * [-3790.416] (-3792.448) (-3802.656) (-3805.235) -- 0:11:34 101500 -- (-3803.282) (-3796.634) (-3805.863) [-3799.264] * (-3788.987) [-3796.823] (-3809.528) (-3804.581) -- 0:11:30 102000 -- (-3796.344) [-3798.256] (-3806.938) (-3797.719) * (-3795.790) [-3798.460] (-3798.151) (-3801.980) -- 0:11:26 102500 -- (-3794.438) (-3799.067) (-3792.941) [-3798.428] * [-3797.608] (-3794.357) (-3802.007) (-3798.947) -- 0:11:31 103000 -- [-3796.271] (-3793.236) (-3796.670) (-3795.738) * (-3801.014) (-3791.897) (-3798.920) [-3800.841] -- 0:11:27 103500 -- [-3794.851] (-3797.923) (-3796.792) (-3801.164) * [-3800.764] (-3807.675) (-3803.114) (-3801.019) -- 0:11:32 104000 -- (-3792.530) (-3797.524) (-3798.812) [-3798.417] * [-3794.169] (-3800.633) (-3806.240) (-3804.571) -- 0:11:29 104500 -- [-3796.846] (-3795.519) (-3797.570) (-3799.504) * (-3804.328) [-3803.007] (-3805.978) (-3812.390) -- 0:11:25 105000 -- (-3807.898) (-3800.058) [-3799.545] (-3807.287) * (-3799.743) (-3792.449) [-3799.226] (-3805.169) -- 0:11:30 Average standard deviation of split frequencies: 0.020383 105500 -- (-3796.709) (-3791.693) (-3810.545) [-3800.094] * [-3795.135] (-3799.214) (-3800.757) (-3800.357) -- 0:11:26 106000 -- (-3799.715) [-3793.221] (-3803.526) (-3797.422) * [-3788.702] (-3798.373) (-3801.683) (-3807.251) -- 0:11:31 106500 -- [-3791.953] (-3801.705) (-3795.123) (-3803.581) * [-3795.166] (-3805.823) (-3801.932) (-3791.598) -- 0:11:27 107000 -- (-3799.141) (-3798.585) (-3799.299) [-3802.824] * (-3795.125) (-3797.567) [-3798.694] (-3795.823) -- 0:11:24 107500 -- (-3797.194) (-3802.400) [-3796.748] (-3797.361) * [-3800.096] (-3801.051) (-3799.096) (-3795.358) -- 0:11:29 108000 -- (-3798.118) (-3794.802) [-3792.251] (-3801.586) * (-3793.746) (-3793.586) [-3801.991] (-3802.718) -- 0:11:25 108500 -- (-3794.243) (-3795.075) (-3803.294) [-3796.999] * (-3793.843) [-3798.463] (-3801.114) (-3812.694) -- 0:11:21 109000 -- (-3802.294) [-3795.430] (-3799.337) (-3793.737) * (-3797.689) [-3795.173] (-3800.451) (-3795.056) -- 0:11:26 109500 -- (-3794.711) [-3794.025] (-3795.334) (-3808.979) * (-3804.835) [-3792.727] (-3797.368) (-3797.025) -- 0:11:23 110000 -- [-3797.747] (-3806.982) (-3809.125) (-3803.568) * (-3806.774) [-3789.188] (-3804.650) (-3807.627) -- 0:11:27 Average standard deviation of split frequencies: 0.016684 110500 -- [-3794.172] (-3800.602) (-3798.343) (-3798.536) * (-3804.582) (-3794.373) [-3798.606] (-3802.560) -- 0:11:24 111000 -- (-3793.063) (-3802.825) (-3791.903) [-3793.276] * [-3800.504] (-3790.802) (-3805.084) (-3795.007) -- 0:11:20 111500 -- (-3796.039) [-3800.784] (-3794.959) (-3801.263) * (-3808.574) [-3789.218] (-3798.233) (-3790.369) -- 0:11:25 112000 -- (-3800.316) (-3800.444) [-3802.167] (-3811.324) * (-3807.428) (-3800.916) [-3799.217] (-3798.248) -- 0:11:21 112500 -- (-3796.111) [-3795.982] (-3804.331) (-3806.761) * (-3799.106) (-3801.409) (-3797.197) [-3796.807] -- 0:11:18 113000 -- (-3798.889) [-3796.767] (-3802.754) (-3809.515) * (-3805.121) (-3792.294) (-3793.264) [-3801.564] -- 0:11:22 113500 -- [-3794.584] (-3795.279) (-3808.558) (-3802.643) * [-3789.345] (-3793.213) (-3805.849) (-3798.031) -- 0:11:19 114000 -- (-3792.893) (-3798.755) [-3803.469] (-3794.465) * [-3791.272] (-3805.099) (-3807.796) (-3794.200) -- 0:11:23 114500 -- [-3790.073] (-3809.327) (-3799.006) (-3792.747) * (-3801.262) (-3805.795) (-3795.947) [-3802.420] -- 0:11:20 115000 -- (-3797.839) (-3803.670) (-3820.056) [-3798.049] * (-3796.362) (-3811.094) [-3799.002] (-3793.920) -- 0:11:17 Average standard deviation of split frequencies: 0.013207 115500 -- (-3804.068) (-3811.956) [-3797.952] (-3792.101) * (-3801.573) (-3802.059) (-3798.708) [-3800.711] -- 0:11:21 116000 -- (-3802.965) (-3806.676) [-3789.305] (-3793.894) * (-3804.828) (-3799.604) (-3823.281) [-3793.036] -- 0:11:18 116500 -- (-3794.669) (-3794.558) [-3793.197] (-3794.328) * (-3798.288) (-3804.537) [-3793.873] (-3797.102) -- 0:11:14 117000 -- (-3811.799) [-3799.658] (-3797.123) (-3792.027) * [-3794.553] (-3800.070) (-3795.920) (-3799.251) -- 0:11:19 117500 -- (-3794.831) [-3792.004] (-3798.787) (-3795.485) * (-3805.429) (-3791.937) (-3804.165) [-3791.567] -- 0:11:15 118000 -- (-3809.666) [-3794.752] (-3794.805) (-3801.742) * (-3794.260) (-3796.490) (-3805.300) [-3790.833] -- 0:11:20 118500 -- (-3797.690) [-3795.453] (-3803.872) (-3804.527) * (-3809.870) [-3794.466] (-3813.785) (-3798.360) -- 0:11:16 119000 -- [-3794.837] (-3792.034) (-3796.703) (-3805.126) * [-3798.364] (-3796.584) (-3804.900) (-3804.816) -- 0:11:13 119500 -- (-3803.406) [-3795.476] (-3793.140) (-3791.117) * (-3795.832) [-3790.833] (-3806.066) (-3799.455) -- 0:11:17 120000 -- (-3800.867) (-3795.224) [-3791.498] (-3796.971) * (-3798.622) [-3793.012] (-3794.273) (-3802.723) -- 0:11:14 Average standard deviation of split frequencies: 0.011069 120500 -- [-3799.622] (-3805.873) (-3794.177) (-3800.642) * (-3806.861) [-3795.831] (-3810.115) (-3810.009) -- 0:11:18 121000 -- [-3798.617] (-3803.840) (-3803.601) (-3802.368) * (-3812.673) (-3802.128) (-3796.627) [-3804.853] -- 0:11:15 121500 -- (-3795.663) [-3794.278] (-3799.319) (-3799.416) * (-3805.836) (-3805.473) (-3805.562) [-3800.978] -- 0:11:12 122000 -- (-3803.747) [-3798.911] (-3797.150) (-3795.663) * (-3802.251) (-3809.247) (-3802.806) [-3795.908] -- 0:11:16 122500 -- (-3796.642) (-3796.609) [-3790.752] (-3802.815) * [-3797.599] (-3808.517) (-3797.311) (-3794.393) -- 0:11:13 123000 -- [-3795.886] (-3810.730) (-3809.010) (-3796.796) * [-3794.589] (-3805.350) (-3798.934) (-3799.736) -- 0:11:10 123500 -- [-3795.727] (-3796.841) (-3805.400) (-3806.430) * [-3790.699] (-3805.916) (-3803.968) (-3797.564) -- 0:11:14 124000 -- (-3794.311) (-3802.898) [-3795.164] (-3794.899) * (-3791.934) (-3808.905) [-3794.026] (-3808.230) -- 0:11:11 124500 -- [-3792.608] (-3807.982) (-3799.703) (-3804.070) * (-3811.133) (-3796.040) [-3795.193] (-3807.888) -- 0:11:15 125000 -- (-3798.091) [-3796.939] (-3807.892) (-3795.748) * (-3805.756) (-3800.480) [-3794.578] (-3794.215) -- 0:11:12 Average standard deviation of split frequencies: 0.010912 125500 -- (-3798.109) (-3799.353) [-3800.870] (-3801.248) * [-3790.835] (-3796.628) (-3795.967) (-3799.064) -- 0:11:08 126000 -- (-3804.926) (-3795.362) (-3807.909) [-3791.680] * (-3807.624) [-3791.374] (-3796.089) (-3798.447) -- 0:11:12 126500 -- (-3807.468) [-3793.969] (-3803.167) (-3803.390) * (-3791.651) (-3801.188) (-3798.719) [-3799.424] -- 0:11:09 127000 -- [-3798.521] (-3794.692) (-3814.270) (-3802.934) * [-3800.443] (-3800.282) (-3794.439) (-3793.339) -- 0:11:13 127500 -- [-3794.071] (-3794.219) (-3798.401) (-3799.751) * (-3794.425) (-3796.982) (-3788.936) [-3792.084] -- 0:11:10 128000 -- (-3795.149) [-3792.670] (-3797.671) (-3795.957) * (-3802.260) (-3791.357) [-3796.506] (-3801.672) -- 0:11:07 128500 -- (-3801.151) (-3794.828) (-3810.357) [-3798.943] * [-3794.876] (-3804.466) (-3795.825) (-3799.374) -- 0:11:11 129000 -- [-3805.450] (-3794.933) (-3809.862) (-3804.051) * (-3799.942) (-3806.680) [-3788.738] (-3800.127) -- 0:11:08 129500 -- (-3800.888) (-3797.095) (-3812.331) [-3793.596] * (-3800.080) [-3800.475] (-3794.782) (-3799.995) -- 0:11:05 130000 -- (-3801.063) [-3795.199] (-3804.262) (-3795.832) * (-3796.839) (-3798.455) (-3793.425) [-3791.640] -- 0:11:09 Average standard deviation of split frequencies: 0.010522 130500 -- (-3796.701) [-3794.710] (-3799.076) (-3799.329) * [-3796.155] (-3806.753) (-3801.081) (-3793.984) -- 0:11:06 131000 -- (-3791.337) (-3805.691) (-3804.101) [-3800.838] * (-3796.234) (-3799.351) (-3794.156) [-3789.138] -- 0:11:09 131500 -- [-3796.447] (-3801.150) (-3809.042) (-3801.093) * (-3800.538) (-3796.316) (-3791.921) [-3798.398] -- 0:11:07 132000 -- (-3795.159) [-3796.687] (-3816.296) (-3794.347) * (-3805.819) (-3799.501) (-3792.958) [-3794.601] -- 0:11:04 132500 -- (-3793.608) (-3793.223) (-3808.797) [-3796.027] * (-3808.837) (-3794.370) [-3802.043] (-3803.868) -- 0:11:07 133000 -- (-3790.022) [-3800.008] (-3824.802) (-3802.272) * (-3798.263) (-3802.284) (-3798.283) [-3788.757] -- 0:11:04 133500 -- [-3806.112] (-3795.451) (-3796.371) (-3800.956) * (-3793.181) (-3792.533) [-3795.467] (-3798.150) -- 0:11:02 134000 -- (-3796.136) (-3799.567) [-3794.631] (-3797.695) * (-3795.635) [-3793.883] (-3791.002) (-3808.751) -- 0:11:05 134500 -- (-3804.767) (-3809.779) (-3797.646) [-3798.451] * (-3794.289) [-3795.485] (-3794.141) (-3798.406) -- 0:11:02 135000 -- (-3793.559) (-3810.585) (-3803.146) [-3795.591] * (-3799.244) (-3802.660) (-3798.390) [-3792.397] -- 0:11:06 Average standard deviation of split frequencies: 0.011554 135500 -- (-3801.843) [-3801.451] (-3809.812) (-3802.269) * (-3806.086) (-3801.965) [-3793.895] (-3793.780) -- 0:11:03 136000 -- (-3795.964) [-3801.827] (-3803.349) (-3803.846) * (-3801.115) [-3807.593] (-3805.011) (-3803.694) -- 0:11:00 136500 -- (-3797.315) (-3797.904) [-3789.072] (-3805.481) * (-3795.668) (-3800.056) (-3795.971) [-3800.691] -- 0:11:04 137000 -- [-3791.408] (-3797.028) (-3797.030) (-3811.035) * [-3799.963] (-3800.465) (-3791.946) (-3793.888) -- 0:11:01 137500 -- (-3803.138) [-3801.333] (-3801.034) (-3803.456) * (-3798.802) [-3797.862] (-3796.169) (-3798.011) -- 0:11:04 138000 -- [-3804.558] (-3795.276) (-3794.961) (-3802.471) * (-3798.902) (-3800.027) (-3804.362) [-3799.673] -- 0:11:02 138500 -- [-3792.931] (-3792.049) (-3813.879) (-3797.136) * (-3797.917) [-3798.406] (-3796.916) (-3796.236) -- 0:10:59 139000 -- [-3797.851] (-3800.664) (-3793.576) (-3796.319) * (-3804.942) (-3796.650) [-3794.586] (-3799.788) -- 0:11:02 139500 -- [-3795.721] (-3800.688) (-3794.365) (-3804.756) * (-3800.888) (-3803.801) (-3795.674) [-3789.895] -- 0:11:00 140000 -- (-3796.063) [-3803.565] (-3801.675) (-3809.455) * (-3801.152) (-3805.665) (-3805.031) [-3793.407] -- 0:10:57 Average standard deviation of split frequencies: 0.009216 140500 -- (-3801.371) (-3800.227) [-3801.558] (-3808.039) * (-3804.441) (-3798.039) [-3794.849] (-3795.645) -- 0:11:00 141000 -- (-3798.399) [-3800.594] (-3795.583) (-3801.589) * (-3804.296) (-3812.446) [-3790.438] (-3795.087) -- 0:10:57 141500 -- [-3796.359] (-3796.690) (-3794.018) (-3814.778) * (-3797.428) (-3796.157) [-3793.808] (-3808.355) -- 0:11:01 142000 -- (-3794.274) (-3798.290) (-3807.932) [-3794.481] * (-3798.154) (-3794.264) [-3793.486] (-3796.759) -- 0:10:58 142500 -- [-3806.426] (-3802.387) (-3800.591) (-3790.578) * [-3793.751] (-3797.061) (-3802.035) (-3807.623) -- 0:10:55 143000 -- (-3801.195) (-3800.955) [-3800.929] (-3800.828) * (-3798.201) (-3804.541) [-3795.972] (-3801.791) -- 0:10:59 143500 -- (-3799.386) [-3799.465] (-3802.004) (-3804.436) * (-3797.487) [-3799.332] (-3807.248) (-3799.132) -- 0:10:56 144000 -- (-3798.368) [-3800.957] (-3801.203) (-3803.558) * (-3799.898) (-3802.258) [-3798.379] (-3801.930) -- 0:10:59 144500 -- (-3801.550) [-3789.973] (-3800.809) (-3793.288) * [-3793.410] (-3797.514) (-3807.710) (-3798.636) -- 0:10:57 145000 -- (-3796.699) (-3803.620) [-3794.306] (-3802.032) * (-3796.999) [-3807.212] (-3797.256) (-3805.775) -- 0:10:54 Average standard deviation of split frequencies: 0.007534 145500 -- [-3791.858] (-3820.484) (-3798.331) (-3797.242) * (-3809.966) [-3800.919] (-3802.916) (-3791.960) -- 0:10:57 146000 -- [-3796.674] (-3801.714) (-3809.005) (-3790.283) * (-3812.244) [-3799.239] (-3813.111) (-3805.413) -- 0:10:55 146500 -- (-3797.660) (-3794.383) (-3804.187) [-3794.516] * (-3810.076) (-3794.262) [-3796.704] (-3791.098) -- 0:10:52 147000 -- (-3800.823) (-3800.363) [-3792.543] (-3808.550) * (-3805.937) (-3801.693) [-3797.501] (-3798.661) -- 0:10:55 147500 -- [-3795.180] (-3792.480) (-3800.498) (-3793.975) * [-3796.382] (-3803.034) (-3799.861) (-3797.940) -- 0:10:53 148000 -- (-3790.577) (-3799.814) (-3790.938) [-3800.265] * (-3791.479) (-3795.679) (-3806.555) [-3797.728] -- 0:10:56 148500 -- (-3801.494) (-3792.407) [-3789.958] (-3800.627) * (-3803.958) (-3799.182) [-3796.218] (-3800.408) -- 0:10:53 149000 -- (-3808.223) [-3794.126] (-3798.476) (-3802.099) * (-3793.874) [-3796.962] (-3801.923) (-3798.964) -- 0:10:51 149500 -- (-3801.643) (-3799.663) [-3794.240] (-3793.164) * (-3794.266) (-3800.504) [-3800.338] (-3801.249) -- 0:10:54 150000 -- (-3804.552) [-3796.951] (-3797.907) (-3802.585) * [-3800.232] (-3795.784) (-3795.044) (-3803.044) -- 0:10:51 Average standard deviation of split frequencies: 0.008083 150500 -- (-3803.514) (-3797.176) (-3803.255) [-3803.164] * (-3794.128) (-3798.924) (-3806.115) [-3791.646] -- 0:10:49 151000 -- (-3806.590) (-3801.286) (-3799.815) [-3798.943] * [-3790.300] (-3799.772) (-3804.579) (-3789.992) -- 0:10:52 151500 -- (-3807.895) (-3800.965) [-3792.561] (-3798.857) * (-3803.225) [-3792.094] (-3794.649) (-3793.191) -- 0:10:49 152000 -- (-3794.649) (-3800.008) [-3807.738] (-3800.395) * (-3816.593) [-3794.291] (-3798.214) (-3794.422) -- 0:10:52 152500 -- (-3794.900) (-3807.612) (-3802.371) [-3801.748] * (-3802.631) [-3796.951] (-3801.939) (-3801.634) -- 0:10:50 153000 -- (-3804.431) (-3794.750) (-3793.767) [-3804.113] * (-3804.653) (-3803.358) (-3799.069) [-3808.822] -- 0:10:47 153500 -- (-3801.453) (-3801.713) [-3791.708] (-3797.737) * [-3797.289] (-3799.315) (-3797.459) (-3794.824) -- 0:10:50 154000 -- [-3795.642] (-3804.520) (-3794.275) (-3810.805) * (-3797.480) [-3796.131] (-3806.399) (-3804.672) -- 0:10:48 154500 -- (-3798.293) (-3802.264) [-3796.220] (-3798.993) * (-3794.284) [-3803.241] (-3800.765) (-3796.226) -- 0:10:51 155000 -- (-3801.640) [-3792.280] (-3811.703) (-3795.365) * [-3792.016] (-3800.590) (-3799.747) (-3797.072) -- 0:10:48 Average standard deviation of split frequencies: 0.007555 155500 -- (-3802.866) (-3798.371) [-3802.364] (-3803.381) * (-3798.929) (-3802.778) (-3799.976) [-3798.949] -- 0:10:46 156000 -- (-3799.748) (-3799.585) [-3786.212] (-3796.898) * (-3806.045) (-3805.142) [-3801.128] (-3804.405) -- 0:10:49 156500 -- (-3802.238) (-3795.921) (-3798.899) [-3804.476] * [-3800.745] (-3800.554) (-3791.861) (-3808.473) -- 0:10:46 157000 -- (-3800.033) (-3801.285) (-3787.542) [-3805.383] * (-3793.775) [-3796.499] (-3799.375) (-3800.313) -- 0:10:44 157500 -- (-3805.977) [-3794.714] (-3805.903) (-3804.973) * [-3788.543] (-3797.332) (-3798.357) (-3801.378) -- 0:10:47 158000 -- (-3799.085) (-3801.019) [-3803.310] (-3802.528) * [-3792.615] (-3794.625) (-3799.732) (-3797.939) -- 0:10:44 158500 -- [-3804.953] (-3801.220) (-3795.647) (-3792.331) * [-3794.426] (-3808.893) (-3801.063) (-3801.740) -- 0:10:47 159000 -- (-3815.424) (-3796.011) (-3805.093) [-3788.421] * (-3792.378) [-3789.536] (-3794.391) (-3808.895) -- 0:10:45 159500 -- (-3807.503) (-3804.684) (-3800.142) [-3796.268] * (-3795.311) (-3791.291) [-3795.918] (-3795.999) -- 0:10:42 160000 -- (-3794.955) (-3801.947) (-3802.693) [-3787.745] * (-3809.047) (-3800.853) [-3790.133] (-3792.292) -- 0:10:45 Average standard deviation of split frequencies: 0.006846 160500 -- [-3792.043] (-3808.008) (-3793.515) (-3795.375) * [-3798.191] (-3794.489) (-3791.954) (-3793.234) -- 0:10:43 161000 -- (-3797.681) (-3810.345) [-3796.407] (-3801.754) * (-3803.618) (-3794.780) [-3789.804] (-3804.096) -- 0:10:46 161500 -- [-3803.647] (-3796.994) (-3802.920) (-3808.508) * (-3793.457) (-3797.297) (-3801.536) [-3801.835] -- 0:10:43 162000 -- (-3807.321) (-3809.437) [-3796.167] (-3795.072) * (-3799.725) (-3800.210) [-3794.154] (-3800.382) -- 0:10:41 162500 -- (-3794.534) (-3811.149) (-3799.283) [-3798.192] * (-3795.388) [-3798.441] (-3798.413) (-3792.294) -- 0:10:44 163000 -- (-3806.044) [-3800.512] (-3806.110) (-3798.534) * (-3797.982) (-3801.000) (-3802.092) [-3797.389] -- 0:10:41 163500 -- (-3793.858) (-3788.871) (-3804.887) [-3794.426] * (-3816.459) (-3795.861) [-3795.708] (-3798.630) -- 0:10:39 164000 -- (-3797.666) [-3797.502] (-3806.854) (-3798.436) * (-3804.009) [-3805.091] (-3794.685) (-3803.063) -- 0:10:42 164500 -- [-3795.155] (-3806.845) (-3802.586) (-3807.747) * [-3800.890] (-3805.764) (-3802.086) (-3805.319) -- 0:10:39 165000 -- (-3797.937) [-3794.085] (-3794.681) (-3804.978) * (-3802.742) [-3800.007] (-3807.781) (-3803.401) -- 0:10:42 Average standard deviation of split frequencies: 0.007573 165500 -- (-3798.692) (-3799.930) (-3790.300) [-3798.014] * (-3800.105) [-3794.483] (-3805.571) (-3804.139) -- 0:10:40 166000 -- (-3797.762) [-3793.942] (-3802.788) (-3791.988) * [-3792.249] (-3796.789) (-3799.754) (-3805.030) -- 0:10:38 166500 -- (-3794.586) (-3796.204) [-3798.507] (-3796.496) * (-3800.455) [-3802.625] (-3804.863) (-3798.109) -- 0:10:40 167000 -- [-3791.463] (-3802.450) (-3790.846) (-3801.804) * (-3795.028) (-3808.861) (-3810.001) [-3794.614] -- 0:10:38 167500 -- (-3805.284) (-3797.362) [-3794.816] (-3793.248) * [-3798.226] (-3806.964) (-3805.294) (-3793.374) -- 0:10:36 168000 -- (-3802.778) (-3797.159) [-3799.602] (-3797.101) * (-3815.975) [-3795.602] (-3802.339) (-3799.963) -- 0:10:38 168500 -- (-3797.766) [-3791.227] (-3801.879) (-3798.042) * (-3801.973) [-3796.533] (-3806.453) (-3795.750) -- 0:10:36 169000 -- (-3795.576) [-3802.120] (-3807.945) (-3800.805) * [-3793.454] (-3798.664) (-3796.057) (-3798.393) -- 0:10:39 169500 -- (-3799.850) [-3798.802] (-3801.524) (-3795.614) * (-3794.634) (-3802.982) (-3799.091) [-3793.222] -- 0:10:36 170000 -- (-3797.582) [-3802.053] (-3804.814) (-3799.638) * (-3792.095) (-3799.275) [-3795.728] (-3801.541) -- 0:10:34 Average standard deviation of split frequencies: 0.004604 170500 -- (-3794.895) (-3808.707) (-3798.545) [-3793.272] * (-3798.432) (-3802.285) [-3793.825] (-3798.737) -- 0:10:37 171000 -- (-3805.825) [-3801.620] (-3800.198) (-3806.510) * (-3804.091) (-3799.834) [-3789.196] (-3795.820) -- 0:10:35 171500 -- (-3812.716) (-3799.750) (-3803.922) [-3805.845] * (-3807.067) [-3796.642] (-3797.744) (-3792.780) -- 0:10:37 172000 -- (-3806.532) (-3798.953) [-3797.298] (-3797.825) * (-3800.807) (-3803.105) [-3794.116] (-3791.644) -- 0:10:35 172500 -- [-3793.302] (-3794.583) (-3795.885) (-3796.268) * (-3795.269) (-3805.219) (-3796.253) [-3800.107] -- 0:10:33 173000 -- (-3792.677) (-3801.223) (-3805.739) [-3793.063] * (-3794.118) (-3803.537) [-3796.189] (-3810.398) -- 0:10:35 173500 -- (-3806.940) [-3797.893] (-3805.049) (-3794.439) * [-3796.391] (-3804.060) (-3797.393) (-3800.285) -- 0:10:33 174000 -- (-3803.674) [-3799.215] (-3799.559) (-3792.134) * (-3800.169) [-3800.330] (-3796.557) (-3795.991) -- 0:10:36 174500 -- (-3813.237) [-3799.624] (-3803.587) (-3796.738) * (-3794.215) [-3790.748] (-3801.212) (-3795.608) -- 0:10:33 175000 -- (-3805.183) (-3798.831) (-3796.683) [-3796.817] * (-3796.385) [-3794.475] (-3809.491) (-3794.253) -- 0:10:31 Average standard deviation of split frequencies: 0.004687 175500 -- [-3800.160] (-3803.915) (-3804.659) (-3801.389) * (-3795.390) (-3792.218) [-3794.979] (-3800.239) -- 0:10:34 176000 -- (-3807.570) [-3795.269] (-3800.832) (-3795.454) * (-3797.902) (-3806.457) [-3791.979] (-3794.886) -- 0:10:32 176500 -- (-3805.772) (-3792.431) (-3797.664) [-3798.199] * (-3808.474) (-3806.056) (-3799.777) [-3801.547] -- 0:10:34 177000 -- (-3805.045) (-3801.875) [-3798.523] (-3799.817) * (-3810.304) (-3806.197) (-3799.344) [-3794.933] -- 0:10:32 177500 -- [-3796.874] (-3804.184) (-3796.962) (-3800.352) * (-3797.500) (-3803.273) [-3796.430] (-3802.139) -- 0:10:30 178000 -- (-3807.732) (-3803.157) [-3800.342] (-3798.906) * [-3790.303] (-3799.629) (-3799.298) (-3790.719) -- 0:10:32 178500 -- (-3804.313) [-3806.501] (-3801.532) (-3798.858) * (-3797.756) (-3797.744) [-3797.914] (-3793.369) -- 0:10:30 179000 -- [-3797.638] (-3799.152) (-3806.194) (-3803.711) * (-3795.612) [-3798.458] (-3799.059) (-3794.860) -- 0:10:32 179500 -- (-3805.940) (-3800.010) (-3798.568) [-3798.170] * [-3793.860] (-3793.243) (-3803.269) (-3797.869) -- 0:10:30 180000 -- [-3805.919] (-3795.976) (-3800.510) (-3805.636) * (-3803.243) (-3799.679) [-3797.956] (-3805.736) -- 0:10:28 Average standard deviation of split frequencies: 0.003914 180500 -- [-3797.580] (-3806.699) (-3796.826) (-3803.233) * (-3802.263) (-3798.153) (-3804.144) [-3800.088] -- 0:10:31 181000 -- [-3792.809] (-3796.499) (-3802.560) (-3801.025) * [-3799.815] (-3806.150) (-3807.670) (-3803.959) -- 0:10:28 181500 -- (-3795.844) (-3800.925) [-3793.949] (-3798.678) * (-3795.686) [-3801.979] (-3806.070) (-3806.364) -- 0:10:31 182000 -- [-3789.348] (-3802.702) (-3799.750) (-3810.550) * [-3795.508] (-3801.253) (-3803.542) (-3802.283) -- 0:10:29 182500 -- (-3795.554) [-3794.228] (-3796.822) (-3797.934) * (-3814.151) (-3798.696) (-3805.746) [-3793.006] -- 0:10:27 183000 -- (-3795.395) [-3796.692] (-3804.066) (-3803.449) * [-3802.437] (-3805.204) (-3807.919) (-3790.712) -- 0:10:29 183500 -- (-3806.502) [-3800.855] (-3803.707) (-3799.742) * (-3795.725) (-3798.511) (-3802.087) [-3794.748] -- 0:10:27 184000 -- (-3797.037) (-3800.846) [-3796.335] (-3801.043) * (-3793.022) (-3793.415) (-3806.627) [-3795.335] -- 0:10:29 184500 -- (-3795.767) [-3790.718] (-3806.628) (-3800.893) * (-3796.384) [-3797.615] (-3804.686) (-3800.255) -- 0:10:27 185000 -- (-3800.826) (-3802.566) (-3811.181) [-3797.305] * (-3794.428) (-3796.109) (-3802.536) [-3801.306] -- 0:10:25 Average standard deviation of split frequencies: 0.004646 185500 -- (-3795.183) [-3796.406] (-3812.000) (-3791.587) * (-3801.730) (-3799.807) [-3801.811] (-3802.367) -- 0:10:27 186000 -- (-3807.274) (-3815.440) [-3800.585] (-3792.090) * (-3801.525) (-3804.575) [-3796.710] (-3799.988) -- 0:10:25 186500 -- [-3801.823] (-3798.715) (-3807.056) (-3796.387) * (-3798.657) (-3809.451) [-3797.104] (-3795.373) -- 0:10:28 187000 -- (-3806.717) [-3802.762] (-3811.061) (-3791.557) * (-3806.546) (-3800.306) (-3792.031) [-3795.950] -- 0:10:26 187500 -- [-3807.639] (-3800.926) (-3808.687) (-3802.886) * [-3796.700] (-3808.835) (-3801.921) (-3798.144) -- 0:10:24 188000 -- [-3797.861] (-3810.378) (-3790.916) (-3798.723) * [-3807.023] (-3805.238) (-3795.750) (-3794.432) -- 0:10:26 188500 -- (-3805.933) (-3802.067) (-3795.086) [-3794.814] * (-3796.040) (-3800.609) (-3801.590) [-3797.357] -- 0:10:24 189000 -- [-3801.356] (-3808.421) (-3794.494) (-3794.452) * (-3793.817) [-3791.896] (-3797.444) (-3797.253) -- 0:10:22 189500 -- [-3792.722] (-3796.308) (-3805.591) (-3796.859) * [-3793.138] (-3795.219) (-3802.345) (-3805.411) -- 0:10:24 190000 -- (-3798.183) (-3807.015) [-3798.566] (-3803.704) * (-3804.698) (-3800.486) (-3802.760) [-3796.134] -- 0:10:22 Average standard deviation of split frequencies: 0.003503 190500 -- (-3800.497) (-3798.714) (-3802.666) [-3798.594] * (-3809.606) (-3789.556) [-3794.924] (-3795.650) -- 0:10:24 191000 -- (-3802.384) (-3797.310) (-3803.638) [-3799.485] * (-3806.615) [-3796.886] (-3801.638) (-3792.202) -- 0:10:22 191500 -- [-3794.848] (-3813.216) (-3799.040) (-3795.684) * (-3804.276) [-3794.039] (-3795.875) (-3804.549) -- 0:10:20 192000 -- (-3800.016) (-3807.331) (-3814.155) [-3795.162] * (-3795.819) (-3793.867) [-3796.940] (-3802.360) -- 0:10:22 192500 -- [-3803.634] (-3800.749) (-3809.411) (-3793.627) * (-3802.213) (-3795.272) (-3794.885) [-3795.570] -- 0:10:20 193000 -- (-3808.941) (-3801.250) [-3797.027] (-3802.573) * [-3799.131] (-3802.819) (-3787.681) (-3808.911) -- 0:10:23 193500 -- (-3797.361) (-3804.267) (-3798.194) [-3794.339] * (-3797.203) [-3789.785] (-3800.123) (-3802.483) -- 0:10:21 194000 -- (-3802.653) (-3807.440) [-3799.467] (-3793.619) * (-3800.039) [-3798.600] (-3814.761) (-3803.112) -- 0:10:19 194500 -- [-3806.693] (-3810.394) (-3798.112) (-3798.720) * (-3798.603) (-3799.300) [-3805.119] (-3797.693) -- 0:10:21 195000 -- (-3798.026) (-3797.571) (-3804.823) [-3798.199] * (-3796.817) (-3801.997) (-3796.639) [-3798.077] -- 0:10:19 Average standard deviation of split frequencies: 0.002806 195500 -- (-3795.743) [-3795.863] (-3796.926) (-3796.070) * (-3807.208) [-3796.576] (-3795.074) (-3805.099) -- 0:10:17 196000 -- (-3800.342) [-3795.325] (-3803.877) (-3807.894) * (-3797.182) [-3797.329] (-3805.703) (-3792.710) -- 0:10:19 196500 -- (-3803.610) (-3795.480) (-3800.193) [-3792.318] * [-3792.753] (-3796.886) (-3799.759) (-3801.461) -- 0:10:17 197000 -- [-3793.488] (-3809.583) (-3805.781) (-3798.803) * (-3793.833) [-3796.558] (-3800.130) (-3809.884) -- 0:10:19 197500 -- (-3799.443) (-3806.986) (-3805.844) [-3797.520] * [-3795.284] (-3810.830) (-3797.653) (-3813.137) -- 0:10:17 198000 -- (-3792.205) [-3802.530] (-3801.063) (-3800.036) * (-3800.333) (-3811.739) (-3797.933) [-3801.634] -- 0:10:15 198500 -- [-3801.275] (-3796.238) (-3795.296) (-3798.707) * (-3800.940) [-3789.392] (-3794.656) (-3799.116) -- 0:10:17 199000 -- [-3795.946] (-3797.199) (-3790.886) (-3801.059) * (-3802.518) (-3792.638) [-3801.523] (-3793.473) -- 0:10:15 199500 -- (-3813.390) (-3790.813) (-3802.917) [-3798.365] * (-3797.307) (-3793.429) (-3802.062) [-3794.303] -- 0:10:17 200000 -- (-3803.840) (-3800.226) [-3800.756] (-3799.526) * [-3799.983] (-3794.019) (-3802.757) (-3793.812) -- 0:10:16 Average standard deviation of split frequencies: 0.003720 200500 -- [-3804.662] (-3795.563) (-3799.219) (-3804.276) * (-3799.907) (-3802.568) (-3797.086) [-3799.017] -- 0:10:14 201000 -- (-3804.152) (-3797.678) (-3795.584) [-3796.744] * (-3796.169) (-3793.243) (-3804.132) [-3798.990] -- 0:10:16 201500 -- (-3798.437) [-3799.212] (-3805.022) (-3801.507) * [-3796.746] (-3800.280) (-3813.944) (-3800.898) -- 0:10:14 202000 -- (-3795.571) [-3794.803] (-3800.575) (-3798.954) * [-3790.481] (-3799.139) (-3803.531) (-3798.446) -- 0:10:12 202500 -- [-3789.882] (-3798.342) (-3801.903) (-3798.511) * (-3794.854) (-3795.413) (-3801.390) [-3796.206] -- 0:10:14 203000 -- [-3796.438] (-3792.002) (-3805.775) (-3801.224) * (-3800.515) (-3798.263) (-3804.166) [-3798.526] -- 0:10:12 203500 -- [-3797.475] (-3795.442) (-3795.000) (-3803.585) * (-3811.187) (-3798.088) (-3803.986) [-3800.046] -- 0:10:14 204000 -- [-3796.514] (-3801.049) (-3809.612) (-3805.963) * (-3807.240) [-3793.473] (-3794.960) (-3799.529) -- 0:10:12 204500 -- [-3794.510] (-3803.456) (-3793.010) (-3806.019) * (-3802.057) [-3793.426] (-3805.470) (-3807.021) -- 0:10:10 205000 -- (-3797.128) (-3796.836) [-3792.900] (-3800.216) * (-3808.374) (-3800.060) [-3793.503] (-3805.763) -- 0:10:12 Average standard deviation of split frequencies: 0.002860 205500 -- (-3793.191) (-3800.520) (-3797.890) [-3791.590] * [-3791.156] (-3811.975) (-3799.799) (-3792.008) -- 0:10:10 206000 -- (-3795.726) [-3803.685] (-3803.549) (-3804.887) * [-3795.227] (-3792.539) (-3800.172) (-3807.433) -- 0:10:12 206500 -- (-3797.454) (-3803.384) [-3794.333] (-3812.757) * (-3802.256) [-3794.260] (-3795.473) (-3805.175) -- 0:10:10 207000 -- (-3804.076) [-3811.936] (-3799.762) (-3801.340) * (-3812.663) (-3797.955) (-3795.871) [-3798.473] -- 0:10:09 207500 -- (-3804.658) [-3800.115] (-3800.698) (-3798.185) * (-3798.156) (-3798.213) [-3790.076] (-3795.758) -- 0:10:11 208000 -- (-3799.911) (-3799.329) [-3796.916] (-3795.303) * (-3808.071) (-3797.373) (-3795.106) [-3799.275] -- 0:10:09 208500 -- (-3805.375) [-3799.859] (-3803.077) (-3790.956) * (-3809.382) (-3800.278) (-3798.575) [-3793.118] -- 0:10:07 209000 -- (-3793.705) (-3795.843) [-3788.575] (-3809.297) * (-3806.827) (-3794.554) (-3804.944) [-3797.199] -- 0:10:09 209500 -- [-3796.870] (-3795.197) (-3790.734) (-3804.898) * (-3801.334) [-3798.454] (-3799.002) (-3793.012) -- 0:10:07 210000 -- (-3792.299) [-3792.827] (-3797.413) (-3794.451) * (-3805.326) [-3794.213] (-3804.513) (-3803.499) -- 0:10:09 Average standard deviation of split frequencies: 0.002797 210500 -- (-3795.611) (-3790.676) (-3795.547) [-3793.500] * (-3815.646) (-3801.811) [-3800.404] (-3798.015) -- 0:10:07 211000 -- (-3794.879) (-3796.189) (-3795.928) [-3805.525] * (-3792.896) (-3797.545) (-3798.264) [-3811.556] -- 0:10:05 211500 -- (-3793.529) (-3794.404) [-3803.076] (-3792.453) * (-3792.383) [-3799.024] (-3799.327) (-3804.938) -- 0:10:07 212000 -- (-3798.396) (-3805.620) [-3799.266] (-3802.119) * (-3804.769) [-3801.054] (-3793.065) (-3800.133) -- 0:10:05 212500 -- (-3803.112) (-3809.810) (-3796.418) [-3797.321] * [-3793.677] (-3798.946) (-3808.749) (-3806.428) -- 0:10:07 213000 -- (-3805.010) (-3806.023) (-3793.705) [-3792.201] * (-3800.151) [-3794.831] (-3811.921) (-3800.034) -- 0:10:05 213500 -- (-3795.709) (-3805.457) [-3795.511] (-3796.644) * (-3807.055) [-3797.855] (-3800.727) (-3802.986) -- 0:10:04 214000 -- (-3802.514) (-3801.108) [-3801.376] (-3796.859) * [-3802.257] (-3799.653) (-3805.810) (-3801.716) -- 0:10:06 214500 -- (-3797.433) (-3804.570) (-3793.818) [-3799.759] * [-3802.347] (-3795.497) (-3799.521) (-3807.021) -- 0:10:04 215000 -- (-3803.630) (-3808.492) [-3805.346] (-3793.771) * [-3799.764] (-3803.580) (-3795.550) (-3804.177) -- 0:10:06 Average standard deviation of split frequencies: 0.002728 215500 -- (-3807.666) (-3797.991) [-3792.073] (-3797.134) * [-3799.269] (-3800.130) (-3799.760) (-3799.382) -- 0:10:04 216000 -- [-3795.423] (-3811.081) (-3798.073) (-3802.683) * (-3813.127) (-3803.684) (-3791.201) [-3794.325] -- 0:10:02 216500 -- (-3798.659) (-3805.744) (-3810.846) [-3802.090] * (-3799.151) (-3816.397) (-3794.418) [-3794.212] -- 0:10:04 217000 -- (-3802.367) (-3795.874) (-3812.572) [-3792.155] * (-3795.413) (-3799.127) [-3801.742] (-3807.836) -- 0:10:02 217500 -- (-3801.329) (-3801.428) (-3804.387) [-3794.247] * (-3795.813) (-3794.701) [-3795.772] (-3800.780) -- 0:10:00 218000 -- (-3795.777) (-3790.512) (-3800.297) [-3796.106] * (-3793.224) (-3799.258) [-3792.429] (-3802.084) -- 0:10:02 218500 -- (-3802.585) (-3800.939) [-3798.854] (-3801.190) * [-3806.723] (-3798.423) (-3796.720) (-3804.189) -- 0:10:00 219000 -- (-3799.347) [-3794.114] (-3797.110) (-3796.846) * (-3801.028) (-3804.274) [-3787.410] (-3804.683) -- 0:10:02 219500 -- (-3801.146) (-3793.302) (-3800.326) [-3793.375] * (-3796.813) [-3800.740] (-3803.680) (-3800.840) -- 0:10:00 220000 -- [-3795.408] (-3796.079) (-3793.047) (-3804.119) * (-3790.997) (-3804.053) (-3797.160) [-3804.359] -- 0:09:59 Average standard deviation of split frequencies: 0.003917 220500 -- [-3789.972] (-3791.596) (-3797.532) (-3799.142) * (-3806.990) (-3816.617) [-3791.705] (-3804.912) -- 0:10:00 221000 -- (-3792.228) (-3796.287) [-3791.219] (-3805.194) * (-3795.037) (-3805.682) [-3794.805] (-3804.521) -- 0:09:59 221500 -- [-3793.206] (-3802.045) (-3800.502) (-3795.286) * (-3795.112) (-3799.363) [-3795.974] (-3817.655) -- 0:10:01 222000 -- [-3799.800] (-3804.705) (-3805.758) (-3797.813) * [-3802.603] (-3803.619) (-3794.739) (-3807.822) -- 0:09:59 222500 -- (-3796.348) (-3805.677) (-3807.681) [-3795.218] * (-3799.844) (-3796.340) (-3796.902) [-3805.170] -- 0:09:57 223000 -- (-3790.082) [-3793.178] (-3797.338) (-3808.731) * [-3791.398] (-3798.680) (-3803.714) (-3800.127) -- 0:09:59 223500 -- [-3794.093] (-3796.025) (-3793.876) (-3797.421) * (-3793.910) [-3799.048] (-3808.168) (-3804.391) -- 0:09:57 224000 -- [-3792.040] (-3797.031) (-3799.451) (-3807.192) * (-3801.383) [-3795.096] (-3793.014) (-3812.741) -- 0:09:55 224500 -- [-3801.953] (-3799.979) (-3795.802) (-3799.903) * (-3798.739) (-3791.126) [-3793.034] (-3811.550) -- 0:09:57 225000 -- (-3799.357) (-3802.160) (-3800.701) [-3796.929] * (-3800.916) [-3804.003] (-3800.810) (-3795.626) -- 0:09:55 Average standard deviation of split frequencies: 0.005562 225500 -- [-3795.379] (-3806.803) (-3801.735) (-3802.223) * (-3791.775) (-3801.586) (-3801.965) [-3794.152] -- 0:09:57 226000 -- (-3793.975) (-3806.047) [-3801.443] (-3812.388) * (-3802.966) [-3793.408] (-3798.765) (-3796.103) -- 0:09:55 226500 -- [-3793.867] (-3805.738) (-3798.984) (-3807.206) * (-3796.709) (-3803.982) [-3797.442] (-3801.520) -- 0:09:54 227000 -- (-3796.989) [-3798.307] (-3805.005) (-3802.041) * (-3799.196) (-3806.572) (-3802.751) [-3798.492] -- 0:09:55 227500 -- [-3793.764] (-3802.024) (-3801.886) (-3805.014) * (-3802.214) (-3797.959) (-3801.782) [-3797.355] -- 0:09:54 228000 -- (-3801.314) [-3792.367] (-3810.197) (-3802.097) * (-3798.400) [-3797.625] (-3790.617) (-3799.812) -- 0:09:55 228500 -- [-3793.038] (-3805.924) (-3809.839) (-3809.849) * (-3805.337) (-3802.800) (-3798.389) [-3799.357] -- 0:09:54 229000 -- [-3796.443] (-3801.243) (-3808.970) (-3797.024) * (-3795.311) (-3800.507) [-3792.783] (-3798.231) -- 0:09:52 229500 -- (-3794.801) (-3796.648) (-3812.895) [-3794.057] * [-3799.371] (-3797.468) (-3805.714) (-3799.683) -- 0:09:54 230000 -- (-3801.663) (-3799.439) (-3801.384) [-3795.865] * (-3797.862) (-3806.877) (-3798.278) [-3795.286] -- 0:09:52 Average standard deviation of split frequencies: 0.004769 230500 -- (-3798.550) (-3805.101) [-3796.470] (-3798.853) * (-3804.240) (-3800.636) [-3793.058] (-3800.542) -- 0:09:50 231000 -- (-3798.266) (-3802.841) [-3795.918] (-3797.982) * (-3799.968) [-3794.060] (-3800.495) (-3812.026) -- 0:09:52 231500 -- (-3814.601) (-3804.850) [-3796.233] (-3799.507) * (-3801.759) [-3798.335] (-3794.957) (-3807.017) -- 0:09:50 232000 -- (-3808.953) (-3807.690) (-3798.145) [-3798.543] * (-3798.757) [-3803.464] (-3795.165) (-3799.781) -- 0:09:52 232500 -- (-3809.979) [-3797.792] (-3803.495) (-3806.985) * [-3792.404] (-3800.659) (-3801.340) (-3794.919) -- 0:09:50 233000 -- [-3801.331] (-3795.025) (-3802.000) (-3799.023) * (-3796.090) (-3804.122) (-3799.154) [-3803.884] -- 0:09:49 233500 -- (-3791.783) (-3807.983) (-3799.170) [-3809.961] * [-3793.812] (-3798.013) (-3797.737) (-3802.824) -- 0:09:50 234000 -- (-3797.981) (-3807.055) [-3791.619] (-3803.709) * [-3796.489] (-3797.484) (-3804.452) (-3799.798) -- 0:09:49 234500 -- [-3792.586] (-3810.449) (-3801.486) (-3806.658) * [-3799.216] (-3802.111) (-3798.325) (-3815.753) -- 0:09:50 235000 -- (-3801.666) (-3799.495) (-3805.641) [-3794.406] * (-3797.128) (-3797.599) (-3795.051) [-3798.032] -- 0:09:49 Average standard deviation of split frequencies: 0.006825 235500 -- [-3790.897] (-3802.287) (-3800.933) (-3804.243) * (-3804.485) (-3791.046) (-3801.898) [-3791.600] -- 0:09:47 236000 -- (-3790.157) (-3799.161) [-3802.664] (-3805.531) * (-3811.672) (-3797.547) (-3795.903) [-3796.514] -- 0:09:49 236500 -- (-3792.058) (-3807.088) (-3806.156) [-3801.191] * (-3804.313) [-3798.507] (-3803.643) (-3792.565) -- 0:09:47 237000 -- (-3798.680) [-3798.043] (-3793.135) (-3800.778) * (-3799.112) (-3795.387) [-3802.605] (-3797.204) -- 0:09:49 237500 -- (-3803.545) (-3801.469) (-3797.109) [-3796.267] * [-3797.466] (-3800.901) (-3811.542) (-3795.615) -- 0:09:47 238000 -- (-3799.341) (-3806.633) (-3797.419) [-3797.989] * (-3794.075) (-3799.868) (-3803.349) [-3792.815] -- 0:09:45 238500 -- (-3797.238) (-3805.461) [-3803.495] (-3798.927) * [-3791.306] (-3802.386) (-3816.541) (-3797.479) -- 0:09:47 239000 -- (-3793.074) [-3802.266] (-3799.253) (-3804.551) * (-3793.525) (-3803.574) [-3796.028] (-3797.516) -- 0:09:45 239500 -- [-3789.929] (-3793.817) (-3801.876) (-3803.219) * (-3795.546) (-3800.667) (-3806.933) [-3795.122] -- 0:09:44 240000 -- [-3799.109] (-3791.703) (-3804.313) (-3803.157) * (-3805.356) [-3802.593] (-3811.186) (-3796.858) -- 0:09:45 Average standard deviation of split frequencies: 0.006366 240500 -- [-3792.466] (-3792.382) (-3809.085) (-3808.262) * (-3799.662) [-3798.235] (-3806.434) (-3803.022) -- 0:09:44 241000 -- (-3794.231) (-3808.480) (-3797.804) [-3797.198] * [-3792.541] (-3805.710) (-3798.064) (-3804.041) -- 0:09:45 241500 -- (-3798.957) [-3793.334] (-3804.255) (-3797.721) * [-3790.982] (-3804.206) (-3795.205) (-3795.219) -- 0:09:44 242000 -- [-3794.817] (-3803.154) (-3811.632) (-3802.489) * (-3796.056) (-3799.096) [-3796.560] (-3806.195) -- 0:09:42 242500 -- (-3797.995) [-3799.668] (-3802.716) (-3793.218) * [-3805.962] (-3802.097) (-3799.190) (-3806.090) -- 0:09:44 243000 -- [-3795.550] (-3797.886) (-3802.766) (-3800.891) * (-3805.568) [-3798.525] (-3797.991) (-3802.281) -- 0:09:42 243500 -- (-3793.729) [-3808.600] (-3796.837) (-3807.152) * (-3809.742) (-3806.659) [-3790.108] (-3800.365) -- 0:09:44 244000 -- (-3793.474) [-3792.154] (-3800.528) (-3800.499) * (-3805.757) [-3803.074] (-3793.447) (-3797.605) -- 0:09:42 244500 -- (-3797.068) (-3805.162) [-3797.723] (-3801.982) * (-3800.558) [-3800.997] (-3803.728) (-3798.322) -- 0:09:40 245000 -- [-3792.455] (-3805.547) (-3809.344) (-3802.373) * (-3799.326) [-3790.715] (-3797.931) (-3804.588) -- 0:09:42 Average standard deviation of split frequencies: 0.008464 245500 -- (-3806.123) (-3799.607) [-3803.676] (-3805.951) * (-3791.402) (-3802.267) [-3794.306] (-3789.095) -- 0:09:40 246000 -- (-3792.940) (-3802.540) [-3799.609] (-3795.295) * (-3796.426) (-3818.738) [-3798.501] (-3803.200) -- 0:09:42 246500 -- (-3801.559) (-3793.741) (-3793.300) [-3796.143] * (-3791.935) [-3797.471] (-3795.493) (-3796.012) -- 0:09:40 247000 -- [-3794.548] (-3804.027) (-3805.417) (-3796.216) * (-3811.740) (-3806.919) [-3801.147] (-3801.946) -- 0:09:39 247500 -- (-3804.364) (-3802.567) (-3800.128) [-3791.531] * [-3800.530] (-3794.599) (-3801.636) (-3802.223) -- 0:09:40 248000 -- (-3816.226) (-3796.863) (-3803.850) [-3789.322] * (-3798.209) [-3795.570] (-3797.265) (-3808.331) -- 0:09:39 248500 -- (-3801.843) (-3802.573) [-3791.709] (-3809.672) * [-3798.620] (-3799.643) (-3801.086) (-3801.880) -- 0:09:40 249000 -- (-3806.388) (-3797.346) [-3792.741] (-3802.021) * (-3797.292) (-3796.780) (-3805.623) [-3796.817] -- 0:09:39 249500 -- (-3800.968) [-3801.688] (-3802.766) (-3796.585) * (-3803.916) (-3794.202) [-3797.931] (-3800.839) -- 0:09:37 250000 -- (-3805.111) (-3794.606) [-3801.664] (-3799.766) * (-3796.090) (-3796.199) [-3801.053] (-3811.079) -- 0:09:39 Average standard deviation of split frequencies: 0.008149 250500 -- [-3802.139] (-3798.563) (-3805.087) (-3808.716) * (-3793.512) [-3793.853] (-3796.390) (-3795.482) -- 0:09:37 251000 -- (-3797.111) [-3793.288] (-3802.009) (-3808.567) * (-3803.983) [-3797.502] (-3789.284) (-3793.259) -- 0:09:35 251500 -- [-3789.439] (-3797.018) (-3800.853) (-3810.401) * (-3794.327) (-3800.085) (-3792.019) [-3791.596] -- 0:09:37 252000 -- (-3794.914) (-3802.564) [-3793.701] (-3809.797) * (-3808.964) (-3800.128) (-3790.978) [-3800.649] -- 0:09:35 252500 -- [-3795.069] (-3804.212) (-3807.999) (-3799.026) * (-3794.532) (-3794.084) (-3795.102) [-3795.633] -- 0:09:37 253000 -- [-3805.827] (-3803.510) (-3809.549) (-3798.696) * (-3795.495) (-3802.856) (-3803.072) [-3799.344] -- 0:09:35 253500 -- (-3796.541) [-3793.792] (-3798.354) (-3792.796) * (-3794.423) (-3794.443) [-3798.949] (-3800.665) -- 0:09:34 254000 -- (-3798.252) (-3801.210) [-3795.244] (-3802.881) * (-3797.846) (-3803.431) [-3798.333] (-3801.364) -- 0:09:35 254500 -- (-3805.347) (-3799.955) [-3799.586] (-3797.797) * (-3796.994) (-3798.470) [-3801.149] (-3811.807) -- 0:09:34 255000 -- [-3793.692] (-3798.542) (-3810.877) (-3796.412) * (-3797.190) [-3792.300] (-3795.154) (-3798.009) -- 0:09:35 Average standard deviation of split frequencies: 0.008900 255500 -- (-3801.243) (-3807.744) [-3795.442] (-3792.448) * (-3800.198) (-3794.544) [-3792.268] (-3801.688) -- 0:09:34 256000 -- (-3790.262) (-3793.190) (-3807.470) [-3794.640] * (-3792.406) [-3799.071] (-3798.826) (-3805.522) -- 0:09:32 256500 -- (-3794.848) [-3795.965] (-3801.690) (-3794.946) * (-3800.460) (-3794.519) [-3795.122] (-3798.146) -- 0:09:33 257000 -- [-3792.820] (-3800.485) (-3797.709) (-3794.125) * (-3802.900) [-3797.858] (-3792.290) (-3803.036) -- 0:09:32 257500 -- (-3805.392) (-3801.070) (-3803.776) [-3797.181] * (-3803.136) (-3802.923) [-3797.503] (-3800.105) -- 0:09:33 258000 -- (-3802.005) (-3795.667) (-3811.560) [-3795.772] * [-3798.936] (-3800.393) (-3809.156) (-3800.341) -- 0:09:32 258500 -- (-3806.386) (-3797.980) (-3792.213) [-3788.158] * (-3802.660) (-3808.650) (-3796.415) [-3795.696] -- 0:09:30 259000 -- (-3796.977) (-3800.483) (-3802.891) [-3796.579] * (-3803.430) (-3800.327) [-3797.462] (-3797.056) -- 0:09:32 259500 -- (-3795.626) (-3790.687) [-3793.068] (-3793.364) * (-3793.157) [-3796.765] (-3798.585) (-3794.860) -- 0:09:30 260000 -- (-3802.820) (-3796.533) [-3797.307] (-3811.128) * (-3803.949) (-3806.601) (-3793.456) [-3797.680] -- 0:09:32 Average standard deviation of split frequencies: 0.008892 260500 -- (-3797.130) (-3804.071) (-3799.927) [-3796.412] * (-3799.773) (-3796.017) (-3797.098) [-3794.180] -- 0:09:30 261000 -- [-3798.683] (-3802.493) (-3795.743) (-3805.219) * [-3795.836] (-3801.636) (-3802.765) (-3805.553) -- 0:09:29 261500 -- (-3795.411) (-3801.414) [-3799.375] (-3802.561) * (-3797.233) (-3794.190) (-3797.939) [-3798.817] -- 0:09:30 262000 -- (-3801.198) (-3795.903) [-3805.456] (-3802.309) * [-3793.607] (-3799.527) (-3800.257) (-3798.419) -- 0:09:28 262500 -- (-3794.853) (-3797.713) (-3792.942) [-3796.752] * (-3794.082) [-3797.093] (-3797.833) (-3804.976) -- 0:09:27 263000 -- (-3808.032) [-3788.578] (-3798.156) (-3800.914) * [-3796.833] (-3802.851) (-3796.907) (-3796.522) -- 0:09:28 263500 -- (-3800.537) (-3819.187) (-3794.576) [-3801.886] * (-3790.376) (-3806.545) (-3797.173) [-3797.544] -- 0:09:27 264000 -- (-3809.390) (-3797.172) (-3797.285) [-3795.936] * (-3795.032) (-3818.329) (-3794.685) [-3795.058] -- 0:09:28 264500 -- [-3797.621] (-3799.711) (-3794.827) (-3791.830) * (-3796.147) (-3821.594) [-3794.098] (-3808.144) -- 0:09:27 265000 -- [-3796.988] (-3791.717) (-3796.976) (-3794.412) * [-3797.456] (-3805.169) (-3797.207) (-3794.934) -- 0:09:25 Average standard deviation of split frequencies: 0.009599 265500 -- (-3804.008) [-3793.528] (-3799.110) (-3800.566) * (-3803.447) (-3798.610) (-3792.477) [-3797.396] -- 0:09:27 266000 -- [-3800.934] (-3789.336) (-3801.897) (-3800.213) * (-3791.583) (-3793.165) (-3795.234) [-3799.451] -- 0:09:25 266500 -- (-3797.665) [-3792.671] (-3797.806) (-3794.770) * (-3799.337) (-3803.904) [-3797.657] (-3803.390) -- 0:09:26 267000 -- (-3812.704) (-3802.149) (-3809.373) [-3793.385] * [-3801.872] (-3805.290) (-3814.401) (-3793.792) -- 0:09:25 267500 -- (-3807.410) [-3797.714] (-3800.988) (-3803.883) * (-3802.715) (-3797.349) [-3800.702] (-3797.538) -- 0:09:24 268000 -- (-3799.387) (-3806.919) (-3804.977) [-3801.607] * (-3797.829) (-3807.669) [-3804.189] (-3802.782) -- 0:09:25 268500 -- (-3799.784) (-3805.205) (-3803.057) [-3803.303] * [-3796.236] (-3792.391) (-3795.683) (-3802.864) -- 0:09:23 269000 -- (-3803.214) [-3792.496] (-3791.928) (-3807.587) * (-3797.911) (-3798.736) (-3796.465) [-3799.240] -- 0:09:25 269500 -- [-3803.273] (-3797.531) (-3799.470) (-3800.308) * [-3799.384] (-3796.755) (-3801.702) (-3794.856) -- 0:09:23 270000 -- (-3806.446) (-3806.028) (-3798.194) [-3799.064] * [-3788.399] (-3798.976) (-3801.793) (-3791.193) -- 0:09:22 Average standard deviation of split frequencies: 0.010160 270500 -- [-3796.995] (-3798.155) (-3796.920) (-3808.399) * (-3802.218) [-3798.631] (-3795.256) (-3797.016) -- 0:09:23 271000 -- (-3801.305) [-3789.888] (-3799.369) (-3791.781) * (-3799.484) [-3794.513] (-3805.032) (-3792.815) -- 0:09:22 271500 -- (-3805.745) (-3790.870) (-3794.929) [-3797.390] * (-3800.871) (-3795.274) [-3793.648] (-3807.900) -- 0:09:20 272000 -- (-3801.227) (-3799.974) (-3812.282) [-3800.581] * (-3800.780) [-3794.601] (-3796.816) (-3808.438) -- 0:09:22 272500 -- (-3809.900) [-3800.853] (-3800.536) (-3800.136) * (-3791.161) (-3796.284) [-3790.560] (-3795.885) -- 0:09:20 273000 -- [-3792.297] (-3792.906) (-3799.537) (-3798.116) * [-3800.051] (-3795.348) (-3794.271) (-3796.612) -- 0:09:21 273500 -- [-3810.210] (-3800.391) (-3805.652) (-3791.989) * (-3795.538) [-3794.154] (-3797.655) (-3798.511) -- 0:09:20 274000 -- (-3809.680) [-3799.265] (-3795.298) (-3797.545) * (-3797.724) (-3795.232) [-3796.911] (-3795.246) -- 0:09:19 274500 -- (-3794.771) (-3800.549) (-3802.764) [-3793.643] * (-3791.621) (-3804.265) (-3798.736) [-3796.767] -- 0:09:20 275000 -- [-3790.047] (-3796.563) (-3805.257) (-3794.793) * (-3799.630) (-3794.993) [-3797.020] (-3801.068) -- 0:09:18 Average standard deviation of split frequencies: 0.010960 275500 -- (-3795.774) (-3791.745) (-3815.007) [-3797.022] * [-3792.699] (-3791.074) (-3796.987) (-3802.892) -- 0:09:20 276000 -- (-3797.043) [-3793.718] (-3807.297) (-3799.720) * [-3791.646] (-3798.950) (-3801.292) (-3796.760) -- 0:09:18 276500 -- (-3804.761) [-3798.135] (-3801.550) (-3799.809) * [-3795.416] (-3804.184) (-3802.402) (-3793.615) -- 0:09:17 277000 -- [-3805.667] (-3799.985) (-3801.803) (-3798.687) * (-3801.368) [-3794.394] (-3791.644) (-3795.879) -- 0:09:18 277500 -- (-3791.087) [-3799.637] (-3799.940) (-3792.756) * (-3799.527) (-3801.435) (-3799.691) [-3794.342] -- 0:09:17 278000 -- (-3794.289) (-3797.574) [-3797.433] (-3806.847) * (-3803.580) (-3798.880) (-3798.630) [-3793.034] -- 0:09:15 278500 -- (-3799.102) (-3801.086) [-3789.231] (-3808.323) * [-3795.883] (-3801.338) (-3803.553) (-3794.184) -- 0:09:16 279000 -- (-3798.368) (-3802.487) (-3793.104) [-3804.940] * (-3801.848) [-3807.416] (-3804.940) (-3795.720) -- 0:09:15 279500 -- (-3792.528) (-3796.552) (-3808.330) [-3798.509] * (-3798.049) (-3802.497) [-3794.688] (-3804.564) -- 0:09:16 280000 -- (-3797.537) [-3802.030] (-3794.111) (-3794.788) * (-3791.917) [-3801.519] (-3795.137) (-3799.074) -- 0:09:15 Average standard deviation of split frequencies: 0.010917 280500 -- [-3795.584] (-3792.854) (-3795.068) (-3792.910) * (-3797.006) (-3804.410) (-3800.610) [-3792.465] -- 0:09:14 281000 -- [-3788.553] (-3803.325) (-3798.952) (-3789.132) * (-3796.949) (-3800.601) [-3792.995] (-3794.527) -- 0:09:15 281500 -- (-3794.707) (-3806.727) (-3799.365) [-3793.193] * [-3795.871] (-3799.396) (-3808.504) (-3802.226) -- 0:09:13 282000 -- (-3802.467) [-3793.361] (-3813.983) (-3798.884) * (-3809.610) [-3801.010] (-3794.096) (-3803.988) -- 0:09:15 282500 -- (-3803.913) (-3793.889) (-3799.526) [-3802.224] * (-3808.747) (-3797.557) (-3806.002) [-3799.685] -- 0:09:13 283000 -- (-3807.450) (-3806.129) [-3796.685] (-3796.832) * [-3796.448] (-3799.622) (-3802.320) (-3803.372) -- 0:09:12 283500 -- (-3801.073) [-3796.646] (-3809.804) (-3801.715) * (-3802.678) (-3795.260) (-3805.268) [-3801.415] -- 0:09:13 284000 -- (-3804.221) (-3799.019) [-3791.172] (-3796.965) * [-3795.353] (-3798.365) (-3802.359) (-3816.153) -- 0:09:12 284500 -- (-3797.829) (-3793.644) [-3796.020] (-3801.596) * [-3803.726] (-3802.816) (-3792.347) (-3793.001) -- 0:09:10 285000 -- (-3801.825) (-3793.350) [-3798.411] (-3802.421) * (-3808.169) (-3826.645) (-3797.219) [-3801.853] -- 0:09:11 Average standard deviation of split frequencies: 0.011675 285500 -- (-3795.135) (-3800.473) (-3801.674) [-3793.311] * (-3795.019) (-3796.689) (-3804.616) [-3799.492] -- 0:09:10 286000 -- [-3798.574] (-3792.844) (-3811.362) (-3800.268) * (-3796.179) [-3796.722] (-3795.175) (-3802.464) -- 0:09:11 286500 -- (-3790.335) [-3793.433] (-3804.015) (-3797.917) * [-3792.187] (-3796.760) (-3796.069) (-3799.318) -- 0:09:10 287000 -- [-3789.738] (-3799.045) (-3793.727) (-3812.509) * (-3796.615) (-3808.586) (-3800.098) [-3794.258] -- 0:09:11 287500 -- (-3794.943) [-3791.046] (-3794.893) (-3802.064) * (-3801.002) [-3799.864] (-3794.703) (-3798.389) -- 0:09:10 288000 -- (-3795.936) (-3801.272) [-3796.712] (-3800.908) * (-3802.229) [-3794.579] (-3799.013) (-3797.659) -- 0:09:08 288500 -- (-3802.792) (-3801.338) [-3797.867] (-3802.195) * [-3794.453] (-3800.959) (-3800.856) (-3805.682) -- 0:09:09 289000 -- (-3806.049) (-3807.937) (-3798.945) [-3797.494] * [-3792.705] (-3789.957) (-3804.777) (-3799.454) -- 0:09:08 289500 -- [-3804.109] (-3793.332) (-3796.106) (-3800.737) * [-3794.909] (-3795.429) (-3797.115) (-3794.704) -- 0:09:09 290000 -- (-3801.559) (-3804.795) (-3795.209) [-3802.346] * (-3799.363) (-3792.608) (-3794.844) [-3794.847] -- 0:09:08 Average standard deviation of split frequencies: 0.010677 290500 -- [-3798.144] (-3797.693) (-3807.747) (-3802.612) * (-3802.063) (-3796.811) (-3800.859) [-3790.149] -- 0:09:09 291000 -- (-3798.134) (-3792.269) [-3796.582] (-3811.765) * (-3801.122) [-3795.421] (-3803.463) (-3800.836) -- 0:09:08 291500 -- (-3808.741) [-3804.022] (-3795.549) (-3804.445) * [-3799.300] (-3808.637) (-3793.452) (-3800.532) -- 0:09:09 292000 -- [-3787.967] (-3794.117) (-3792.724) (-3794.420) * (-3796.031) [-3793.728] (-3796.899) (-3801.895) -- 0:09:07 292500 -- (-3797.708) (-3800.668) (-3796.384) [-3800.783] * [-3794.856] (-3795.039) (-3796.882) (-3797.987) -- 0:09:06 293000 -- [-3802.449] (-3795.193) (-3804.168) (-3800.378) * (-3794.467) [-3793.314] (-3801.751) (-3800.656) -- 0:09:07 293500 -- (-3798.943) (-3804.706) (-3803.219) [-3793.857] * (-3796.170) [-3794.001] (-3797.514) (-3802.171) -- 0:09:06 294000 -- [-3801.859] (-3799.791) (-3810.258) (-3801.435) * (-3798.944) (-3792.663) (-3799.880) [-3805.086] -- 0:09:07 294500 -- (-3799.532) (-3796.385) (-3805.654) [-3801.770] * (-3809.862) [-3801.247] (-3796.413) (-3813.356) -- 0:09:06 295000 -- (-3804.824) [-3800.860] (-3812.841) (-3793.894) * (-3804.807) (-3805.114) [-3794.462] (-3806.004) -- 0:09:04 Average standard deviation of split frequencies: 0.009821 295500 -- (-3797.875) (-3799.084) (-3812.599) [-3797.757] * (-3808.326) [-3798.912] (-3797.433) (-3799.591) -- 0:09:05 296000 -- [-3794.550] (-3796.582) (-3792.256) (-3798.581) * (-3802.883) [-3794.173] (-3791.230) (-3810.491) -- 0:09:04 296500 -- (-3796.839) [-3793.836] (-3795.207) (-3805.978) * (-3802.157) (-3800.506) [-3797.702] (-3798.160) -- 0:09:05 297000 -- (-3799.077) [-3796.314] (-3801.905) (-3799.366) * (-3799.912) (-3798.039) [-3793.379] (-3805.636) -- 0:09:04 297500 -- (-3795.773) [-3801.900] (-3796.699) (-3793.676) * (-3800.901) (-3795.326) (-3793.058) [-3790.906] -- 0:09:03 298000 -- [-3795.185] (-3797.858) (-3809.450) (-3801.813) * [-3795.627] (-3800.078) (-3796.081) (-3791.743) -- 0:09:04 298500 -- [-3795.397] (-3796.426) (-3802.231) (-3799.853) * (-3797.991) (-3802.687) [-3797.387] (-3791.160) -- 0:09:02 299000 -- (-3805.625) (-3792.616) (-3795.805) [-3790.008] * [-3796.442] (-3807.655) (-3798.594) (-3791.272) -- 0:09:03 299500 -- (-3805.746) (-3805.392) [-3794.068] (-3792.418) * (-3800.576) (-3804.081) (-3796.453) [-3792.437] -- 0:09:02 300000 -- (-3800.864) (-3794.906) (-3794.301) [-3794.354] * (-3798.176) (-3800.322) [-3804.326] (-3803.872) -- 0:09:03 Average standard deviation of split frequencies: 0.009015 300500 -- (-3800.767) [-3802.490] (-3804.354) (-3807.458) * (-3797.765) (-3798.581) [-3798.682] (-3798.493) -- 0:09:02 301000 -- [-3797.566] (-3801.540) (-3798.461) (-3806.526) * (-3803.801) (-3795.633) [-3796.342] (-3803.636) -- 0:09:01 301500 -- (-3796.510) (-3808.942) [-3802.093] (-3808.503) * [-3792.918] (-3804.304) (-3798.125) (-3798.886) -- 0:09:02 302000 -- [-3795.526] (-3808.122) (-3800.576) (-3803.601) * (-3794.359) (-3813.073) [-3796.610] (-3800.876) -- 0:09:00 302500 -- (-3804.173) [-3793.606] (-3792.021) (-3802.751) * (-3803.341) (-3806.803) (-3796.560) [-3798.544] -- 0:09:01 303000 -- (-3804.861) (-3799.877) (-3792.215) [-3812.861] * [-3798.437] (-3796.893) (-3803.434) (-3807.575) -- 0:09:00 303500 -- (-3804.707) [-3797.460] (-3803.937) (-3805.959) * [-3797.969] (-3805.215) (-3797.962) (-3800.381) -- 0:08:59 304000 -- (-3801.507) [-3791.950] (-3800.495) (-3793.885) * (-3793.769) (-3802.953) [-3797.445] (-3804.061) -- 0:09:00 304500 -- (-3803.079) [-3799.898] (-3798.107) (-3803.746) * [-3796.647] (-3814.093) (-3803.077) (-3802.036) -- 0:08:59 305000 -- (-3808.016) (-3805.875) [-3801.270] (-3802.927) * (-3791.131) (-3806.673) [-3800.499] (-3795.399) -- 0:09:00 Average standard deviation of split frequencies: 0.008088 305500 -- (-3803.147) (-3802.487) (-3799.458) [-3794.473] * (-3796.362) (-3815.344) [-3797.701] (-3804.824) -- 0:08:58 306000 -- (-3794.076) (-3803.694) (-3803.443) [-3797.992] * [-3796.392] (-3794.847) (-3794.226) (-3802.267) -- 0:08:59 306500 -- [-3790.698] (-3794.964) (-3806.275) (-3793.104) * (-3801.312) [-3797.328] (-3803.850) (-3795.547) -- 0:08:58 307000 -- [-3794.816] (-3802.119) (-3800.941) (-3798.561) * [-3795.626] (-3801.356) (-3798.425) (-3792.045) -- 0:08:57 307500 -- (-3796.309) (-3799.428) [-3797.445] (-3805.242) * (-3812.170) [-3790.194] (-3792.402) (-3812.398) -- 0:08:58 308000 -- (-3796.480) (-3810.917) [-3795.794] (-3801.169) * (-3810.599) [-3790.574] (-3800.719) (-3790.745) -- 0:08:56 308500 -- (-3803.810) (-3801.563) [-3800.888] (-3802.770) * (-3802.062) (-3791.366) (-3800.594) [-3798.011] -- 0:08:55 309000 -- [-3794.757] (-3804.451) (-3804.757) (-3802.742) * (-3816.734) (-3802.541) (-3798.345) [-3800.764] -- 0:08:56 309500 -- [-3793.685] (-3802.187) (-3800.559) (-3802.334) * [-3806.054] (-3799.203) (-3802.507) (-3798.512) -- 0:08:55 310000 -- (-3806.572) (-3798.849) [-3803.045] (-3810.202) * (-3798.977) (-3799.007) [-3791.708] (-3795.449) -- 0:08:56 Average standard deviation of split frequencies: 0.007713 310500 -- (-3795.039) [-3804.373] (-3799.932) (-3807.714) * (-3796.795) (-3796.498) (-3794.727) [-3792.523] -- 0:08:55 311000 -- (-3797.231) (-3792.706) [-3795.240] (-3804.186) * (-3797.830) (-3798.660) [-3794.115] (-3802.500) -- 0:08:56 311500 -- [-3795.576] (-3795.458) (-3796.687) (-3802.169) * (-3801.361) (-3800.862) [-3794.456] (-3792.653) -- 0:08:54 312000 -- (-3807.812) (-3806.334) (-3794.555) [-3798.124] * (-3807.243) (-3795.134) (-3794.856) [-3795.905] -- 0:08:53 312500 -- (-3799.940) (-3807.034) [-3795.782] (-3791.555) * [-3793.962] (-3795.574) (-3790.852) (-3800.982) -- 0:08:54 313000 -- (-3803.291) (-3806.650) [-3793.698] (-3801.520) * [-3796.120] (-3799.995) (-3795.797) (-3807.663) -- 0:08:53 313500 -- (-3803.624) (-3795.659) (-3797.919) [-3795.895] * (-3802.746) [-3798.996] (-3799.160) (-3799.999) -- 0:08:52 314000 -- (-3816.516) (-3804.623) (-3793.510) [-3794.983] * (-3793.619) [-3799.990] (-3796.557) (-3798.831) -- 0:08:53 314500 -- [-3792.861] (-3806.420) (-3792.567) (-3802.998) * (-3797.606) (-3806.671) (-3798.230) [-3793.581] -- 0:08:51 315000 -- (-3803.560) (-3798.976) (-3793.694) [-3798.617] * (-3804.141) [-3795.257] (-3802.901) (-3795.521) -- 0:08:52 Average standard deviation of split frequencies: 0.006962 315500 -- (-3803.732) (-3810.324) [-3796.021] (-3798.411) * (-3801.304) (-3812.823) [-3795.253] (-3801.872) -- 0:08:51 316000 -- (-3805.981) (-3798.872) (-3801.251) [-3790.954] * (-3808.866) (-3803.066) (-3796.483) [-3789.881] -- 0:08:50 316500 -- (-3789.034) (-3804.968) (-3802.981) [-3796.478] * (-3803.058) (-3811.042) [-3796.945] (-3795.152) -- 0:08:51 317000 -- (-3802.722) (-3798.712) (-3802.777) [-3795.642] * (-3794.916) [-3801.257] (-3800.737) (-3797.506) -- 0:08:50 317500 -- [-3795.563] (-3791.738) (-3799.078) (-3798.446) * (-3788.370) (-3798.898) (-3811.513) [-3803.704] -- 0:08:50 318000 -- (-3809.650) (-3801.030) (-3796.363) [-3802.338] * (-3796.341) (-3802.483) (-3803.562) [-3800.031] -- 0:08:49 318500 -- [-3790.306] (-3802.680) (-3797.092) (-3811.442) * (-3794.697) (-3800.420) (-3803.523) [-3795.348] -- 0:08:48 319000 -- (-3801.724) [-3794.974] (-3797.388) (-3809.919) * [-3802.597] (-3798.440) (-3796.212) (-3794.880) -- 0:08:49 319500 -- (-3793.516) (-3799.680) [-3793.506] (-3804.982) * (-3816.923) (-3802.850) [-3800.245] (-3794.544) -- 0:08:48 320000 -- (-3798.480) (-3795.326) (-3798.358) [-3801.223] * [-3795.668] (-3800.739) (-3796.855) (-3800.151) -- 0:08:47 Average standard deviation of split frequencies: 0.006125 320500 -- [-3795.942] (-3790.088) (-3798.242) (-3803.130) * [-3798.768] (-3796.725) (-3804.725) (-3801.130) -- 0:08:47 321000 -- (-3794.365) (-3800.272) [-3800.787] (-3793.022) * (-3797.129) (-3794.068) (-3804.245) [-3792.541] -- 0:08:46 321500 -- [-3800.912] (-3805.529) (-3801.170) (-3799.330) * (-3795.036) (-3800.132) [-3804.136] (-3803.896) -- 0:08:47 322000 -- (-3803.424) [-3800.046] (-3808.613) (-3798.700) * [-3796.570] (-3798.280) (-3797.804) (-3791.901) -- 0:08:46 322500 -- (-3797.973) [-3794.088] (-3802.104) (-3810.388) * (-3801.771) (-3797.470) [-3798.227] (-3792.232) -- 0:08:45 323000 -- (-3791.317) [-3791.662] (-3801.948) (-3802.230) * (-3798.431) (-3795.130) (-3801.753) [-3792.271] -- 0:08:46 323500 -- (-3803.796) (-3798.559) [-3804.532] (-3797.237) * (-3799.894) (-3798.402) (-3798.314) [-3791.222] -- 0:08:44 324000 -- (-3804.972) (-3800.329) (-3806.039) [-3791.186] * (-3800.167) [-3792.927] (-3797.644) (-3798.192) -- 0:08:45 324500 -- (-3800.714) (-3795.193) [-3801.806] (-3801.249) * (-3793.848) (-3791.826) (-3803.217) [-3797.190] -- 0:08:44 325000 -- (-3795.514) (-3807.265) [-3796.485] (-3794.002) * (-3792.723) (-3794.719) (-3797.394) [-3791.607] -- 0:08:43 Average standard deviation of split frequencies: 0.006869 325500 -- [-3801.895] (-3793.657) (-3798.113) (-3804.427) * (-3803.217) [-3792.664] (-3794.573) (-3809.292) -- 0:08:44 326000 -- [-3802.310] (-3795.657) (-3803.066) (-3794.604) * (-3806.998) (-3794.395) [-3791.962] (-3816.483) -- 0:08:43 326500 -- (-3792.171) (-3801.007) (-3800.632) [-3796.338] * (-3796.646) [-3795.744] (-3802.349) (-3796.068) -- 0:08:41 327000 -- (-3803.498) [-3794.086] (-3802.600) (-3800.977) * [-3793.135] (-3802.676) (-3795.963) (-3799.263) -- 0:08:42 327500 -- [-3800.981] (-3798.919) (-3807.058) (-3809.883) * (-3793.386) (-3808.944) [-3799.328] (-3803.996) -- 0:08:41 328000 -- [-3791.071] (-3799.198) (-3806.044) (-3802.474) * (-3804.082) (-3793.040) (-3804.489) [-3798.874] -- 0:08:42 328500 -- (-3795.046) (-3809.343) [-3794.795] (-3801.659) * (-3803.507) (-3797.063) [-3806.056] (-3792.605) -- 0:08:41 329000 -- (-3799.251) (-3798.569) (-3794.938) [-3806.112] * (-3805.592) [-3796.085] (-3797.374) (-3795.660) -- 0:08:40 329500 -- (-3798.163) (-3798.036) [-3792.800] (-3812.597) * (-3799.481) [-3789.422] (-3801.173) (-3803.836) -- 0:08:40 330000 -- (-3794.882) (-3805.948) [-3788.230] (-3818.396) * (-3812.942) [-3793.447] (-3794.594) (-3797.254) -- 0:08:39 Average standard deviation of split frequencies: 0.006534 330500 -- (-3791.495) [-3798.205] (-3800.238) (-3798.660) * (-3802.101) [-3797.669] (-3795.040) (-3797.042) -- 0:08:40 331000 -- (-3797.552) (-3794.397) [-3798.204] (-3807.412) * (-3798.006) (-3800.285) [-3807.035] (-3799.794) -- 0:08:39 331500 -- (-3794.534) (-3798.377) (-3794.775) [-3792.456] * (-3803.819) (-3794.150) [-3797.314] (-3815.525) -- 0:08:38 332000 -- (-3792.639) (-3795.964) (-3790.470) [-3796.531] * (-3798.086) [-3794.540] (-3796.298) (-3800.901) -- 0:08:39 332500 -- (-3802.420) [-3790.712] (-3799.137) (-3808.498) * (-3794.546) (-3798.292) [-3793.636] (-3797.997) -- 0:08:37 333000 -- (-3799.117) (-3799.139) (-3801.011) [-3794.481] * (-3795.389) [-3793.182] (-3803.506) (-3795.322) -- 0:08:38 333500 -- (-3812.595) (-3808.534) [-3799.654] (-3796.935) * [-3792.529] (-3794.476) (-3803.161) (-3805.054) -- 0:08:37 334000 -- (-3800.499) (-3807.728) [-3793.263] (-3799.936) * (-3804.192) (-3796.820) (-3789.218) [-3795.148] -- 0:08:36 334500 -- (-3804.680) (-3811.697) (-3802.940) [-3796.656] * (-3803.352) (-3802.016) [-3787.891] (-3805.925) -- 0:08:37 335000 -- (-3796.850) (-3798.391) [-3801.393] (-3808.984) * (-3798.783) (-3803.684) (-3799.831) [-3807.318] -- 0:08:36 Average standard deviation of split frequencies: 0.007015 335500 -- (-3795.392) (-3799.558) (-3801.772) [-3803.621] * [-3801.050] (-3801.124) (-3805.606) (-3801.366) -- 0:08:36 336000 -- (-3808.280) [-3799.191] (-3803.177) (-3801.278) * [-3790.574] (-3804.206) (-3801.770) (-3796.745) -- 0:08:35 336500 -- (-3799.732) (-3801.349) (-3810.203) [-3793.055] * [-3798.450] (-3804.797) (-3800.403) (-3792.291) -- 0:08:34 337000 -- (-3799.382) (-3791.618) [-3792.413] (-3806.735) * [-3795.737] (-3797.681) (-3806.793) (-3798.746) -- 0:08:35 337500 -- [-3805.715] (-3800.182) (-3801.184) (-3807.624) * [-3801.438] (-3799.302) (-3797.898) (-3796.822) -- 0:08:34 338000 -- (-3804.782) (-3795.028) (-3805.379) [-3801.339] * [-3797.010] (-3800.419) (-3799.056) (-3799.059) -- 0:08:33 338500 -- [-3803.736] (-3799.625) (-3805.544) (-3803.786) * (-3800.479) [-3793.250] (-3793.919) (-3788.114) -- 0:08:33 339000 -- [-3798.949] (-3796.906) (-3799.038) (-3795.448) * (-3795.478) (-3805.815) (-3796.772) [-3799.117] -- 0:08:32 339500 -- (-3798.843) [-3794.195] (-3803.343) (-3797.753) * (-3791.898) (-3800.927) [-3795.444] (-3794.716) -- 0:08:33 340000 -- (-3801.978) (-3798.545) [-3790.980] (-3801.738) * (-3800.240) (-3805.075) (-3810.392) [-3792.307] -- 0:08:32 Average standard deviation of split frequencies: 0.006458 340500 -- [-3798.069] (-3795.627) (-3816.649) (-3799.552) * (-3795.763) [-3810.970] (-3797.602) (-3813.777) -- 0:08:31 341000 -- [-3795.271] (-3799.347) (-3816.164) (-3801.043) * [-3792.643] (-3799.464) (-3800.117) (-3799.894) -- 0:08:32 341500 -- (-3798.283) [-3797.905] (-3810.824) (-3799.743) * [-3794.867] (-3792.481) (-3797.186) (-3798.996) -- 0:08:30 342000 -- (-3806.952) (-3796.767) (-3811.230) [-3794.424] * [-3800.477] (-3794.204) (-3791.665) (-3816.202) -- 0:08:31 342500 -- (-3799.053) [-3790.035] (-3793.424) (-3791.624) * (-3795.661) [-3803.706] (-3800.655) (-3806.701) -- 0:08:30 343000 -- (-3803.115) [-3794.407] (-3793.932) (-3793.287) * (-3804.658) (-3799.448) [-3790.377] (-3803.171) -- 0:08:29 343500 -- (-3805.174) [-3797.921] (-3800.020) (-3796.637) * (-3804.500) (-3801.522) [-3794.937] (-3805.220) -- 0:08:30 344000 -- (-3793.925) (-3801.094) [-3799.433] (-3801.741) * (-3798.702) (-3801.780) (-3808.100) [-3801.433] -- 0:08:29 344500 -- [-3801.158] (-3795.314) (-3798.203) (-3803.203) * (-3795.794) [-3802.789] (-3808.021) (-3796.787) -- 0:08:29 345000 -- (-3798.079) [-3797.212] (-3810.419) (-3795.849) * (-3807.946) [-3798.117] (-3803.435) (-3802.311) -- 0:08:28 Average standard deviation of split frequencies: 0.006245 345500 -- (-3805.165) [-3799.026] (-3799.169) (-3803.972) * (-3819.172) (-3809.979) [-3794.337] (-3797.881) -- 0:08:27 346000 -- (-3795.977) [-3797.942] (-3798.631) (-3793.187) * (-3800.322) [-3786.476] (-3792.411) (-3801.832) -- 0:08:28 346500 -- [-3798.693] (-3794.866) (-3802.217) (-3795.804) * (-3798.451) [-3789.817] (-3798.010) (-3797.154) -- 0:08:27 347000 -- [-3799.226] (-3797.890) (-3811.555) (-3806.233) * (-3798.969) (-3788.574) (-3791.532) [-3794.928] -- 0:08:26 347500 -- [-3801.958] (-3794.720) (-3803.159) (-3800.126) * (-3796.148) [-3798.766] (-3802.333) (-3798.555) -- 0:08:26 348000 -- (-3797.016) [-3799.442] (-3796.107) (-3794.944) * [-3796.185] (-3799.083) (-3799.038) (-3797.924) -- 0:08:25 348500 -- [-3791.200] (-3799.067) (-3788.661) (-3796.455) * (-3806.049) [-3795.040] (-3799.160) (-3796.792) -- 0:08:26 349000 -- (-3799.377) (-3797.359) [-3795.651] (-3797.741) * (-3802.135) (-3800.160) (-3802.643) [-3794.079] -- 0:08:25 349500 -- [-3797.958] (-3795.159) (-3798.859) (-3793.764) * [-3791.412] (-3798.158) (-3799.167) (-3801.567) -- 0:08:24 350000 -- (-3805.620) [-3798.248] (-3794.645) (-3794.683) * (-3792.806) (-3798.231) [-3803.419] (-3802.527) -- 0:08:25 Average standard deviation of split frequencies: 0.007170 350500 -- (-3809.328) (-3792.325) (-3797.513) [-3796.687] * (-3792.383) [-3794.764] (-3802.831) (-3807.761) -- 0:08:24 351000 -- (-3799.232) (-3793.470) [-3793.340] (-3797.142) * (-3800.472) (-3806.391) [-3804.078] (-3803.905) -- 0:08:24 351500 -- [-3793.568] (-3800.776) (-3795.071) (-3796.999) * (-3799.974) (-3801.001) [-3798.397] (-3805.916) -- 0:08:23 352000 -- (-3791.810) (-3811.995) [-3805.676] (-3803.525) * [-3797.300] (-3802.051) (-3795.860) (-3792.441) -- 0:08:22 352500 -- (-3794.262) (-3805.859) [-3802.102] (-3792.547) * (-3807.304) (-3801.249) [-3801.479] (-3809.979) -- 0:08:23 353000 -- [-3796.879] (-3802.117) (-3801.674) (-3794.330) * [-3796.371] (-3801.892) (-3796.727) (-3801.045) -- 0:08:22 353500 -- (-3800.521) (-3801.647) (-3804.168) [-3802.927] * (-3797.462) (-3804.668) [-3798.527] (-3799.852) -- 0:08:22 354000 -- (-3803.207) [-3800.599] (-3797.317) (-3802.413) * [-3795.981] (-3792.686) (-3801.941) (-3801.837) -- 0:08:21 354500 -- [-3802.581] (-3796.343) (-3799.642) (-3795.313) * (-3800.523) (-3799.534) [-3799.728] (-3802.750) -- 0:08:20 355000 -- (-3804.975) (-3795.177) [-3796.408] (-3803.365) * (-3803.230) (-3805.323) (-3806.006) [-3794.721] -- 0:08:21 Average standard deviation of split frequencies: 0.006179 355500 -- [-3799.585] (-3798.109) (-3799.996) (-3801.690) * (-3796.108) (-3802.007) (-3801.571) [-3791.865] -- 0:08:20 356000 -- (-3795.580) (-3798.935) [-3801.879] (-3796.745) * (-3806.473) (-3806.709) [-3794.996] (-3797.419) -- 0:08:19 356500 -- [-3791.139] (-3800.610) (-3798.550) (-3797.488) * (-3793.733) (-3797.384) (-3803.242) [-3795.174] -- 0:08:19 357000 -- [-3795.221] (-3802.393) (-3798.790) (-3805.416) * (-3798.611) (-3787.830) (-3806.496) [-3799.826] -- 0:08:18 357500 -- (-3802.225) [-3790.189] (-3789.593) (-3797.280) * (-3798.386) [-3798.690] (-3798.156) (-3798.768) -- 0:08:19 358000 -- (-3795.952) (-3803.292) (-3793.740) [-3796.341] * (-3799.825) (-3793.909) [-3810.378] (-3810.443) -- 0:08:18 358500 -- [-3795.200] (-3799.747) (-3795.109) (-3793.931) * (-3796.431) [-3792.298] (-3798.580) (-3799.187) -- 0:08:17 359000 -- [-3795.653] (-3809.473) (-3791.112) (-3797.436) * (-3807.928) (-3797.184) (-3805.053) [-3798.891] -- 0:08:18 359500 -- [-3800.371] (-3796.078) (-3812.467) (-3804.167) * (-3804.667) (-3794.263) [-3803.182] (-3793.389) -- 0:08:17 360000 -- [-3794.668] (-3795.606) (-3801.132) (-3801.582) * (-3802.231) [-3793.831] (-3801.678) (-3805.929) -- 0:08:17 Average standard deviation of split frequencies: 0.006317 360500 -- [-3803.545] (-3799.102) (-3799.409) (-3797.263) * (-3804.895) [-3798.487] (-3800.731) (-3799.503) -- 0:08:16 361000 -- (-3799.250) (-3793.879) (-3802.426) [-3796.979] * (-3790.242) (-3797.464) [-3792.739] (-3799.801) -- 0:08:15 361500 -- (-3803.649) [-3797.133] (-3809.748) (-3800.053) * [-3794.333] (-3797.489) (-3811.412) (-3813.047) -- 0:08:16 362000 -- (-3798.522) (-3796.230) (-3798.236) [-3797.439] * [-3789.364] (-3793.231) (-3800.124) (-3794.358) -- 0:08:15 362500 -- (-3797.965) (-3799.579) (-3793.687) [-3801.859] * (-3797.956) (-3803.183) [-3795.371] (-3808.367) -- 0:08:14 363000 -- (-3796.844) (-3803.773) (-3799.113) [-3793.942] * [-3800.880] (-3799.344) (-3794.265) (-3798.644) -- 0:08:14 363500 -- (-3798.887) [-3796.208] (-3797.602) (-3796.987) * (-3801.965) (-3800.070) [-3797.886] (-3816.442) -- 0:08:13 364000 -- (-3803.109) (-3799.439) (-3790.855) [-3801.799] * (-3794.552) [-3799.070] (-3805.959) (-3806.437) -- 0:08:14 364500 -- (-3799.724) (-3796.786) (-3793.236) [-3795.681] * [-3794.134] (-3802.319) (-3799.990) (-3798.901) -- 0:08:13 365000 -- (-3797.227) (-3797.337) [-3793.018] (-3801.676) * (-3797.727) (-3799.480) [-3796.728] (-3792.316) -- 0:08:12 Average standard deviation of split frequencies: 0.006440 365500 -- (-3792.132) [-3797.586] (-3809.090) (-3816.818) * (-3798.044) (-3810.611) (-3797.972) [-3806.336] -- 0:08:13 366000 -- (-3797.238) (-3803.133) [-3797.831] (-3798.488) * [-3794.415] (-3800.573) (-3793.582) (-3807.079) -- 0:08:11 366500 -- (-3801.531) [-3798.571] (-3800.534) (-3797.700) * (-3792.490) (-3802.240) (-3796.462) [-3799.162] -- 0:08:12 367000 -- (-3804.703) (-3799.106) [-3800.486] (-3794.096) * (-3797.044) (-3800.168) (-3794.357) [-3797.656] -- 0:08:11 367500 -- (-3792.577) [-3792.166] (-3810.432) (-3799.533) * (-3803.887) [-3793.774] (-3803.950) (-3810.682) -- 0:08:10 368000 -- (-3796.167) (-3792.188) (-3804.029) [-3796.253] * (-3799.852) (-3798.895) [-3796.513] (-3804.180) -- 0:08:11 368500 -- (-3800.121) [-3792.537] (-3794.874) (-3810.053) * (-3797.140) [-3793.400] (-3790.402) (-3805.668) -- 0:08:10 369000 -- [-3808.026] (-3796.784) (-3805.287) (-3806.730) * (-3798.658) [-3797.316] (-3802.751) (-3811.071) -- 0:08:10 369500 -- [-3802.208] (-3797.465) (-3792.122) (-3801.145) * (-3806.876) [-3798.135] (-3797.142) (-3798.561) -- 0:08:09 370000 -- (-3804.136) (-3801.824) (-3810.351) [-3792.765] * (-3799.973) (-3795.828) (-3805.029) [-3796.688] -- 0:08:08 Average standard deviation of split frequencies: 0.005829 370500 -- (-3802.879) [-3801.253] (-3802.511) (-3798.926) * (-3812.740) [-3793.199] (-3792.621) (-3799.400) -- 0:08:09 371000 -- (-3795.315) [-3791.646] (-3804.230) (-3795.436) * (-3791.348) [-3793.494] (-3796.486) (-3804.805) -- 0:08:08 371500 -- [-3798.268] (-3791.876) (-3795.568) (-3810.216) * (-3800.156) [-3801.000] (-3790.982) (-3805.603) -- 0:08:07 372000 -- (-3804.026) (-3803.170) (-3801.229) [-3796.541] * (-3804.158) (-3802.392) [-3795.654] (-3792.626) -- 0:08:07 372500 -- [-3800.082] (-3805.865) (-3797.194) (-3798.534) * (-3802.886) [-3795.688] (-3813.285) (-3795.465) -- 0:08:06 373000 -- (-3802.927) (-3803.295) [-3796.437] (-3810.071) * (-3797.289) [-3798.055] (-3798.107) (-3803.932) -- 0:08:07 373500 -- [-3796.933] (-3797.786) (-3797.621) (-3809.470) * (-3796.080) (-3795.980) [-3795.034] (-3801.470) -- 0:08:06 374000 -- (-3806.631) [-3795.329] (-3798.088) (-3800.716) * [-3791.332] (-3796.094) (-3792.024) (-3804.234) -- 0:08:05 374500 -- (-3792.600) (-3801.033) [-3795.582] (-3803.500) * (-3792.813) [-3800.063] (-3807.531) (-3799.908) -- 0:08:06 375000 -- (-3806.127) [-3810.499] (-3791.200) (-3792.184) * (-3800.226) (-3799.704) [-3795.837] (-3794.058) -- 0:08:05 Average standard deviation of split frequencies: 0.005537 375500 -- [-3793.466] (-3799.636) (-3802.570) (-3806.536) * (-3811.700) (-3802.843) (-3800.864) [-3792.526] -- 0:08:05 376000 -- (-3795.877) [-3800.160] (-3797.984) (-3815.223) * (-3799.561) (-3806.831) [-3794.753] (-3800.955) -- 0:08:04 376500 -- (-3800.904) (-3800.033) (-3799.426) [-3798.940] * [-3797.232] (-3804.484) (-3808.103) (-3798.924) -- 0:08:03 377000 -- [-3801.534] (-3804.527) (-3797.799) (-3797.969) * (-3797.752) (-3800.063) [-3793.822] (-3801.112) -- 0:08:04 377500 -- [-3802.735] (-3800.845) (-3810.629) (-3793.995) * [-3799.145] (-3796.701) (-3800.521) (-3800.565) -- 0:08:03 378000 -- (-3799.959) (-3801.902) (-3793.414) [-3805.920] * (-3797.253) [-3796.515] (-3800.794) (-3796.470) -- 0:08:03 378500 -- (-3809.208) (-3807.184) [-3797.921] (-3803.871) * (-3801.779) (-3794.099) [-3792.212] (-3804.016) -- 0:08:02 379000 -- (-3804.759) (-3797.689) (-3801.138) [-3797.403] * [-3800.436] (-3794.965) (-3807.641) (-3809.478) -- 0:08:01 379500 -- [-3801.578] (-3796.646) (-3803.957) (-3810.144) * [-3796.812] (-3793.508) (-3806.692) (-3803.407) -- 0:08:02 380000 -- [-3800.739] (-3794.539) (-3801.172) (-3796.295) * (-3803.676) (-3803.450) (-3796.115) [-3795.900] -- 0:08:01 Average standard deviation of split frequencies: 0.005469 380500 -- (-3800.291) (-3804.722) (-3804.634) [-3801.059] * (-3806.363) (-3800.108) [-3796.566] (-3799.122) -- 0:08:00 381000 -- (-3795.034) (-3808.455) (-3800.922) [-3791.965] * (-3797.715) (-3794.114) (-3799.424) [-3793.860] -- 0:08:00 381500 -- (-3797.624) (-3798.775) (-3793.553) [-3793.387] * [-3794.261] (-3799.892) (-3798.999) (-3799.422) -- 0:07:59 382000 -- [-3791.892] (-3809.029) (-3798.077) (-3794.532) * (-3803.990) (-3802.365) (-3793.354) [-3794.966] -- 0:08:00 382500 -- (-3791.732) [-3804.309] (-3800.573) (-3796.812) * (-3797.011) (-3811.805) (-3796.174) [-3789.611] -- 0:07:59 383000 -- (-3796.920) (-3805.267) (-3796.862) [-3795.542] * (-3795.857) (-3801.048) [-3792.761] (-3799.983) -- 0:07:58 383500 -- [-3799.495] (-3802.627) (-3805.953) (-3792.853) * [-3801.637] (-3797.676) (-3806.187) (-3796.316) -- 0:07:59 384000 -- (-3802.491) [-3798.063] (-3800.288) (-3798.692) * [-3793.573] (-3807.718) (-3806.582) (-3802.700) -- 0:07:58 384500 -- [-3795.219] (-3789.983) (-3795.774) (-3801.854) * (-3793.118) (-3796.437) [-3805.608] (-3792.731) -- 0:07:58 385000 -- (-3791.889) (-3792.973) [-3798.015] (-3808.925) * [-3791.427] (-3793.755) (-3811.910) (-3792.329) -- 0:07:57 Average standard deviation of split frequencies: 0.005190 385500 -- (-3797.967) [-3792.132] (-3802.703) (-3795.101) * (-3798.730) (-3803.913) (-3806.253) [-3798.424] -- 0:07:56 386000 -- (-3798.695) (-3794.766) [-3793.539] (-3812.474) * (-3794.387) (-3797.799) (-3798.871) [-3793.869] -- 0:07:57 386500 -- (-3796.501) (-3802.812) (-3789.783) [-3797.294] * (-3809.001) (-3802.540) (-3796.819) [-3792.028] -- 0:07:56 387000 -- (-3796.136) (-3795.474) [-3791.718] (-3792.878) * [-3796.904] (-3799.389) (-3797.272) (-3801.953) -- 0:07:56 387500 -- (-3803.256) (-3805.904) [-3794.416] (-3806.178) * (-3803.660) (-3798.554) [-3795.164] (-3808.894) -- 0:07:55 388000 -- [-3796.832] (-3810.921) (-3799.092) (-3801.024) * (-3797.702) [-3794.147] (-3804.188) (-3803.964) -- 0:07:56 388500 -- (-3792.745) [-3794.585] (-3795.680) (-3787.702) * (-3799.247) (-3802.484) (-3814.040) [-3794.259] -- 0:07:55 389000 -- [-3797.226] (-3796.867) (-3794.740) (-3793.367) * (-3808.314) (-3796.137) [-3801.755] (-3799.589) -- 0:07:54 389500 -- (-3794.514) (-3802.886) (-3796.378) [-3797.963] * (-3793.210) (-3803.126) (-3796.293) [-3795.181] -- 0:07:54 390000 -- (-3800.623) (-3800.205) (-3798.382) [-3801.808] * (-3795.800) (-3806.913) [-3797.628] (-3800.783) -- 0:07:53 Average standard deviation of split frequencies: 0.004927 390500 -- [-3798.360] (-3803.732) (-3799.947) (-3806.832) * (-3798.316) [-3791.286] (-3804.676) (-3799.614) -- 0:07:52 391000 -- [-3794.371] (-3812.340) (-3805.189) (-3797.527) * (-3805.978) (-3796.910) [-3802.250] (-3807.304) -- 0:07:53 391500 -- (-3800.871) (-3791.165) [-3801.882] (-3815.886) * [-3796.220] (-3797.424) (-3798.366) (-3805.352) -- 0:07:52 392000 -- (-3808.689) [-3800.317] (-3798.681) (-3798.890) * (-3793.191) [-3803.073] (-3797.900) (-3803.738) -- 0:07:53 392500 -- (-3800.732) (-3794.377) [-3790.270] (-3795.325) * (-3791.639) [-3802.868] (-3800.234) (-3804.507) -- 0:07:52 393000 -- (-3796.118) (-3808.623) (-3795.192) [-3798.288] * [-3792.186] (-3802.130) (-3799.401) (-3800.058) -- 0:07:51 393500 -- (-3800.065) [-3793.550] (-3794.631) (-3797.558) * (-3791.244) [-3797.544] (-3802.936) (-3806.942) -- 0:07:51 394000 -- [-3795.977] (-3800.456) (-3799.052) (-3804.166) * (-3797.293) (-3800.152) (-3798.596) [-3791.226] -- 0:07:50 394500 -- [-3796.925] (-3799.405) (-3801.114) (-3797.436) * (-3801.580) (-3800.579) [-3799.036] (-3809.185) -- 0:07:51 395000 -- [-3792.410] (-3814.332) (-3793.387) (-3806.024) * (-3801.676) (-3800.242) [-3796.810] (-3812.101) -- 0:07:50 Average standard deviation of split frequencies: 0.004861 395500 -- (-3795.047) (-3796.940) [-3798.044] (-3801.709) * (-3804.393) (-3793.511) (-3799.965) [-3805.433] -- 0:07:49 396000 -- [-3798.859] (-3801.163) (-3794.046) (-3807.105) * (-3809.656) (-3802.879) (-3801.936) [-3797.171] -- 0:07:49 396500 -- (-3808.003) (-3800.389) [-3796.217] (-3802.346) * (-3801.807) [-3788.162] (-3807.095) (-3809.474) -- 0:07:48 397000 -- (-3801.843) (-3803.820) (-3797.499) [-3795.951] * [-3797.654] (-3802.869) (-3796.235) (-3809.953) -- 0:07:47 397500 -- [-3802.855] (-3800.642) (-3794.892) (-3794.602) * (-3798.028) [-3797.764] (-3806.391) (-3799.248) -- 0:07:48 398000 -- (-3799.876) (-3810.740) [-3797.287] (-3800.498) * (-3799.114) [-3797.679] (-3805.229) (-3795.386) -- 0:07:47 398500 -- (-3799.953) (-3799.383) (-3795.978) [-3797.635] * (-3802.836) [-3801.666] (-3802.620) (-3804.665) -- 0:07:47 399000 -- (-3811.683) (-3811.786) [-3799.623] (-3796.281) * [-3794.137] (-3794.568) (-3797.679) (-3810.563) -- 0:07:46 399500 -- (-3794.789) (-3811.743) [-3795.533] (-3796.728) * (-3816.387) [-3795.512] (-3796.209) (-3799.932) -- 0:07:45 400000 -- (-3792.203) (-3807.444) (-3802.329) [-3793.247] * (-3801.761) (-3800.285) (-3798.394) [-3802.621] -- 0:07:46 Average standard deviation of split frequencies: 0.004608 400500 -- [-3787.902] (-3799.703) (-3799.252) (-3803.142) * (-3813.624) (-3801.470) [-3794.805] (-3804.171) -- 0:07:45 401000 -- [-3792.971] (-3798.020) (-3802.556) (-3795.662) * (-3792.170) (-3790.651) [-3791.226] (-3803.163) -- 0:07:44 401500 -- [-3791.449] (-3802.932) (-3795.251) (-3796.349) * (-3794.996) (-3797.348) (-3800.927) [-3794.092] -- 0:07:45 402000 -- [-3798.882] (-3797.494) (-3794.875) (-3796.551) * (-3794.067) (-3799.551) [-3796.682] (-3793.974) -- 0:07:44 402500 -- (-3801.220) (-3809.854) (-3798.241) [-3792.088] * [-3792.610] (-3799.504) (-3804.180) (-3791.278) -- 0:07:44 403000 -- [-3796.404] (-3798.634) (-3803.981) (-3792.872) * (-3794.109) [-3798.700] (-3799.298) (-3804.205) -- 0:07:43 403500 -- (-3797.547) (-3797.478) (-3799.234) [-3791.429] * (-3800.003) (-3797.404) [-3798.349] (-3800.241) -- 0:07:42 404000 -- [-3790.895] (-3799.447) (-3802.855) (-3795.254) * (-3796.318) (-3804.019) (-3791.733) [-3791.724] -- 0:07:43 404500 -- (-3796.058) (-3798.061) (-3802.248) [-3798.783] * (-3807.439) (-3799.206) [-3791.814] (-3795.987) -- 0:07:42 405000 -- (-3793.360) (-3802.654) (-3794.874) [-3795.523] * (-3800.017) (-3792.407) [-3791.862] (-3799.063) -- 0:07:42 Average standard deviation of split frequencies: 0.004935 405500 -- (-3795.611) (-3808.667) [-3795.294] (-3801.392) * (-3800.327) (-3806.615) (-3793.809) [-3791.295] -- 0:07:41 406000 -- (-3794.139) [-3806.335] (-3800.444) (-3801.504) * (-3799.282) [-3795.255] (-3808.520) (-3796.904) -- 0:07:40 406500 -- (-3806.455) (-3801.764) [-3792.419] (-3802.306) * (-3803.359) (-3803.328) (-3797.962) [-3796.284] -- 0:07:41 407000 -- (-3804.946) (-3798.809) [-3790.295] (-3801.430) * (-3799.957) (-3797.605) (-3791.025) [-3793.814] -- 0:07:40 407500 -- (-3804.400) (-3798.609) [-3792.853] (-3804.177) * (-3796.699) (-3808.037) [-3794.803] (-3798.627) -- 0:07:39 408000 -- (-3801.620) (-3802.116) [-3797.310] (-3803.729) * (-3801.816) (-3804.978) (-3794.786) [-3797.687] -- 0:07:39 408500 -- [-3794.313] (-3802.491) (-3803.472) (-3794.819) * (-3801.187) (-3797.917) [-3795.665] (-3805.025) -- 0:07:39 409000 -- [-3795.978] (-3799.182) (-3794.992) (-3794.638) * (-3798.182) (-3798.433) [-3802.466] (-3796.322) -- 0:07:39 409500 -- (-3804.242) (-3797.492) [-3798.662] (-3799.599) * (-3806.660) [-3793.854] (-3794.312) (-3799.464) -- 0:07:38 410000 -- (-3795.049) (-3800.900) (-3805.120) [-3797.690] * (-3799.822) (-3794.380) [-3796.244] (-3790.135) -- 0:07:37 Average standard deviation of split frequencies: 0.005548 410500 -- [-3794.257] (-3798.481) (-3800.570) (-3793.974) * [-3799.459] (-3804.317) (-3801.249) (-3796.253) -- 0:07:38 411000 -- (-3795.892) (-3801.376) [-3803.808] (-3801.504) * (-3796.175) (-3808.568) [-3793.569] (-3797.961) -- 0:07:37 411500 -- (-3796.067) [-3792.398] (-3803.580) (-3791.409) * (-3803.475) (-3798.198) [-3791.183] (-3796.673) -- 0:07:37 412000 -- (-3804.749) (-3800.191) (-3807.062) [-3802.194] * (-3802.894) (-3799.169) [-3798.581] (-3790.169) -- 0:07:36 412500 -- (-3796.388) (-3797.445) [-3798.162] (-3808.536) * (-3801.523) (-3802.522) (-3791.164) [-3793.915] -- 0:07:35 413000 -- [-3794.500] (-3800.635) (-3801.677) (-3796.270) * (-3794.186) (-3807.460) (-3798.932) [-3799.125] -- 0:07:36 413500 -- (-3800.299) (-3800.609) (-3806.292) [-3800.984] * (-3790.929) (-3813.665) (-3799.752) [-3804.362] -- 0:07:35 414000 -- (-3801.918) [-3798.828] (-3799.943) (-3794.631) * (-3798.121) [-3794.320] (-3804.074) (-3801.605) -- 0:07:34 414500 -- (-3800.840) (-3795.144) [-3794.654] (-3799.183) * (-3807.462) (-3804.158) [-3792.812] (-3798.731) -- 0:07:34 415000 -- [-3797.149] (-3802.169) (-3798.928) (-3799.717) * (-3807.413) [-3801.285] (-3809.679) (-3804.106) -- 0:07:33 Average standard deviation of split frequencies: 0.005194 415500 -- (-3794.233) [-3802.595] (-3805.220) (-3801.658) * (-3792.139) (-3797.078) [-3800.856] (-3805.861) -- 0:07:34 416000 -- [-3793.395] (-3806.978) (-3802.312) (-3793.450) * [-3789.840] (-3802.518) (-3798.615) (-3808.577) -- 0:07:33 416500 -- (-3801.486) (-3815.831) (-3799.919) [-3793.961] * (-3794.991) (-3803.463) [-3793.627] (-3799.828) -- 0:07:32 417000 -- (-3803.105) (-3802.415) [-3799.065] (-3796.681) * [-3795.445] (-3803.584) (-3805.326) (-3795.217) -- 0:07:32 417500 -- (-3798.610) (-3812.237) [-3806.549] (-3793.593) * (-3795.470) [-3794.895] (-3807.196) (-3808.610) -- 0:07:32 418000 -- (-3810.910) (-3798.433) [-3802.598] (-3800.282) * [-3796.299] (-3802.238) (-3802.332) (-3800.652) -- 0:07:32 418500 -- (-3805.164) (-3801.558) [-3797.515] (-3799.389) * (-3801.033) (-3796.766) (-3803.310) [-3797.044] -- 0:07:31 419000 -- (-3799.240) [-3793.687] (-3799.560) (-3798.057) * (-3807.870) [-3797.438] (-3805.780) (-3799.711) -- 0:07:30 419500 -- [-3795.790] (-3794.535) (-3804.878) (-3803.208) * (-3799.494) [-3795.696] (-3800.824) (-3795.333) -- 0:07:31 420000 -- (-3791.376) [-3792.725] (-3810.481) (-3798.159) * (-3800.672) [-3797.519] (-3796.367) (-3792.500) -- 0:07:30 Average standard deviation of split frequencies: 0.005510 420500 -- (-3799.880) [-3791.556] (-3798.129) (-3804.000) * [-3802.755] (-3795.469) (-3811.381) (-3789.620) -- 0:07:29 421000 -- [-3801.061] (-3795.194) (-3791.419) (-3794.353) * (-3808.226) [-3795.017] (-3805.127) (-3796.937) -- 0:07:29 421500 -- [-3800.321] (-3798.164) (-3809.011) (-3800.470) * (-3800.679) [-3795.215] (-3801.579) (-3801.602) -- 0:07:28 422000 -- [-3794.274] (-3799.160) (-3812.277) (-3797.073) * (-3799.898) (-3801.346) (-3800.900) [-3792.825] -- 0:07:29 422500 -- (-3792.216) [-3796.206] (-3795.976) (-3793.704) * (-3801.318) (-3789.511) (-3806.066) [-3794.649] -- 0:07:28 423000 -- (-3798.128) (-3813.289) [-3799.506] (-3795.592) * (-3805.930) (-3799.865) (-3800.827) [-3801.441] -- 0:07:27 423500 -- (-3796.999) (-3803.212) [-3801.250] (-3808.718) * (-3797.984) [-3796.892] (-3796.958) (-3800.279) -- 0:07:27 424000 -- [-3802.525] (-3807.750) (-3791.640) (-3802.419) * [-3800.429] (-3805.655) (-3796.841) (-3801.858) -- 0:07:26 424500 -- [-3797.029] (-3801.663) (-3794.808) (-3808.463) * [-3792.469] (-3798.021) (-3797.478) (-3798.840) -- 0:07:27 425000 -- (-3805.754) [-3796.998] (-3801.462) (-3806.605) * [-3799.196] (-3795.737) (-3798.289) (-3789.949) -- 0:07:26 Average standard deviation of split frequencies: 0.005256 425500 -- (-3809.284) [-3795.699] (-3799.324) (-3798.985) * (-3801.663) (-3800.170) (-3798.386) [-3797.446] -- 0:07:25 426000 -- (-3812.663) (-3791.929) [-3805.384] (-3792.748) * (-3796.299) (-3796.304) [-3794.951] (-3800.345) -- 0:07:25 426500 -- (-3805.129) (-3796.874) (-3792.616) [-3804.942] * (-3796.361) (-3802.063) (-3804.838) [-3798.733] -- 0:07:25 427000 -- (-3797.488) (-3796.456) [-3795.523] (-3803.524) * (-3793.413) (-3800.868) (-3790.768) [-3795.667] -- 0:07:24 427500 -- (-3808.955) (-3798.137) [-3793.932] (-3804.758) * (-3796.584) (-3805.279) (-3793.645) [-3793.699] -- 0:07:24 428000 -- (-3802.271) [-3799.063] (-3797.570) (-3801.104) * (-3802.017) (-3800.867) [-3798.016] (-3794.672) -- 0:07:23 428500 -- (-3812.019) (-3793.903) (-3814.615) [-3793.354] * (-3808.011) [-3794.035] (-3796.301) (-3803.424) -- 0:07:24 429000 -- (-3804.515) [-3795.162] (-3807.867) (-3797.651) * (-3800.116) (-3804.360) [-3791.192] (-3795.765) -- 0:07:23 429500 -- (-3793.672) (-3800.260) [-3797.492] (-3792.897) * [-3797.700] (-3800.096) (-3790.515) (-3797.657) -- 0:07:22 430000 -- (-3790.938) [-3801.810] (-3807.795) (-3792.518) * [-3798.138] (-3800.144) (-3796.745) (-3794.594) -- 0:07:22 Average standard deviation of split frequencies: 0.005655 430500 -- (-3792.775) [-3793.092] (-3796.665) (-3795.614) * (-3797.263) [-3791.685] (-3799.311) (-3801.303) -- 0:07:21 431000 -- (-3799.228) (-3796.770) (-3802.885) [-3798.638] * (-3796.870) (-3803.770) [-3800.840] (-3796.120) -- 0:07:20 431500 -- (-3808.687) [-3795.159] (-3796.308) (-3793.206) * (-3805.103) (-3818.967) (-3797.735) [-3798.776] -- 0:07:21 432000 -- (-3797.530) (-3801.813) [-3794.855] (-3804.505) * (-3795.632) (-3803.175) (-3803.178) [-3792.612] -- 0:07:20 432500 -- (-3798.277) [-3798.045] (-3790.674) (-3796.090) * (-3794.021) [-3795.297] (-3809.341) (-3798.568) -- 0:07:20 433000 -- (-3800.253) (-3804.421) [-3792.983] (-3800.407) * (-3793.614) [-3795.947] (-3793.799) (-3820.444) -- 0:07:19 433500 -- [-3800.953] (-3799.683) (-3801.826) (-3789.880) * (-3793.952) (-3803.566) (-3796.009) [-3797.522] -- 0:07:19 434000 -- (-3805.912) (-3794.408) (-3799.473) [-3792.317] * (-3796.888) [-3796.541] (-3793.505) (-3807.300) -- 0:07:19 434500 -- (-3797.334) (-3793.499) (-3804.647) [-3799.552] * (-3810.751) (-3790.129) [-3791.700] (-3805.696) -- 0:07:18 435000 -- [-3795.791] (-3800.864) (-3807.637) (-3800.461) * [-3799.350] (-3807.517) (-3796.142) (-3800.226) -- 0:07:19 Average standard deviation of split frequencies: 0.005676 435500 -- [-3793.419] (-3801.683) (-3802.711) (-3806.510) * (-3804.898) (-3801.248) [-3797.237] (-3795.569) -- 0:07:18 436000 -- (-3797.132) [-3791.493] (-3792.401) (-3796.327) * (-3804.318) (-3791.145) [-3791.348] (-3798.341) -- 0:07:17 436500 -- (-3807.805) (-3800.100) [-3805.521] (-3801.112) * (-3802.727) (-3802.328) [-3794.841] (-3806.612) -- 0:07:17 437000 -- (-3803.464) (-3796.996) [-3795.140] (-3807.286) * (-3813.846) (-3805.156) [-3790.668] (-3806.783) -- 0:07:16 437500 -- (-3808.307) [-3797.662] (-3800.360) (-3797.696) * (-3805.291) (-3805.025) [-3796.537] (-3795.748) -- 0:07:15 438000 -- (-3807.980) [-3793.808] (-3796.931) (-3806.520) * (-3801.425) (-3797.410) [-3807.049] (-3792.923) -- 0:07:16 438500 -- (-3796.556) (-3796.078) (-3797.724) [-3802.478] * (-3792.368) [-3796.335] (-3798.271) (-3804.550) -- 0:07:15 439000 -- (-3796.686) [-3799.903] (-3805.429) (-3801.475) * (-3803.106) (-3806.359) [-3808.793] (-3804.894) -- 0:07:15 439500 -- [-3801.673] (-3801.014) (-3803.896) (-3794.137) * (-3793.742) (-3799.828) [-3801.957] (-3804.051) -- 0:07:14 440000 -- (-3799.163) [-3796.440] (-3798.960) (-3792.899) * [-3797.128] (-3802.851) (-3807.803) (-3797.310) -- 0:07:14 Average standard deviation of split frequencies: 0.005349 440500 -- (-3794.576) [-3796.738] (-3810.087) (-3800.849) * (-3802.898) (-3792.326) (-3796.958) [-3798.373] -- 0:07:14 441000 -- (-3795.921) [-3792.245] (-3807.810) (-3791.210) * (-3810.910) (-3807.346) [-3801.321] (-3793.637) -- 0:07:13 441500 -- (-3806.204) (-3799.859) [-3790.080] (-3795.411) * [-3809.352] (-3801.133) (-3794.295) (-3817.890) -- 0:07:13 442000 -- (-3805.804) (-3801.528) (-3800.016) [-3801.672] * (-3810.613) (-3803.779) (-3795.564) [-3797.295] -- 0:07:13 442500 -- (-3804.856) (-3805.712) [-3791.330] (-3796.758) * (-3794.465) [-3796.822] (-3794.273) (-3797.822) -- 0:07:13 443000 -- (-3801.401) (-3806.488) (-3801.373) [-3795.111] * (-3789.553) [-3797.378] (-3799.206) (-3804.144) -- 0:07:12 443500 -- (-3794.955) (-3795.696) (-3798.909) [-3795.608] * (-3790.177) (-3792.432) [-3793.394] (-3795.919) -- 0:07:11 444000 -- (-3797.545) (-3794.162) [-3797.726] (-3800.363) * (-3794.116) (-3801.126) (-3796.231) [-3797.509] -- 0:07:12 444500 -- (-3807.340) [-3799.844] (-3796.066) (-3807.599) * (-3791.419) (-3803.821) [-3794.072] (-3800.917) -- 0:07:11 445000 -- (-3803.627) [-3792.561] (-3808.064) (-3812.085) * (-3801.938) [-3793.674] (-3801.659) (-3805.034) -- 0:07:10 Average standard deviation of split frequencies: 0.006342 445500 -- (-3800.788) (-3796.406) (-3805.347) [-3797.576] * (-3802.782) (-3802.175) (-3799.471) [-3796.081] -- 0:07:10 446000 -- (-3795.625) [-3793.468] (-3795.568) (-3800.554) * (-3805.901) (-3796.276) (-3803.884) [-3797.112] -- 0:07:09 446500 -- (-3797.611) (-3798.416) (-3795.042) [-3792.947] * (-3810.718) (-3799.800) [-3794.608] (-3797.947) -- 0:07:10 447000 -- (-3798.446) [-3786.419] (-3805.471) (-3794.977) * (-3812.758) (-3803.931) (-3794.664) [-3798.993] -- 0:07:09 447500 -- (-3798.448) [-3795.602] (-3802.777) (-3795.550) * [-3806.603] (-3801.115) (-3812.464) (-3791.556) -- 0:07:08 448000 -- [-3796.765] (-3803.691) (-3797.555) (-3801.910) * (-3800.167) [-3796.981] (-3802.038) (-3802.960) -- 0:07:08 448500 -- [-3802.830] (-3802.751) (-3801.556) (-3792.805) * (-3795.276) [-3790.546] (-3803.770) (-3796.228) -- 0:07:07 449000 -- [-3795.607] (-3797.010) (-3799.939) (-3792.628) * (-3805.077) (-3792.989) (-3797.826) [-3795.638] -- 0:07:07 449500 -- (-3800.704) (-3797.944) (-3797.238) [-3789.948] * [-3789.503] (-3798.835) (-3794.483) (-3804.142) -- 0:07:07 450000 -- [-3799.133] (-3793.960) (-3797.244) (-3801.205) * (-3799.464) (-3795.456) [-3795.735] (-3806.391) -- 0:07:06 Average standard deviation of split frequencies: 0.006973 450500 -- (-3811.378) [-3800.728] (-3798.674) (-3804.079) * (-3794.145) (-3802.564) [-3796.827] (-3796.096) -- 0:07:06 451000 -- (-3795.467) (-3800.918) (-3798.483) [-3797.099] * (-3800.372) [-3791.203] (-3800.051) (-3800.138) -- 0:07:06 451500 -- (-3798.745) (-3805.769) (-3806.051) [-3792.627] * [-3797.813] (-3792.492) (-3798.988) (-3798.588) -- 0:07:05 452000 -- (-3797.142) (-3803.147) (-3803.730) [-3792.550] * [-3794.924] (-3797.626) (-3802.986) (-3792.944) -- 0:07:05 452500 -- (-3793.649) (-3797.989) (-3796.323) [-3799.162] * (-3792.237) (-3801.376) [-3799.514] (-3806.060) -- 0:07:04 453000 -- (-3802.617) (-3801.359) (-3796.839) [-3793.766] * (-3804.950) (-3799.865) (-3794.618) [-3790.858] -- 0:07:05 453500 -- (-3796.614) (-3808.368) (-3793.568) [-3798.829] * (-3803.225) (-3804.204) [-3799.940] (-3801.814) -- 0:07:04 454000 -- [-3796.221] (-3814.003) (-3797.554) (-3793.312) * (-3799.691) (-3816.737) (-3799.198) [-3793.704] -- 0:07:03 454500 -- [-3797.641] (-3809.232) (-3806.507) (-3796.392) * (-3801.294) (-3804.483) [-3793.891] (-3799.866) -- 0:07:03 455000 -- (-3814.317) (-3798.179) [-3793.980] (-3794.677) * (-3789.316) (-3803.369) [-3799.638] (-3799.797) -- 0:07:02 Average standard deviation of split frequencies: 0.006892 455500 -- (-3813.346) (-3799.900) (-3793.847) [-3799.538] * [-3795.359] (-3802.732) (-3792.687) (-3796.095) -- 0:07:01 456000 -- [-3797.543] (-3799.928) (-3789.139) (-3796.383) * (-3792.036) (-3798.809) [-3793.900] (-3813.817) -- 0:07:02 456500 -- (-3790.300) [-3810.058] (-3803.590) (-3794.852) * (-3796.887) (-3792.646) [-3798.910] (-3797.387) -- 0:07:01 457000 -- (-3801.488) (-3796.429) (-3799.194) [-3799.559] * [-3791.548] (-3802.035) (-3798.804) (-3790.871) -- 0:07:01 457500 -- (-3798.782) [-3801.608] (-3797.075) (-3800.690) * (-3815.961) (-3796.142) (-3804.827) [-3810.461] -- 0:07:00 458000 -- [-3798.105] (-3794.190) (-3799.377) (-3809.749) * (-3798.219) [-3802.184] (-3808.143) (-3805.970) -- 0:07:00 458500 -- (-3797.422) (-3797.069) [-3791.639] (-3798.362) * (-3801.221) [-3794.938] (-3801.052) (-3805.233) -- 0:07:00 459000 -- (-3799.367) (-3794.417) [-3799.006] (-3803.231) * [-3799.780] (-3801.155) (-3796.516) (-3805.911) -- 0:06:59 459500 -- (-3796.112) (-3795.674) [-3799.312] (-3800.441) * (-3793.111) (-3804.864) [-3800.612] (-3817.270) -- 0:06:58 460000 -- (-3795.828) [-3793.521] (-3803.652) (-3795.892) * (-3801.120) (-3804.023) [-3805.143] (-3806.919) -- 0:06:59 Average standard deviation of split frequencies: 0.005969 460500 -- (-3797.213) [-3795.380] (-3805.722) (-3802.841) * (-3793.998) (-3807.540) (-3807.575) [-3795.858] -- 0:06:58 461000 -- (-3796.001) [-3790.087] (-3812.166) (-3802.717) * (-3791.701) (-3796.830) [-3793.682] (-3801.439) -- 0:06:58 461500 -- (-3800.254) (-3807.536) [-3799.067] (-3796.147) * (-3801.677) (-3794.385) (-3802.269) [-3793.243] -- 0:06:57 462000 -- (-3798.592) (-3805.307) [-3800.270] (-3808.139) * [-3798.969] (-3799.945) (-3799.242) (-3797.908) -- 0:06:56 462500 -- (-3801.560) [-3795.981] (-3794.835) (-3803.288) * (-3799.071) [-3795.216] (-3797.772) (-3791.810) -- 0:06:57 463000 -- (-3800.464) (-3794.351) [-3795.007] (-3805.149) * (-3804.226) (-3800.312) (-3796.025) [-3796.053] -- 0:06:56 463500 -- (-3807.511) (-3794.283) (-3797.794) [-3802.160] * (-3796.950) (-3802.970) (-3799.623) [-3796.389] -- 0:06:56 464000 -- (-3808.364) (-3797.774) (-3798.125) [-3805.127] * (-3811.261) (-3802.603) (-3806.409) [-3795.330] -- 0:06:55 464500 -- [-3793.962] (-3794.106) (-3799.351) (-3810.674) * [-3788.824] (-3792.465) (-3809.203) (-3802.535) -- 0:06:55 465000 -- (-3804.346) (-3797.004) [-3798.034] (-3790.730) * (-3799.679) (-3798.558) [-3800.739] (-3802.753) -- 0:06:55 Average standard deviation of split frequencies: 0.005564 465500 -- (-3801.517) (-3801.944) (-3805.568) [-3794.252] * [-3796.845] (-3794.894) (-3802.495) (-3797.605) -- 0:06:54 466000 -- (-3795.946) [-3792.359] (-3799.194) (-3808.975) * (-3801.141) (-3793.313) [-3791.214] (-3799.361) -- 0:06:53 466500 -- (-3791.121) [-3801.036] (-3805.054) (-3806.209) * [-3797.747] (-3808.056) (-3798.189) (-3801.184) -- 0:06:53 467000 -- (-3801.532) (-3807.034) [-3812.453] (-3797.968) * (-3795.057) (-3799.219) (-3796.327) [-3798.207] -- 0:06:53 467500 -- (-3803.036) (-3802.912) (-3802.177) [-3799.581] * (-3800.521) (-3793.473) [-3801.886] (-3800.192) -- 0:06:53 468000 -- (-3799.186) (-3797.909) (-3794.838) [-3800.537] * [-3792.817] (-3799.860) (-3799.771) (-3797.465) -- 0:06:52 468500 -- [-3799.778] (-3801.682) (-3794.922) (-3802.626) * (-3800.758) [-3807.885] (-3798.760) (-3803.510) -- 0:06:51 469000 -- (-3798.852) (-3800.873) [-3803.894] (-3801.934) * (-3792.963) (-3803.437) [-3797.923] (-3801.463) -- 0:06:52 469500 -- (-3805.399) (-3795.900) (-3803.840) [-3801.383] * [-3801.423] (-3793.165) (-3800.503) (-3806.500) -- 0:06:51 470000 -- (-3799.990) (-3802.735) (-3794.391) [-3792.340] * (-3799.079) (-3809.814) [-3791.642] (-3806.610) -- 0:06:50 Average standard deviation of split frequencies: 0.005258 470500 -- [-3797.321] (-3804.858) (-3795.559) (-3796.876) * (-3797.139) [-3799.140] (-3800.277) (-3805.644) -- 0:06:50 471000 -- (-3802.762) (-3801.133) [-3792.061] (-3793.091) * [-3795.676] (-3796.731) (-3811.406) (-3804.998) -- 0:06:49 471500 -- (-3797.000) [-3798.900] (-3793.329) (-3799.796) * (-3799.462) (-3794.388) [-3794.378] (-3796.407) -- 0:06:50 472000 -- (-3806.345) [-3804.259] (-3799.973) (-3795.598) * (-3797.453) [-3790.073] (-3795.324) (-3813.707) -- 0:06:49 472500 -- (-3798.742) (-3807.556) (-3790.539) [-3793.950] * (-3800.115) (-3791.384) [-3799.551] (-3803.627) -- 0:06:48 473000 -- (-3804.848) [-3805.201] (-3793.208) (-3797.688) * (-3800.752) [-3800.570] (-3796.481) (-3799.405) -- 0:06:48 473500 -- (-3794.708) (-3795.754) (-3799.878) [-3803.523] * [-3797.509] (-3793.720) (-3796.312) (-3802.283) -- 0:06:48 474000 -- (-3800.134) (-3795.414) [-3794.308] (-3795.918) * (-3795.551) (-3795.451) [-3802.388] (-3803.980) -- 0:06:48 474500 -- (-3799.800) [-3798.177] (-3799.598) (-3796.523) * (-3798.696) (-3802.439) [-3801.078] (-3801.997) -- 0:06:47 475000 -- (-3799.386) [-3799.551] (-3807.850) (-3802.017) * (-3809.574) [-3793.803] (-3795.622) (-3807.815) -- 0:06:46 Average standard deviation of split frequencies: 0.005199 475500 -- (-3800.685) [-3805.946] (-3794.385) (-3816.355) * (-3806.545) [-3793.708] (-3797.116) (-3799.594) -- 0:06:47 476000 -- [-3797.587] (-3801.812) (-3815.054) (-3807.308) * [-3807.938] (-3798.874) (-3797.289) (-3802.408) -- 0:06:46 476500 -- (-3798.073) (-3804.543) (-3799.427) [-3807.868] * (-3804.705) [-3797.719] (-3795.257) (-3799.211) -- 0:06:45 477000 -- [-3801.261] (-3804.298) (-3805.062) (-3807.291) * [-3792.324] (-3801.305) (-3797.398) (-3800.574) -- 0:06:45 477500 -- [-3795.607] (-3797.072) (-3796.929) (-3799.975) * (-3795.621) (-3793.924) (-3798.899) [-3804.296] -- 0:06:44 478000 -- (-3797.678) [-3803.782] (-3806.035) (-3800.335) * (-3797.336) (-3802.302) [-3793.242] (-3807.636) -- 0:06:45 478500 -- [-3792.962] (-3805.567) (-3802.476) (-3797.970) * [-3793.142] (-3796.380) (-3806.443) (-3803.681) -- 0:06:44 479000 -- (-3801.890) (-3800.141) [-3799.271] (-3800.661) * (-3791.194) (-3805.058) [-3797.493] (-3794.771) -- 0:06:43 479500 -- [-3793.331] (-3798.806) (-3806.108) (-3792.257) * [-3793.382] (-3796.305) (-3801.248) (-3800.201) -- 0:06:43 480000 -- [-3797.061] (-3797.394) (-3799.753) (-3796.674) * [-3801.144] (-3805.268) (-3795.079) (-3796.594) -- 0:06:43 Average standard deviation of split frequencies: 0.005067 480500 -- (-3819.947) (-3799.899) (-3803.404) [-3803.394] * (-3805.785) (-3801.383) (-3803.990) [-3804.659] -- 0:06:43 481000 -- (-3792.896) [-3795.310] (-3794.709) (-3804.835) * (-3810.589) [-3804.069] (-3796.246) (-3799.381) -- 0:06:42 481500 -- (-3800.515) (-3795.902) [-3799.713] (-3797.939) * (-3795.904) (-3807.268) [-3799.064] (-3797.217) -- 0:06:41 482000 -- (-3795.944) (-3797.543) [-3791.603] (-3815.833) * [-3795.028] (-3796.759) (-3799.124) (-3799.069) -- 0:06:41 482500 -- [-3794.711] (-3807.899) (-3795.584) (-3813.754) * (-3801.636) [-3797.482] (-3796.831) (-3797.202) -- 0:06:41 483000 -- (-3797.159) [-3795.947] (-3801.668) (-3801.405) * (-3802.353) (-3805.441) [-3794.253] (-3792.000) -- 0:06:40 483500 -- (-3798.911) (-3801.018) (-3805.042) [-3804.407] * (-3805.690) (-3798.539) [-3794.200] (-3799.310) -- 0:06:40 484000 -- (-3816.614) (-3800.666) (-3797.029) [-3799.348] * (-3808.334) (-3798.446) (-3800.596) [-3801.212] -- 0:06:39 484500 -- (-3803.417) (-3806.038) [-3797.667] (-3799.187) * [-3798.408] (-3800.921) (-3803.501) (-3800.749) -- 0:06:40 485000 -- (-3799.516) (-3808.556) [-3800.863] (-3801.470) * (-3798.085) (-3799.921) (-3808.812) [-3788.395] -- 0:06:39 Average standard deviation of split frequencies: 0.005658 485500 -- [-3794.807] (-3807.536) (-3811.525) (-3802.113) * (-3803.405) (-3802.135) [-3799.200] (-3801.862) -- 0:06:38 486000 -- [-3805.928] (-3797.312) (-3795.339) (-3801.517) * (-3793.358) (-3803.263) [-3794.546] (-3799.263) -- 0:06:38 486500 -- [-3798.276] (-3799.093) (-3800.142) (-3804.432) * (-3802.599) (-3807.836) (-3799.071) [-3796.142] -- 0:06:37 487000 -- (-3791.194) (-3796.214) [-3792.026] (-3800.958) * (-3807.912) (-3805.664) [-3800.227] (-3799.104) -- 0:06:37 487500 -- (-3790.814) (-3801.777) [-3794.285] (-3797.383) * [-3796.537] (-3801.888) (-3793.272) (-3797.144) -- 0:06:37 488000 -- (-3795.813) (-3803.487) (-3799.759) [-3797.778] * (-3791.372) (-3797.699) (-3802.759) [-3808.269] -- 0:06:36 488500 -- (-3800.311) [-3794.308] (-3798.171) (-3799.056) * [-3794.111] (-3796.361) (-3796.354) (-3806.282) -- 0:06:36 489000 -- (-3799.134) [-3795.440] (-3803.204) (-3805.059) * [-3800.346] (-3802.901) (-3796.433) (-3803.701) -- 0:06:36 489500 -- (-3797.735) [-3797.682] (-3801.217) (-3808.827) * (-3807.606) [-3793.289] (-3806.291) (-3803.993) -- 0:06:35 490000 -- (-3799.313) (-3805.232) [-3797.802] (-3810.049) * (-3799.591) (-3805.833) [-3802.752] (-3803.496) -- 0:06:35 Average standard deviation of split frequencies: 0.006245 490500 -- (-3801.172) [-3796.380] (-3799.799) (-3801.483) * (-3794.915) [-3790.091] (-3792.613) (-3815.331) -- 0:06:34 491000 -- [-3789.949] (-3796.621) (-3795.384) (-3801.373) * [-3794.928] (-3798.991) (-3797.276) (-3808.879) -- 0:06:34 491500 -- (-3795.583) (-3809.087) (-3807.028) [-3795.052] * (-3795.275) (-3803.113) [-3797.236] (-3803.295) -- 0:06:34 492000 -- (-3804.179) [-3794.541] (-3812.937) (-3799.085) * (-3807.887) (-3798.627) [-3798.936] (-3808.561) -- 0:06:33 492500 -- [-3793.460] (-3794.124) (-3798.950) (-3800.287) * [-3797.882] (-3798.000) (-3800.498) (-3808.879) -- 0:06:33 493000 -- (-3811.579) (-3795.395) (-3795.564) [-3800.592] * (-3791.776) (-3805.055) [-3793.901] (-3800.179) -- 0:06:32 493500 -- (-3807.010) (-3801.060) (-3799.878) [-3796.797] * (-3794.710) (-3797.088) (-3794.516) [-3798.754] -- 0:06:32 494000 -- (-3800.124) (-3808.940) [-3807.710] (-3804.796) * [-3798.510] (-3803.268) (-3802.434) (-3804.838) -- 0:06:32 494500 -- (-3800.728) [-3794.331] (-3801.684) (-3811.880) * [-3797.524] (-3795.543) (-3799.047) (-3803.737) -- 0:06:31 495000 -- (-3793.514) (-3806.731) (-3796.459) [-3806.291] * (-3802.442) (-3803.744) (-3808.201) [-3791.123] -- 0:06:31 Average standard deviation of split frequencies: 0.006574 495500 -- (-3791.613) (-3806.358) [-3799.489] (-3792.886) * (-3796.460) (-3796.054) [-3795.323] (-3792.145) -- 0:06:30 496000 -- (-3795.911) [-3802.864] (-3809.692) (-3804.566) * (-3802.748) [-3796.806] (-3797.586) (-3791.353) -- 0:06:30 496500 -- [-3799.671] (-3800.488) (-3799.397) (-3807.042) * [-3797.910] (-3799.859) (-3801.819) (-3795.366) -- 0:06:30 497000 -- (-3795.730) (-3799.339) (-3798.783) [-3795.855] * (-3797.544) (-3796.871) [-3800.532] (-3799.970) -- 0:06:29 497500 -- (-3799.202) (-3793.934) (-3800.416) [-3799.295] * (-3797.923) (-3805.704) [-3792.571] (-3810.447) -- 0:06:29 498000 -- [-3792.086] (-3797.417) (-3797.076) (-3807.001) * [-3795.658] (-3798.066) (-3802.044) (-3802.135) -- 0:06:29 498500 -- [-3805.186] (-3801.211) (-3805.579) (-3806.924) * (-3789.820) (-3797.188) (-3802.371) [-3798.387] -- 0:06:28 499000 -- (-3798.594) [-3794.734] (-3795.475) (-3800.743) * [-3801.480] (-3801.431) (-3797.540) (-3809.917) -- 0:06:28 499500 -- (-3796.654) (-3793.148) [-3792.325] (-3816.118) * (-3813.913) [-3792.341] (-3809.393) (-3800.548) -- 0:06:27 500000 -- (-3800.652) (-3798.215) [-3794.356] (-3798.380) * (-3828.503) (-3797.191) (-3810.399) [-3794.941] -- 0:06:27 Average standard deviation of split frequencies: 0.006512 500500 -- (-3805.779) (-3794.964) (-3800.900) [-3796.543] * (-3802.375) [-3795.737] (-3803.460) (-3796.521) -- 0:06:27 501000 -- (-3790.615) (-3796.226) (-3808.611) [-3792.837] * (-3796.117) (-3805.312) (-3810.932) [-3797.763] -- 0:06:26 501500 -- (-3800.538) (-3801.411) [-3795.523] (-3798.295) * (-3805.250) [-3800.474] (-3804.605) (-3805.056) -- 0:06:26 502000 -- (-3797.022) (-3805.652) (-3803.799) [-3796.864] * (-3793.681) (-3797.938) (-3810.564) [-3800.716] -- 0:06:25 502500 -- (-3801.748) (-3796.518) (-3796.425) [-3803.406] * [-3792.236] (-3800.871) (-3802.573) (-3797.766) -- 0:06:25 503000 -- (-3805.246) [-3799.244] (-3796.530) (-3801.871) * [-3797.829] (-3810.179) (-3796.965) (-3803.065) -- 0:06:25 503500 -- (-3804.128) (-3789.416) [-3792.492] (-3804.651) * [-3790.116] (-3803.868) (-3795.022) (-3800.329) -- 0:06:24 504000 -- (-3801.987) (-3801.310) (-3804.572) [-3796.458] * [-3794.730] (-3801.334) (-3802.466) (-3811.866) -- 0:06:24 504500 -- [-3802.074] (-3794.721) (-3796.664) (-3806.971) * (-3793.466) (-3800.266) (-3797.606) [-3794.662] -- 0:06:24 505000 -- (-3795.338) [-3793.547] (-3807.855) (-3795.484) * [-3794.151] (-3803.314) (-3797.051) (-3801.479) -- 0:06:23 Average standard deviation of split frequencies: 0.006056 505500 -- (-3805.661) (-3798.321) (-3793.390) [-3798.668] * (-3789.928) [-3800.795] (-3799.409) (-3800.969) -- 0:06:23 506000 -- (-3798.914) (-3798.922) [-3793.629] (-3794.059) * [-3794.922] (-3803.885) (-3800.590) (-3796.629) -- 0:06:22 506500 -- (-3812.084) [-3796.617] (-3797.772) (-3794.832) * (-3805.413) (-3801.355) (-3804.606) [-3797.466] -- 0:06:21 507000 -- (-3809.158) (-3799.754) [-3795.649] (-3799.498) * [-3793.791] (-3792.574) (-3793.523) (-3810.737) -- 0:06:22 507500 -- (-3814.228) (-3796.516) (-3804.750) [-3793.661] * (-3794.471) [-3810.164] (-3811.167) (-3803.898) -- 0:06:21 508000 -- (-3803.712) (-3803.409) (-3797.769) [-3802.114] * [-3794.403] (-3798.114) (-3803.265) (-3799.566) -- 0:06:21 508500 -- [-3789.631] (-3795.457) (-3798.459) (-3796.274) * (-3793.101) [-3797.820] (-3800.727) (-3812.574) -- 0:06:20 509000 -- (-3799.504) [-3797.136] (-3808.662) (-3799.124) * [-3793.427] (-3794.592) (-3798.261) (-3801.661) -- 0:06:20 509500 -- (-3801.693) (-3807.034) [-3796.088] (-3803.051) * (-3801.599) (-3802.419) [-3792.992] (-3792.665) -- 0:06:20 510000 -- (-3806.152) (-3804.667) (-3807.397) [-3798.766] * (-3801.370) (-3793.873) (-3805.329) [-3794.499] -- 0:06:19 Average standard deviation of split frequencies: 0.005462 510500 -- [-3801.377] (-3800.615) (-3801.627) (-3798.770) * (-3801.182) (-3795.578) [-3794.345] (-3799.305) -- 0:06:18 511000 -- (-3809.748) (-3796.815) (-3804.034) [-3801.173] * (-3805.083) (-3798.134) (-3795.296) [-3801.816] -- 0:06:18 511500 -- [-3798.953] (-3799.924) (-3804.395) (-3805.074) * (-3804.646) [-3799.446] (-3802.093) (-3798.577) -- 0:06:18 512000 -- (-3798.103) [-3794.037] (-3795.508) (-3800.460) * [-3802.297] (-3797.120) (-3800.010) (-3797.797) -- 0:06:18 512500 -- (-3809.291) (-3797.510) [-3795.899] (-3798.557) * (-3801.548) (-3798.805) (-3792.828) [-3795.409] -- 0:06:17 513000 -- (-3809.134) (-3797.908) [-3794.100] (-3803.024) * (-3809.640) (-3808.031) (-3800.774) [-3797.057] -- 0:06:16 513500 -- [-3796.040] (-3801.675) (-3800.458) (-3807.035) * (-3794.845) (-3809.959) (-3799.895) [-3799.207] -- 0:06:17 514000 -- (-3806.775) (-3792.282) [-3799.764] (-3808.278) * (-3800.739) [-3793.097] (-3799.471) (-3799.808) -- 0:06:16 514500 -- (-3808.141) (-3802.011) (-3797.759) [-3799.856] * (-3796.477) (-3804.541) (-3805.421) [-3792.106] -- 0:06:16 515000 -- [-3810.459] (-3795.016) (-3803.635) (-3797.345) * (-3796.947) (-3805.794) [-3791.262] (-3800.230) -- 0:06:15 Average standard deviation of split frequencies: 0.005101 515500 -- (-3806.460) (-3806.697) (-3801.936) [-3799.717] * (-3809.412) (-3799.110) [-3799.135] (-3800.383) -- 0:06:15 516000 -- (-3796.493) [-3793.401] (-3808.148) (-3798.620) * (-3806.215) [-3800.964] (-3802.252) (-3799.332) -- 0:06:15 516500 -- (-3794.921) (-3795.739) (-3802.268) [-3800.264] * (-3802.052) (-3803.708) [-3803.003] (-3796.673) -- 0:06:14 517000 -- [-3789.893] (-3797.146) (-3798.125) (-3799.361) * (-3811.481) (-3795.018) (-3796.954) [-3804.110] -- 0:06:13 517500 -- (-3794.686) (-3801.528) [-3806.876] (-3798.733) * (-3797.233) (-3798.462) [-3794.065] (-3805.545) -- 0:06:13 518000 -- (-3808.444) (-3795.303) [-3793.774] (-3792.944) * (-3797.201) (-3813.635) [-3800.426] (-3802.095) -- 0:06:13 518500 -- (-3795.618) (-3799.167) [-3788.644] (-3791.630) * (-3792.063) (-3803.358) [-3794.632] (-3799.494) -- 0:06:13 519000 -- (-3802.528) (-3796.313) (-3802.091) [-3791.571] * (-3803.043) (-3809.069) (-3798.806) [-3798.481] -- 0:06:12 519500 -- [-3794.720] (-3800.392) (-3801.657) (-3801.238) * [-3793.004] (-3801.628) (-3794.110) (-3811.429) -- 0:06:11 520000 -- (-3804.577) [-3791.577] (-3800.799) (-3793.701) * (-3793.540) [-3797.588] (-3805.621) (-3791.236) -- 0:06:12 Average standard deviation of split frequencies: 0.005055 520500 -- (-3811.239) [-3791.470] (-3793.135) (-3805.252) * (-3797.652) [-3796.003] (-3817.454) (-3794.025) -- 0:06:11 521000 -- (-3808.776) (-3800.077) (-3799.003) [-3793.299] * (-3807.700) [-3802.511] (-3809.017) (-3797.420) -- 0:06:11 521500 -- (-3802.669) [-3795.511] (-3796.109) (-3797.459) * (-3803.617) (-3802.310) [-3799.839] (-3811.546) -- 0:06:10 522000 -- (-3807.222) [-3797.221] (-3791.532) (-3792.029) * (-3807.624) (-3801.876) (-3799.598) [-3797.533] -- 0:06:09 522500 -- (-3793.767) (-3802.463) (-3807.466) [-3797.462] * (-3798.852) (-3797.939) (-3797.646) [-3801.941] -- 0:06:10 523000 -- (-3794.858) (-3807.434) (-3805.311) [-3792.205] * (-3799.214) (-3804.335) (-3802.365) [-3791.720] -- 0:06:09 523500 -- (-3797.744) (-3800.906) (-3814.641) [-3796.686] * [-3795.222] (-3794.855) (-3799.052) (-3795.604) -- 0:06:08 524000 -- [-3803.369] (-3795.769) (-3801.569) (-3808.426) * [-3795.690] (-3791.103) (-3794.617) (-3803.462) -- 0:06:08 524500 -- (-3807.014) (-3797.329) [-3791.245] (-3798.971) * [-3791.221] (-3800.760) (-3809.723) (-3794.334) -- 0:06:08 525000 -- (-3793.634) [-3798.343] (-3802.223) (-3796.438) * (-3796.866) (-3800.314) (-3803.790) [-3792.536] -- 0:06:08 Average standard deviation of split frequencies: 0.005452 525500 -- (-3801.869) [-3798.241] (-3794.935) (-3794.703) * (-3803.606) (-3814.324) [-3789.809] (-3794.669) -- 0:06:07 526000 -- (-3793.358) (-3796.655) [-3796.744] (-3796.188) * (-3802.037) (-3794.936) (-3805.060) [-3804.687] -- 0:06:06 526500 -- [-3798.642] (-3805.928) (-3793.231) (-3801.824) * [-3802.819] (-3798.268) (-3803.441) (-3804.152) -- 0:06:06 527000 -- [-3792.549] (-3795.809) (-3797.653) (-3798.952) * (-3804.821) [-3796.675] (-3800.387) (-3795.992) -- 0:06:06 527500 -- (-3793.481) (-3801.461) (-3812.762) [-3797.898] * [-3795.568] (-3802.923) (-3795.220) (-3798.596) -- 0:06:06 528000 -- [-3799.187] (-3809.083) (-3804.777) (-3806.080) * [-3794.243] (-3801.805) (-3798.622) (-3798.860) -- 0:06:05 528500 -- (-3799.013) [-3800.417] (-3791.486) (-3797.897) * (-3801.826) (-3796.501) (-3796.661) [-3800.995] -- 0:06:04 529000 -- [-3799.246] (-3805.511) (-3795.481) (-3799.402) * (-3795.582) (-3792.125) [-3795.286] (-3810.848) -- 0:06:05 529500 -- (-3808.816) (-3801.337) (-3802.272) [-3802.399] * [-3809.587] (-3799.182) (-3813.009) (-3805.129) -- 0:06:04 530000 -- (-3814.478) (-3803.634) [-3799.128] (-3797.375) * (-3803.309) (-3800.674) [-3796.819] (-3804.217) -- 0:06:03 Average standard deviation of split frequencies: 0.004812 530500 -- [-3801.959] (-3798.754) (-3804.226) (-3797.030) * [-3797.369] (-3796.707) (-3799.381) (-3797.542) -- 0:06:03 531000 -- (-3802.688) (-3798.141) [-3794.960] (-3790.033) * (-3800.432) [-3794.055] (-3797.029) (-3800.217) -- 0:06:03 531500 -- (-3809.025) (-3799.200) (-3808.660) [-3798.357] * (-3796.178) [-3802.626] (-3794.974) (-3808.019) -- 0:06:03 532000 -- (-3814.355) (-3795.024) (-3794.235) [-3798.796] * (-3808.299) (-3793.165) (-3807.151) [-3797.919] -- 0:06:02 532500 -- (-3804.839) [-3785.816] (-3803.018) (-3803.837) * (-3800.081) (-3806.788) (-3809.930) [-3798.176] -- 0:06:01 533000 -- [-3796.416] (-3791.973) (-3800.700) (-3800.218) * [-3795.758] (-3793.054) (-3814.365) (-3801.402) -- 0:06:01 533500 -- (-3794.093) (-3794.673) (-3795.568) [-3792.584] * (-3795.489) [-3796.893] (-3818.197) (-3809.599) -- 0:06:01 534000 -- (-3798.542) [-3802.423] (-3798.968) (-3798.038) * [-3793.598] (-3800.170) (-3813.846) (-3796.828) -- 0:06:00 534500 -- (-3801.605) [-3794.127] (-3806.200) (-3797.893) * (-3798.413) (-3802.266) (-3803.222) [-3802.006] -- 0:06:00 535000 -- (-3796.897) (-3795.540) [-3796.170] (-3801.460) * (-3794.128) [-3799.980] (-3795.520) (-3808.646) -- 0:05:59 Average standard deviation of split frequencies: 0.004764 535500 -- (-3806.857) (-3813.796) (-3808.399) [-3801.734] * (-3795.939) (-3800.729) [-3797.939] (-3806.809) -- 0:05:59 536000 -- [-3799.745] (-3795.629) (-3804.196) (-3799.731) * (-3798.109) [-3802.656] (-3803.365) (-3800.154) -- 0:05:59 536500 -- (-3795.758) [-3795.131] (-3810.870) (-3806.985) * (-3803.101) (-3794.775) [-3796.723] (-3801.176) -- 0:05:58 537000 -- (-3799.444) (-3810.961) (-3806.715) [-3797.737] * (-3800.274) [-3801.680] (-3801.272) (-3798.665) -- 0:05:58 537500 -- [-3798.417] (-3792.007) (-3807.704) (-3797.555) * [-3794.672] (-3799.393) (-3801.352) (-3800.833) -- 0:05:57 538000 -- [-3795.995] (-3797.135) (-3804.687) (-3796.814) * (-3808.376) (-3806.993) [-3790.282] (-3800.200) -- 0:05:58 538500 -- (-3800.265) [-3788.097] (-3804.109) (-3792.096) * (-3806.203) [-3802.132] (-3797.383) (-3796.845) -- 0:05:57 539000 -- [-3792.254] (-3797.822) (-3808.584) (-3796.536) * (-3801.112) (-3800.493) (-3799.238) [-3791.919] -- 0:05:56 539500 -- (-3800.700) [-3790.773] (-3807.032) (-3802.545) * (-3795.217) (-3800.982) (-3805.789) [-3793.846] -- 0:05:56 540000 -- (-3801.809) [-3792.157] (-3792.380) (-3800.473) * (-3793.552) [-3789.170] (-3792.619) (-3811.669) -- 0:05:56 Average standard deviation of split frequencies: 0.004650 540500 -- (-3802.691) [-3795.322] (-3799.267) (-3806.001) * (-3808.098) [-3808.081] (-3790.064) (-3797.120) -- 0:05:56 541000 -- [-3799.127] (-3795.555) (-3792.352) (-3797.907) * [-3794.652] (-3797.274) (-3797.447) (-3797.177) -- 0:05:55 541500 -- [-3793.158] (-3805.448) (-3803.631) (-3800.407) * (-3804.137) [-3802.899] (-3796.309) (-3805.870) -- 0:05:54 542000 -- (-3802.546) [-3795.675] (-3800.167) (-3802.214) * (-3803.183) (-3804.490) (-3799.187) [-3795.622] -- 0:05:54 542500 -- (-3797.610) (-3802.983) [-3796.246] (-3805.830) * (-3802.373) (-3799.718) (-3803.643) [-3796.889] -- 0:05:54 543000 -- (-3805.510) [-3798.895] (-3796.249) (-3806.692) * (-3798.191) [-3798.196] (-3797.848) (-3799.494) -- 0:05:53 543500 -- [-3794.198] (-3805.339) (-3806.735) (-3804.380) * [-3795.607] (-3799.310) (-3799.865) (-3801.570) -- 0:05:53 544000 -- (-3803.867) (-3794.770) [-3795.337] (-3802.482) * (-3797.327) [-3795.907] (-3801.588) (-3794.203) -- 0:05:52 544500 -- (-3791.352) [-3792.524] (-3805.287) (-3802.544) * [-3802.937] (-3809.598) (-3804.960) (-3794.648) -- 0:05:53 545000 -- [-3797.007] (-3806.231) (-3803.305) (-3813.141) * (-3797.210) [-3798.578] (-3792.448) (-3794.204) -- 0:05:52 Average standard deviation of split frequencies: 0.004964 545500 -- [-3791.436] (-3796.622) (-3805.544) (-3802.895) * [-3793.059] (-3801.278) (-3810.576) (-3798.973) -- 0:05:51 546000 -- [-3791.483] (-3800.764) (-3799.048) (-3814.032) * (-3793.165) [-3804.127] (-3803.713) (-3799.593) -- 0:05:51 546500 -- [-3794.503] (-3807.164) (-3800.433) (-3811.669) * (-3803.650) (-3799.454) [-3801.475] (-3804.221) -- 0:05:51 547000 -- (-3797.680) [-3797.219] (-3800.167) (-3817.051) * (-3805.103) (-3795.737) [-3793.730] (-3808.465) -- 0:05:50 547500 -- (-3801.804) [-3808.360] (-3792.152) (-3801.284) * (-3800.313) (-3796.265) [-3793.619] (-3802.339) -- 0:05:50 548000 -- (-3804.181) (-3806.882) (-3795.685) [-3800.120] * (-3798.587) (-3796.313) (-3791.716) [-3799.592] -- 0:05:49 548500 -- (-3806.030) (-3798.778) (-3799.648) [-3802.967] * (-3797.292) [-3797.732] (-3799.437) (-3803.264) -- 0:05:49 549000 -- (-3798.263) (-3802.670) (-3800.902) [-3802.187] * (-3795.267) (-3795.981) (-3808.979) [-3805.346] -- 0:05:49 549500 -- (-3808.177) (-3798.976) [-3801.603] (-3797.911) * (-3810.435) [-3795.580] (-3797.906) (-3798.645) -- 0:05:48 550000 -- (-3804.506) [-3800.133] (-3801.542) (-3802.559) * (-3801.795) [-3795.984] (-3805.390) (-3807.062) -- 0:05:48 Average standard deviation of split frequencies: 0.005350 550500 -- [-3796.807] (-3795.484) (-3800.310) (-3797.200) * (-3808.323) (-3803.661) (-3794.311) [-3791.303] -- 0:05:47 551000 -- [-3791.426] (-3797.063) (-3797.955) (-3802.190) * (-3793.729) (-3795.499) [-3794.673] (-3791.681) -- 0:05:47 551500 -- (-3798.710) (-3806.751) [-3797.240] (-3797.417) * (-3802.437) [-3792.565] (-3801.794) (-3800.651) -- 0:05:47 552000 -- (-3798.020) (-3810.229) [-3792.813] (-3799.168) * (-3796.426) [-3798.697] (-3795.344) (-3801.030) -- 0:05:46 552500 -- (-3793.996) (-3791.464) [-3799.062] (-3801.148) * (-3805.216) (-3800.139) [-3799.215] (-3799.992) -- 0:05:46 553000 -- (-3799.788) (-3791.463) [-3797.160] (-3801.284) * [-3794.466] (-3799.842) (-3801.565) (-3799.534) -- 0:05:45 553500 -- (-3808.414) (-3792.022) (-3790.581) [-3793.476] * (-3803.351) (-3796.199) (-3800.981) [-3795.980] -- 0:05:45 554000 -- (-3802.377) [-3792.273] (-3793.021) (-3811.919) * (-3800.612) (-3798.297) (-3794.251) [-3792.639] -- 0:05:45 554500 -- (-3810.602) [-3791.097] (-3796.552) (-3801.316) * (-3796.225) (-3804.548) [-3799.327] (-3799.873) -- 0:05:44 555000 -- (-3802.172) [-3794.823] (-3802.596) (-3796.590) * (-3793.564) (-3805.916) [-3799.980] (-3807.027) -- 0:05:44 Average standard deviation of split frequencies: 0.005228 555500 -- (-3800.046) [-3796.189] (-3797.060) (-3812.748) * (-3796.983) (-3796.236) (-3800.051) [-3804.323] -- 0:05:44 556000 -- (-3799.000) (-3806.990) [-3803.846] (-3803.193) * [-3791.048] (-3803.019) (-3798.618) (-3798.816) -- 0:05:43 556500 -- (-3803.408) [-3793.017] (-3798.811) (-3800.385) * [-3794.093] (-3800.316) (-3800.456) (-3801.437) -- 0:05:43 557000 -- (-3801.376) (-3797.846) (-3799.241) [-3792.891] * [-3793.664] (-3803.267) (-3794.681) (-3807.655) -- 0:05:42 557500 -- (-3797.325) (-3794.557) (-3801.777) [-3793.734] * (-3794.730) [-3797.211] (-3793.942) (-3810.437) -- 0:05:42 558000 -- (-3801.379) (-3797.995) (-3789.731) [-3796.689] * [-3799.664] (-3799.653) (-3804.291) (-3805.914) -- 0:05:42 558500 -- (-3797.968) (-3811.212) [-3792.399] (-3793.353) * [-3795.422] (-3797.462) (-3793.199) (-3805.956) -- 0:05:41 559000 -- (-3799.760) (-3806.948) [-3792.284] (-3801.093) * (-3788.205) (-3799.137) [-3799.859] (-3793.947) -- 0:05:41 559500 -- (-3802.783) (-3799.198) (-3797.680) [-3798.934] * [-3794.860] (-3804.388) (-3810.182) (-3804.945) -- 0:05:40 560000 -- (-3810.786) (-3803.674) [-3797.278] (-3806.728) * [-3796.410] (-3795.081) (-3797.425) (-3807.823) -- 0:05:40 Average standard deviation of split frequencies: 0.005115 560500 -- (-3802.453) (-3796.591) (-3794.256) [-3794.870] * [-3796.099] (-3798.046) (-3789.956) (-3797.133) -- 0:05:40 561000 -- (-3795.717) [-3795.575] (-3806.668) (-3797.448) * (-3794.126) (-3794.422) [-3799.049] (-3809.643) -- 0:05:39 561500 -- (-3806.593) (-3811.045) (-3796.870) [-3791.860] * [-3790.352] (-3799.375) (-3798.572) (-3794.348) -- 0:05:39 562000 -- (-3801.952) (-3799.192) (-3796.982) [-3800.615] * (-3796.268) (-3811.306) (-3797.042) [-3799.059] -- 0:05:39 562500 -- (-3797.852) (-3797.186) [-3790.907] (-3794.757) * (-3802.093) (-3800.916) [-3807.281] (-3799.904) -- 0:05:38 563000 -- (-3797.148) [-3804.951] (-3802.041) (-3797.884) * (-3802.707) [-3804.854] (-3794.046) (-3791.194) -- 0:05:38 563500 -- (-3800.052) (-3793.917) [-3799.504] (-3800.287) * (-3800.771) (-3800.141) [-3797.863] (-3803.358) -- 0:05:37 564000 -- [-3795.050] (-3794.358) (-3801.868) (-3794.578) * (-3802.545) [-3794.618] (-3802.632) (-3799.126) -- 0:05:37 564500 -- [-3792.939] (-3797.227) (-3805.743) (-3798.546) * [-3794.873] (-3793.212) (-3803.164) (-3790.086) -- 0:05:37 565000 -- (-3797.043) (-3804.788) (-3804.448) [-3792.194] * (-3794.794) [-3808.123] (-3794.972) (-3797.985) -- 0:05:36 Average standard deviation of split frequencies: 0.004650 565500 -- [-3797.074] (-3803.620) (-3802.910) (-3793.739) * [-3801.432] (-3791.415) (-3799.608) (-3796.898) -- 0:05:36 566000 -- (-3795.135) [-3791.590] (-3800.394) (-3803.049) * (-3792.713) (-3805.771) [-3796.167] (-3796.313) -- 0:05:35 566500 -- [-3797.493] (-3806.100) (-3797.766) (-3801.589) * (-3797.913) (-3809.910) (-3806.886) [-3796.834] -- 0:05:35 567000 -- [-3793.108] (-3811.907) (-3798.970) (-3802.414) * (-3798.939) [-3804.794] (-3807.795) (-3794.581) -- 0:05:35 567500 -- (-3805.761) [-3794.622] (-3803.582) (-3790.595) * (-3803.983) (-3802.775) [-3794.252] (-3799.630) -- 0:05:34 568000 -- (-3798.666) (-3804.477) (-3797.324) [-3794.784] * (-3800.549) (-3798.077) [-3799.651] (-3810.157) -- 0:05:34 568500 -- (-3797.022) [-3796.143] (-3801.475) (-3797.487) * [-3799.567] (-3795.926) (-3799.558) (-3805.852) -- 0:05:33 569000 -- (-3795.185) [-3790.424] (-3795.075) (-3805.402) * (-3795.352) (-3797.737) (-3795.794) [-3800.224] -- 0:05:33 569500 -- [-3792.354] (-3800.473) (-3803.345) (-3796.520) * (-3801.654) (-3802.469) [-3797.062] (-3801.584) -- 0:05:33 570000 -- (-3789.879) (-3803.713) (-3802.278) [-3791.240] * (-3797.072) (-3824.226) [-3802.221] (-3794.927) -- 0:05:32 Average standard deviation of split frequencies: 0.003924 570500 -- [-3797.456] (-3793.711) (-3792.763) (-3811.881) * (-3807.959) (-3811.534) [-3792.530] (-3801.409) -- 0:05:32 571000 -- (-3798.286) (-3806.921) [-3793.241] (-3800.554) * (-3804.353) (-3812.180) [-3792.714] (-3799.296) -- 0:05:32 571500 -- [-3789.792] (-3792.351) (-3809.169) (-3801.342) * [-3792.759] (-3812.130) (-3797.184) (-3801.425) -- 0:05:31 572000 -- (-3799.164) [-3796.802] (-3796.710) (-3804.574) * [-3802.494] (-3801.954) (-3794.717) (-3807.130) -- 0:05:31 572500 -- [-3805.321] (-3794.709) (-3804.166) (-3798.893) * (-3799.427) (-3810.376) [-3801.094] (-3798.661) -- 0:05:30 573000 -- (-3801.945) [-3806.926] (-3807.423) (-3798.349) * (-3792.085) [-3798.065] (-3816.018) (-3797.517) -- 0:05:30 573500 -- (-3799.499) [-3797.377] (-3801.053) (-3800.513) * (-3795.758) [-3798.060] (-3813.781) (-3804.440) -- 0:05:30 574000 -- (-3795.208) [-3799.114] (-3811.763) (-3813.031) * (-3798.906) [-3798.210] (-3803.360) (-3793.354) -- 0:05:29 574500 -- (-3796.460) [-3798.007] (-3797.413) (-3798.098) * [-3804.112] (-3804.501) (-3797.147) (-3795.615) -- 0:05:28 575000 -- (-3792.525) [-3794.769] (-3796.659) (-3804.345) * (-3806.037) (-3805.607) [-3797.810] (-3793.776) -- 0:05:28 Average standard deviation of split frequencies: 0.004297 575500 -- [-3798.540] (-3792.130) (-3797.247) (-3802.416) * [-3795.268] (-3804.165) (-3799.734) (-3792.515) -- 0:05:28 576000 -- [-3800.015] (-3797.037) (-3808.023) (-3793.940) * [-3796.624] (-3809.674) (-3806.402) (-3788.398) -- 0:05:28 576500 -- (-3797.120) [-3797.150] (-3796.886) (-3793.331) * [-3791.511] (-3802.613) (-3806.270) (-3797.739) -- 0:05:27 577000 -- (-3795.126) (-3801.747) (-3795.537) [-3802.597] * (-3794.777) (-3795.365) (-3806.610) [-3790.464] -- 0:05:26 577500 -- (-3800.671) (-3796.944) [-3793.257] (-3813.443) * (-3801.351) [-3797.970] (-3806.615) (-3794.865) -- 0:05:27 578000 -- (-3801.542) (-3794.916) (-3805.912) [-3796.536] * [-3798.111] (-3808.493) (-3798.525) (-3793.570) -- 0:05:26 578500 -- (-3804.732) (-3803.426) [-3799.965] (-3793.395) * [-3798.897] (-3802.911) (-3794.306) (-3799.020) -- 0:05:26 579000 -- [-3794.976] (-3807.056) (-3796.563) (-3803.749) * (-3790.786) (-3800.382) (-3797.181) [-3790.614] -- 0:05:25 579500 -- (-3794.398) (-3797.213) (-3799.766) [-3800.217] * [-3796.754] (-3799.481) (-3801.301) (-3793.333) -- 0:05:25 580000 -- [-3794.657] (-3808.916) (-3798.074) (-3806.516) * (-3795.248) (-3807.560) [-3800.169] (-3806.609) -- 0:05:25 Average standard deviation of split frequencies: 0.004397 580500 -- (-3792.597) (-3799.376) (-3799.448) [-3805.126] * (-3798.282) (-3813.124) (-3798.117) [-3795.733] -- 0:05:24 581000 -- [-3792.756] (-3793.009) (-3792.525) (-3796.726) * [-3791.461] (-3797.055) (-3796.349) (-3790.468) -- 0:05:23 581500 -- (-3799.576) (-3795.760) (-3795.383) [-3793.672] * [-3800.321] (-3794.547) (-3810.059) (-3804.386) -- 0:05:23 582000 -- (-3801.677) [-3792.838] (-3791.719) (-3798.481) * [-3789.204] (-3796.895) (-3806.637) (-3795.052) -- 0:05:23 582500 -- (-3797.114) (-3809.690) [-3799.063] (-3801.539) * [-3794.688] (-3797.494) (-3795.084) (-3795.933) -- 0:05:23 583000 -- (-3797.510) (-3798.802) (-3793.943) [-3797.215] * [-3791.470] (-3795.815) (-3805.435) (-3794.624) -- 0:05:22 583500 -- [-3799.748] (-3810.239) (-3799.967) (-3801.263) * (-3806.883) (-3804.918) (-3802.248) [-3795.135] -- 0:05:21 584000 -- [-3797.310] (-3816.161) (-3791.099) (-3803.326) * (-3811.693) (-3791.595) [-3797.129] (-3803.030) -- 0:05:21 584500 -- (-3799.065) (-3807.013) (-3793.710) [-3801.613] * (-3797.577) (-3800.530) (-3797.293) [-3791.489] -- 0:05:21 585000 -- (-3795.930) (-3802.902) [-3791.831] (-3791.434) * [-3795.555] (-3793.362) (-3805.275) (-3802.010) -- 0:05:21 Average standard deviation of split frequencies: 0.004022 585500 -- (-3802.232) [-3794.821] (-3798.616) (-3790.875) * (-3791.776) (-3808.109) [-3792.080] (-3796.069) -- 0:05:20 586000 -- (-3795.238) [-3796.741] (-3800.612) (-3798.217) * [-3803.209] (-3819.100) (-3795.285) (-3802.288) -- 0:05:20 586500 -- [-3799.074] (-3817.961) (-3806.161) (-3800.566) * (-3808.425) [-3799.200] (-3796.838) (-3798.829) -- 0:05:20 587000 -- [-3800.374] (-3799.189) (-3810.653) (-3805.933) * (-3793.382) (-3794.922) [-3795.420] (-3798.434) -- 0:05:19 587500 -- (-3795.850) (-3812.202) [-3794.345] (-3796.258) * (-3805.047) (-3794.945) (-3795.150) [-3794.342] -- 0:05:18 588000 -- [-3792.781] (-3802.752) (-3803.988) (-3803.629) * [-3798.474] (-3803.879) (-3800.668) (-3801.874) -- 0:05:18 588500 -- (-3802.785) [-3800.980] (-3795.919) (-3804.615) * (-3807.234) (-3798.892) [-3796.652] (-3798.319) -- 0:05:18 589000 -- (-3793.192) (-3790.923) [-3797.204] (-3799.026) * (-3805.978) (-3799.415) (-3798.900) [-3796.531] -- 0:05:18 589500 -- (-3795.447) [-3794.765] (-3794.535) (-3797.868) * (-3798.702) (-3802.298) [-3794.324] (-3802.578) -- 0:05:17 590000 -- (-3804.868) (-3803.230) [-3793.088] (-3804.435) * (-3798.720) (-3802.936) (-3798.413) [-3797.685] -- 0:05:16 Average standard deviation of split frequencies: 0.003990 590500 -- (-3796.876) [-3795.348] (-3791.767) (-3795.431) * [-3808.006] (-3810.040) (-3798.250) (-3809.362) -- 0:05:16 591000 -- (-3793.145) (-3797.756) (-3794.471) [-3790.673] * (-3801.635) (-3801.374) [-3795.537] (-3808.813) -- 0:05:16 591500 -- (-3794.129) [-3791.800] (-3805.539) (-3795.358) * (-3806.949) (-3796.832) (-3801.886) [-3797.420] -- 0:05:15 592000 -- (-3807.688) [-3799.214] (-3810.447) (-3797.010) * (-3805.231) (-3799.338) [-3796.920] (-3798.760) -- 0:05:15 592500 -- (-3794.718) (-3796.016) [-3791.338] (-3799.867) * (-3795.661) (-3801.230) (-3804.311) [-3803.344] -- 0:05:14 593000 -- (-3813.419) (-3798.425) [-3798.407] (-3797.949) * (-3792.097) (-3802.007) [-3791.904] (-3807.191) -- 0:05:15 593500 -- (-3798.421) [-3797.397] (-3800.027) (-3801.084) * (-3800.820) (-3797.927) (-3805.046) [-3793.237] -- 0:05:14 594000 -- (-3798.811) (-3800.224) (-3805.721) [-3797.490] * [-3801.445] (-3803.173) (-3797.139) (-3800.219) -- 0:05:13 594500 -- (-3794.944) [-3798.032] (-3806.355) (-3795.864) * (-3803.493) [-3792.877] (-3801.185) (-3801.504) -- 0:05:13 595000 -- [-3799.059] (-3793.719) (-3800.346) (-3799.433) * (-3805.737) [-3795.434] (-3803.825) (-3796.347) -- 0:05:13 Average standard deviation of split frequencies: 0.004152 595500 -- (-3797.134) (-3804.332) [-3792.494] (-3799.365) * (-3803.717) (-3797.691) (-3799.883) [-3799.649] -- 0:05:13 596000 -- (-3802.335) (-3810.386) [-3792.598] (-3800.241) * (-3797.567) (-3794.953) (-3808.604) [-3792.337] -- 0:05:12 596500 -- (-3803.981) (-3809.834) [-3790.602] (-3793.190) * (-3794.495) (-3803.043) (-3799.962) [-3796.892] -- 0:05:11 597000 -- [-3807.074] (-3801.102) (-3798.240) (-3798.529) * [-3796.877] (-3800.488) (-3798.878) (-3799.424) -- 0:05:11 597500 -- (-3794.804) (-3791.806) (-3797.880) [-3796.325] * (-3793.111) (-3799.405) [-3795.575] (-3800.496) -- 0:05:11 598000 -- (-3802.983) [-3799.639] (-3797.211) (-3797.756) * (-3791.575) (-3806.279) [-3796.541] (-3795.186) -- 0:05:10 598500 -- (-3802.832) (-3799.362) [-3794.026] (-3798.804) * [-3787.729] (-3809.554) (-3798.063) (-3798.210) -- 0:05:10 599000 -- (-3799.643) (-3799.370) (-3790.163) [-3792.250] * (-3803.979) [-3796.913] (-3794.974) (-3808.661) -- 0:05:09 599500 -- (-3801.794) (-3796.551) (-3795.525) [-3802.355] * (-3793.588) (-3798.258) (-3800.938) [-3796.067] -- 0:05:09 600000 -- (-3804.026) (-3799.804) [-3791.112] (-3805.161) * (-3799.170) [-3795.048] (-3795.520) (-3804.351) -- 0:05:09 Average standard deviation of split frequencies: 0.003532 600500 -- [-3791.795] (-3799.537) (-3793.919) (-3795.553) * (-3795.994) [-3793.060] (-3798.697) (-3804.983) -- 0:05:08 601000 -- (-3812.016) (-3798.318) (-3804.051) [-3795.062] * [-3793.977] (-3799.693) (-3793.446) (-3795.272) -- 0:05:08 601500 -- (-3796.641) [-3802.600] (-3804.883) (-3807.477) * (-3805.838) (-3802.617) [-3798.412] (-3807.884) -- 0:05:08 602000 -- (-3793.187) (-3789.802) [-3807.751] (-3794.668) * [-3797.463] (-3804.424) (-3802.459) (-3805.668) -- 0:05:08 602500 -- (-3803.156) (-3793.083) [-3796.211] (-3792.255) * (-3800.699) (-3801.508) [-3796.350] (-3793.590) -- 0:05:07 603000 -- (-3795.062) [-3796.658] (-3793.443) (-3808.092) * [-3798.322] (-3809.206) (-3796.374) (-3796.279) -- 0:05:06 603500 -- (-3808.272) [-3803.760] (-3798.346) (-3796.830) * (-3799.554) (-3794.207) (-3804.909) [-3800.993] -- 0:05:06 604000 -- (-3802.312) [-3795.196] (-3802.996) (-3795.384) * (-3801.087) (-3808.834) [-3795.207] (-3796.712) -- 0:05:06 604500 -- (-3806.906) (-3792.552) (-3791.123) [-3792.853] * (-3798.571) (-3803.249) [-3791.565] (-3802.257) -- 0:05:05 605000 -- (-3807.523) (-3797.526) (-3797.625) [-3791.765] * (-3793.767) (-3803.959) [-3794.021] (-3810.337) -- 0:05:05 Average standard deviation of split frequencies: 0.003371 605500 -- (-3798.195) (-3801.999) (-3798.297) [-3800.469] * (-3793.710) (-3802.327) [-3790.337] (-3803.826) -- 0:05:04 606000 -- (-3796.954) (-3800.597) [-3793.208] (-3794.751) * (-3792.870) [-3798.390] (-3794.158) (-3793.489) -- 0:05:04 606500 -- (-3816.469) (-3802.616) [-3791.418] (-3803.240) * [-3800.968] (-3810.173) (-3794.088) (-3801.144) -- 0:05:04 607000 -- (-3801.538) [-3800.978] (-3796.639) (-3795.997) * (-3803.287) (-3813.356) (-3796.410) [-3795.857] -- 0:05:03 607500 -- (-3807.029) (-3796.459) (-3798.288) [-3796.182] * (-3797.940) [-3800.879] (-3800.674) (-3801.494) -- 0:05:03 608000 -- [-3794.126] (-3796.929) (-3792.973) (-3798.099) * (-3808.669) (-3805.888) [-3793.965] (-3796.350) -- 0:05:03 608500 -- (-3800.954) [-3801.924] (-3791.842) (-3792.171) * (-3798.628) (-3798.542) [-3797.285] (-3798.622) -- 0:05:03 609000 -- (-3801.852) (-3796.425) (-3794.563) [-3786.604] * (-3809.653) [-3792.290] (-3799.829) (-3810.809) -- 0:05:02 609500 -- (-3802.104) [-3791.334] (-3799.473) (-3803.821) * (-3800.553) [-3794.164] (-3796.202) (-3797.318) -- 0:05:01 610000 -- [-3789.872] (-3795.122) (-3793.531) (-3803.004) * (-3795.009) (-3797.381) [-3802.127] (-3802.852) -- 0:05:01 Average standard deviation of split frequencies: 0.003409 610500 -- (-3791.712) (-3790.255) (-3813.194) [-3797.587] * (-3795.894) (-3802.962) (-3795.448) [-3799.493] -- 0:05:01 611000 -- (-3801.246) [-3792.916] (-3802.314) (-3798.189) * [-3801.451] (-3804.473) (-3793.595) (-3806.858) -- 0:05:00 611500 -- (-3804.841) (-3796.194) (-3805.397) [-3799.245] * (-3807.098) (-3794.923) (-3804.187) [-3810.964] -- 0:05:00 612000 -- (-3800.590) [-3797.052] (-3797.689) (-3809.581) * [-3809.367] (-3795.778) (-3800.645) (-3800.715) -- 0:04:59 612500 -- (-3801.094) (-3796.851) (-3805.120) [-3804.913] * [-3794.760] (-3802.567) (-3800.862) (-3805.059) -- 0:04:59 613000 -- (-3796.922) (-3792.290) (-3797.770) [-3799.891] * [-3795.306] (-3804.704) (-3794.123) (-3805.282) -- 0:04:59 613500 -- (-3802.464) [-3797.095] (-3803.926) (-3794.738) * [-3795.557] (-3799.378) (-3795.834) (-3798.271) -- 0:04:58 614000 -- (-3798.223) (-3810.540) (-3809.807) [-3797.101] * [-3795.118] (-3811.731) (-3794.314) (-3804.680) -- 0:04:58 614500 -- [-3788.427] (-3815.753) (-3805.763) (-3793.753) * (-3804.585) (-3806.689) [-3801.643] (-3792.994) -- 0:04:57 615000 -- (-3801.188) (-3802.802) (-3804.537) [-3792.675] * (-3795.617) (-3807.416) (-3799.004) [-3795.839] -- 0:04:57 Average standard deviation of split frequencies: 0.004081 615500 -- (-3791.325) (-3811.662) (-3809.812) [-3791.123] * [-3792.938] (-3804.071) (-3799.824) (-3794.392) -- 0:04:57 616000 -- (-3803.429) (-3809.880) [-3794.531] (-3801.308) * [-3794.383] (-3806.663) (-3812.896) (-3797.431) -- 0:04:56 616500 -- (-3795.705) (-3808.516) [-3799.726] (-3797.485) * (-3792.305) (-3801.578) [-3796.292] (-3801.971) -- 0:04:56 617000 -- (-3793.318) (-3802.460) (-3798.465) [-3797.377] * [-3797.793] (-3803.516) (-3798.194) (-3797.685) -- 0:04:56 617500 -- (-3793.442) [-3794.193] (-3794.997) (-3795.501) * (-3793.295) [-3795.511] (-3801.697) (-3805.242) -- 0:04:55 618000 -- (-3790.943) (-3801.332) [-3799.020] (-3803.639) * [-3796.221] (-3799.884) (-3809.275) (-3793.804) -- 0:04:55 618500 -- (-3793.614) (-3797.785) [-3795.552] (-3796.229) * [-3796.518] (-3795.763) (-3800.054) (-3798.260) -- 0:04:54 619000 -- (-3801.777) [-3803.944] (-3807.622) (-3806.409) * [-3795.566] (-3809.157) (-3799.689) (-3797.431) -- 0:04:54 619500 -- (-3793.499) (-3806.009) (-3804.098) [-3794.019] * [-3801.819] (-3797.026) (-3801.566) (-3794.662) -- 0:04:54 620000 -- (-3798.824) [-3795.021] (-3801.577) (-3800.185) * (-3797.824) [-3796.619] (-3806.879) (-3799.648) -- 0:04:53 Average standard deviation of split frequencies: 0.003734 620500 -- [-3810.802] (-3792.621) (-3799.718) (-3792.951) * (-3807.103) (-3804.771) [-3797.508] (-3805.879) -- 0:04:53 621000 -- (-3798.035) (-3807.887) [-3797.088] (-3800.966) * (-3811.110) (-3797.809) [-3793.101] (-3807.776) -- 0:04:52 621500 -- (-3800.013) [-3795.467] (-3791.826) (-3801.444) * (-3803.558) (-3807.319) (-3800.253) [-3799.112] -- 0:04:52 622000 -- (-3792.776) [-3802.727] (-3803.416) (-3800.433) * (-3806.367) [-3806.843] (-3787.660) (-3791.505) -- 0:04:52 622500 -- (-3793.271) [-3797.730] (-3798.863) (-3800.507) * (-3802.148) (-3803.228) [-3804.656] (-3802.500) -- 0:04:51 623000 -- (-3802.072) (-3801.162) [-3794.590] (-3808.225) * (-3806.506) [-3798.661] (-3803.774) (-3791.918) -- 0:04:51 623500 -- (-3802.357) (-3798.129) [-3797.874] (-3804.598) * (-3802.806) (-3800.238) [-3797.919] (-3800.285) -- 0:04:51 624000 -- (-3795.545) (-3799.509) (-3796.336) [-3797.605] * (-3795.756) [-3798.024] (-3799.454) (-3806.889) -- 0:04:50 624500 -- (-3808.672) (-3798.483) (-3795.592) [-3795.857] * (-3791.288) [-3797.407] (-3792.110) (-3803.372) -- 0:04:50 625000 -- (-3795.993) (-3791.909) (-3799.638) [-3794.442] * [-3792.785] (-3806.315) (-3797.567) (-3800.134) -- 0:04:49 Average standard deviation of split frequencies: 0.004079 625500 -- (-3800.787) (-3803.418) [-3791.430] (-3795.854) * (-3798.032) (-3801.843) (-3798.844) [-3802.130] -- 0:04:49 626000 -- [-3799.862] (-3807.121) (-3799.314) (-3802.109) * (-3797.622) (-3800.585) [-3803.222] (-3793.702) -- 0:04:49 626500 -- (-3796.477) (-3799.450) [-3800.085] (-3815.541) * (-3801.661) (-3797.588) [-3795.880] (-3794.701) -- 0:04:48 627000 -- (-3794.001) (-3800.829) [-3803.968] (-3809.473) * [-3791.511] (-3795.960) (-3806.090) (-3802.510) -- 0:04:48 627500 -- (-3792.321) [-3794.123] (-3810.624) (-3803.906) * (-3791.076) (-3795.405) (-3805.279) [-3796.109] -- 0:04:47 628000 -- [-3806.588] (-3794.263) (-3799.660) (-3798.924) * (-3796.600) [-3792.823] (-3803.577) (-3803.938) -- 0:04:47 628500 -- [-3793.040] (-3792.674) (-3795.153) (-3797.250) * [-3794.804] (-3795.371) (-3802.369) (-3795.834) -- 0:04:47 629000 -- [-3799.484] (-3795.583) (-3806.326) (-3798.922) * [-3798.680] (-3793.571) (-3798.065) (-3792.289) -- 0:04:46 629500 -- (-3806.812) [-3796.427] (-3789.530) (-3809.318) * (-3800.062) (-3792.112) (-3801.883) [-3800.441] -- 0:04:46 630000 -- (-3790.741) [-3800.486] (-3792.323) (-3800.995) * (-3797.663) (-3807.764) [-3798.478] (-3797.654) -- 0:04:46 Average standard deviation of split frequencies: 0.004547 630500 -- (-3804.683) (-3803.636) [-3805.453] (-3796.477) * [-3794.375] (-3798.482) (-3796.077) (-3804.094) -- 0:04:45 631000 -- (-3805.083) [-3797.392] (-3797.889) (-3792.006) * (-3800.809) (-3793.944) (-3797.544) [-3800.303] -- 0:04:45 631500 -- (-3802.529) [-3791.417] (-3808.322) (-3798.256) * (-3794.453) (-3804.932) (-3795.577) [-3788.874] -- 0:04:44 632000 -- [-3800.371] (-3794.155) (-3798.430) (-3800.004) * (-3794.522) (-3805.210) [-3795.231] (-3804.378) -- 0:04:44 632500 -- (-3797.187) [-3794.694] (-3803.259) (-3798.307) * (-3795.401) (-3810.483) (-3802.341) [-3808.486] -- 0:04:44 633000 -- (-3797.155) [-3794.676] (-3798.830) (-3802.904) * (-3797.855) (-3804.536) (-3795.211) [-3792.528] -- 0:04:43 633500 -- (-3798.718) [-3790.639] (-3798.651) (-3806.939) * (-3800.402) [-3797.336] (-3801.211) (-3804.884) -- 0:04:43 634000 -- (-3805.192) (-3794.798) [-3796.477] (-3802.064) * (-3793.085) [-3802.573] (-3803.235) (-3802.590) -- 0:04:42 634500 -- (-3793.829) (-3796.240) [-3793.569] (-3804.286) * (-3796.874) (-3796.942) [-3795.116] (-3799.058) -- 0:04:42 635000 -- [-3801.438] (-3796.441) (-3799.187) (-3810.334) * (-3805.377) [-3799.087] (-3802.957) (-3798.867) -- 0:04:42 Average standard deviation of split frequencies: 0.004385 635500 -- (-3799.727) [-3800.812] (-3797.362) (-3801.191) * (-3807.636) [-3791.314] (-3800.018) (-3801.395) -- 0:04:41 636000 -- (-3807.033) (-3796.956) [-3799.294] (-3799.769) * (-3800.111) [-3801.461] (-3797.107) (-3798.261) -- 0:04:41 636500 -- (-3802.225) [-3794.380] (-3789.747) (-3797.459) * (-3795.232) (-3809.227) [-3792.162] (-3807.625) -- 0:04:40 637000 -- (-3793.299) (-3793.900) [-3793.737] (-3794.822) * (-3795.500) (-3803.039) [-3795.686] (-3796.887) -- 0:04:40 637500 -- [-3796.812] (-3799.296) (-3800.885) (-3799.872) * (-3801.338) [-3799.654] (-3795.562) (-3799.485) -- 0:04:40 638000 -- (-3798.774) (-3797.568) (-3791.286) [-3792.752] * (-3806.916) [-3804.564] (-3803.414) (-3792.298) -- 0:04:39 638500 -- [-3796.146] (-3799.743) (-3794.269) (-3800.426) * (-3798.828) (-3795.355) (-3796.673) [-3796.894] -- 0:04:39 639000 -- (-3797.062) (-3805.456) [-3796.789] (-3796.102) * (-3797.845) (-3805.245) [-3793.847] (-3792.555) -- 0:04:39 639500 -- (-3798.286) [-3794.138] (-3800.363) (-3795.528) * [-3800.521] (-3812.451) (-3797.224) (-3798.087) -- 0:04:38 640000 -- (-3802.112) (-3807.994) (-3799.285) [-3796.391] * (-3793.862) (-3803.626) [-3798.432] (-3799.156) -- 0:04:38 Average standard deviation of split frequencies: 0.005273 640500 -- (-3798.003) (-3817.641) [-3789.627] (-3803.278) * (-3807.353) (-3795.769) [-3799.589] (-3804.404) -- 0:04:37 641000 -- [-3789.682] (-3810.973) (-3805.724) (-3795.158) * (-3806.554) [-3792.819] (-3795.887) (-3799.841) -- 0:04:37 641500 -- (-3794.826) [-3793.966] (-3793.240) (-3802.711) * (-3810.067) [-3795.149] (-3797.308) (-3800.448) -- 0:04:37 642000 -- (-3799.694) [-3799.424] (-3794.351) (-3803.961) * (-3802.019) (-3807.889) [-3788.429] (-3790.598) -- 0:04:36 642500 -- (-3809.330) (-3795.794) (-3796.469) [-3802.612] * (-3799.626) (-3792.588) [-3788.855] (-3793.246) -- 0:04:36 643000 -- (-3793.011) [-3794.146] (-3798.521) (-3807.680) * (-3795.582) (-3801.050) (-3791.922) [-3797.614] -- 0:04:35 643500 -- (-3801.044) (-3799.437) [-3796.686] (-3805.564) * [-3790.960] (-3796.078) (-3796.915) (-3792.133) -- 0:04:35 644000 -- [-3795.632] (-3815.655) (-3800.091) (-3792.851) * (-3792.978) [-3800.402] (-3797.046) (-3799.066) -- 0:04:35 644500 -- [-3793.515] (-3810.618) (-3813.996) (-3797.042) * (-3800.732) [-3796.943] (-3795.949) (-3802.012) -- 0:04:34 645000 -- (-3795.206) (-3807.063) (-3810.601) [-3796.903] * [-3794.140] (-3795.260) (-3803.358) (-3798.014) -- 0:04:34 Average standard deviation of split frequencies: 0.005108 645500 -- (-3795.684) [-3795.857] (-3802.335) (-3799.466) * (-3802.309) (-3802.744) [-3798.440] (-3808.201) -- 0:04:34 646000 -- (-3792.513) [-3792.327] (-3801.032) (-3791.418) * (-3803.497) (-3795.109) [-3789.771] (-3800.326) -- 0:04:33 646500 -- [-3790.532] (-3794.350) (-3799.320) (-3801.892) * (-3803.169) [-3802.123] (-3801.091) (-3797.565) -- 0:04:33 647000 -- [-3796.849] (-3801.847) (-3795.234) (-3797.683) * (-3807.454) [-3795.419] (-3799.686) (-3796.511) -- 0:04:32 647500 -- [-3797.500] (-3803.987) (-3796.770) (-3801.730) * (-3803.321) (-3798.362) [-3796.873] (-3796.473) -- 0:04:32 648000 -- (-3791.995) (-3795.977) (-3792.549) [-3800.355] * [-3801.719] (-3797.208) (-3803.739) (-3798.103) -- 0:04:32 648500 -- (-3804.106) (-3797.838) [-3802.709] (-3792.097) * [-3800.385] (-3793.696) (-3800.033) (-3798.998) -- 0:04:31 649000 -- (-3799.478) (-3800.707) (-3804.532) [-3792.948] * [-3789.530] (-3792.052) (-3798.832) (-3802.297) -- 0:04:31 649500 -- (-3802.578) (-3790.702) (-3809.355) [-3801.064] * (-3795.899) (-3798.786) [-3800.363] (-3802.407) -- 0:04:30 650000 -- (-3802.688) (-3796.220) [-3796.519] (-3791.028) * [-3797.834] (-3793.059) (-3806.098) (-3795.379) -- 0:04:30 Average standard deviation of split frequencies: 0.004588 650500 -- (-3801.433) [-3794.403] (-3801.770) (-3791.218) * (-3803.016) [-3794.885] (-3797.348) (-3797.550) -- 0:04:30 651000 -- (-3791.811) [-3794.861] (-3801.506) (-3798.943) * (-3805.192) (-3792.034) (-3799.534) [-3794.879] -- 0:04:29 651500 -- (-3801.313) (-3795.127) (-3799.539) [-3792.774] * (-3805.880) (-3793.526) [-3797.574] (-3798.829) -- 0:04:29 652000 -- (-3791.900) (-3803.063) (-3794.755) [-3796.566] * (-3802.671) (-3797.597) (-3808.266) [-3800.332] -- 0:04:29 652500 -- (-3797.178) (-3803.021) [-3802.665] (-3799.682) * (-3795.797) (-3813.692) [-3799.716] (-3805.175) -- 0:04:28 653000 -- (-3795.728) (-3796.937) [-3795.481] (-3800.788) * (-3796.816) [-3794.770] (-3814.760) (-3802.090) -- 0:04:28 653500 -- (-3800.118) [-3799.980] (-3805.082) (-3794.119) * [-3793.731] (-3803.883) (-3807.167) (-3798.324) -- 0:04:27 654000 -- [-3795.881] (-3793.070) (-3802.679) (-3798.481) * (-3793.825) (-3807.243) [-3798.080] (-3802.570) -- 0:04:27 654500 -- (-3792.053) (-3807.786) (-3806.723) [-3795.481] * [-3794.953] (-3804.789) (-3800.046) (-3804.144) -- 0:04:27 655000 -- (-3802.780) (-3803.776) (-3797.480) [-3794.159] * [-3794.882] (-3808.795) (-3800.576) (-3794.765) -- 0:04:26 Average standard deviation of split frequencies: 0.004731 655500 -- (-3809.852) (-3805.325) (-3796.990) [-3794.555] * [-3806.043] (-3801.150) (-3799.832) (-3792.979) -- 0:04:26 656000 -- (-3797.272) (-3792.175) [-3792.433] (-3790.058) * [-3792.689] (-3799.922) (-3796.732) (-3794.251) -- 0:04:25 656500 -- (-3798.085) (-3799.990) (-3797.440) [-3791.849] * (-3804.037) (-3806.174) (-3799.870) [-3792.407] -- 0:04:25 657000 -- [-3790.343] (-3804.070) (-3791.149) (-3800.843) * (-3799.286) (-3808.097) (-3802.863) [-3791.984] -- 0:04:25 657500 -- [-3794.143] (-3800.540) (-3796.954) (-3794.239) * [-3796.696] (-3799.835) (-3807.138) (-3803.557) -- 0:04:24 658000 -- [-3797.265] (-3791.250) (-3797.228) (-3803.854) * (-3798.551) [-3797.155] (-3796.796) (-3795.211) -- 0:04:24 658500 -- (-3807.931) (-3797.935) [-3791.653] (-3802.793) * (-3796.078) [-3806.061] (-3801.596) (-3795.467) -- 0:04:23 659000 -- (-3795.423) [-3795.056] (-3801.765) (-3801.395) * (-3799.552) (-3801.725) (-3803.377) [-3794.548] -- 0:04:23 659500 -- (-3800.865) (-3809.061) (-3804.246) [-3805.012] * (-3800.463) (-3798.521) (-3795.044) [-3798.690] -- 0:04:23 660000 -- [-3806.174] (-3809.095) (-3807.172) (-3803.565) * (-3800.205) (-3803.546) (-3803.714) [-3792.571] -- 0:04:22 Average standard deviation of split frequencies: 0.004876 660500 -- (-3796.762) (-3809.145) [-3793.782] (-3798.783) * (-3798.482) [-3792.547] (-3792.966) (-3803.135) -- 0:04:22 661000 -- (-3800.517) (-3810.783) (-3797.943) [-3802.969] * (-3790.819) (-3805.629) (-3795.869) [-3800.127] -- 0:04:22 661500 -- (-3796.758) [-3801.362] (-3798.969) (-3799.368) * [-3794.055] (-3797.472) (-3798.293) (-3805.552) -- 0:04:21 662000 -- (-3794.577) (-3803.234) (-3812.833) [-3794.518] * (-3799.047) (-3796.493) [-3795.106] (-3792.468) -- 0:04:21 662500 -- (-3794.568) (-3797.663) (-3812.831) [-3799.186] * [-3795.251] (-3796.031) (-3795.792) (-3798.904) -- 0:04:20 663000 -- (-3808.864) [-3795.765] (-3799.341) (-3800.814) * (-3804.858) (-3796.980) (-3799.426) [-3791.471] -- 0:04:20 663500 -- (-3819.984) (-3792.076) [-3804.602] (-3803.896) * (-3796.999) (-3797.919) (-3805.991) [-3794.575] -- 0:04:20 664000 -- [-3798.256] (-3799.768) (-3807.843) (-3811.033) * [-3799.769] (-3799.719) (-3813.511) (-3807.666) -- 0:04:19 664500 -- (-3799.103) (-3806.896) (-3798.679) [-3800.958] * (-3801.877) (-3801.669) (-3798.115) [-3803.301] -- 0:04:19 665000 -- (-3806.511) (-3801.099) [-3802.317] (-3796.810) * (-3796.739) [-3794.304] (-3799.247) (-3808.772) -- 0:04:18 Average standard deviation of split frequencies: 0.004601 665500 -- (-3801.985) (-3806.261) (-3799.580) [-3789.275] * (-3798.081) (-3804.832) [-3795.616] (-3796.685) -- 0:04:18 666000 -- (-3806.214) (-3794.690) (-3809.283) [-3790.089] * (-3797.929) [-3798.820] (-3802.870) (-3800.009) -- 0:04:18 666500 -- (-3801.198) [-3795.176] (-3802.525) (-3791.550) * (-3805.485) (-3795.238) (-3800.858) [-3795.191] -- 0:04:17 667000 -- [-3796.595] (-3801.070) (-3801.018) (-3798.168) * (-3800.715) [-3795.497] (-3799.096) (-3799.530) -- 0:04:17 667500 -- (-3806.462) [-3797.388] (-3794.725) (-3798.720) * [-3800.679] (-3797.515) (-3800.812) (-3792.758) -- 0:04:17 668000 -- (-3802.129) (-3807.923) [-3793.611] (-3804.532) * [-3797.404] (-3801.601) (-3802.504) (-3793.037) -- 0:04:16 668500 -- (-3800.438) (-3802.805) (-3803.128) [-3802.110] * (-3803.335) (-3806.464) (-3794.894) [-3789.522] -- 0:04:16 669000 -- [-3802.141] (-3795.951) (-3799.873) (-3794.207) * (-3798.665) (-3806.797) [-3800.077] (-3804.477) -- 0:04:15 669500 -- [-3795.486] (-3800.817) (-3798.788) (-3800.443) * (-3803.630) (-3812.793) (-3799.286) [-3791.633] -- 0:04:15 670000 -- (-3795.550) (-3811.980) (-3809.007) [-3806.317] * (-3793.326) (-3807.851) (-3796.513) [-3801.657] -- 0:04:15 Average standard deviation of split frequencies: 0.004276 670500 -- (-3807.462) [-3801.361] (-3802.561) (-3798.163) * (-3792.131) (-3804.050) (-3804.605) [-3792.550] -- 0:04:14 671000 -- (-3813.992) (-3805.093) [-3798.989] (-3804.324) * (-3792.552) [-3798.361] (-3807.664) (-3798.250) -- 0:04:14 671500 -- [-3808.302] (-3798.229) (-3811.104) (-3799.089) * [-3797.735] (-3794.707) (-3803.895) (-3800.467) -- 0:04:13 672000 -- [-3790.294] (-3803.802) (-3802.343) (-3798.861) * [-3795.406] (-3800.171) (-3798.649) (-3803.086) -- 0:04:13 672500 -- [-3792.085] (-3800.096) (-3794.110) (-3814.512) * (-3797.489) (-3801.751) [-3800.355] (-3801.462) -- 0:04:13 673000 -- (-3793.620) (-3798.107) [-3795.663] (-3805.188) * (-3803.924) (-3800.370) [-3796.160] (-3804.544) -- 0:04:12 673500 -- (-3797.010) (-3802.355) [-3802.867] (-3802.914) * [-3797.292] (-3797.130) (-3803.325) (-3802.590) -- 0:04:12 674000 -- [-3797.576] (-3799.983) (-3792.445) (-3807.299) * (-3797.540) [-3799.387] (-3800.592) (-3802.196) -- 0:04:11 674500 -- [-3788.303] (-3797.330) (-3798.888) (-3799.896) * [-3800.917] (-3798.393) (-3802.361) (-3808.937) -- 0:04:11 675000 -- (-3801.262) (-3806.185) [-3795.868] (-3803.980) * (-3795.305) (-3799.254) (-3796.122) [-3794.868] -- 0:04:11 Average standard deviation of split frequencies: 0.004068 675500 -- (-3803.396) (-3804.863) (-3798.081) [-3799.566] * (-3788.897) [-3797.804] (-3803.104) (-3801.169) -- 0:04:10 676000 -- (-3811.717) (-3805.073) (-3813.159) [-3796.364] * (-3801.453) (-3796.698) [-3793.048] (-3800.405) -- 0:04:10 676500 -- [-3803.208] (-3795.712) (-3797.737) (-3795.912) * [-3793.314] (-3801.513) (-3799.752) (-3807.532) -- 0:04:10 677000 -- (-3799.416) (-3796.453) [-3793.468] (-3796.504) * (-3797.945) (-3789.140) (-3805.835) [-3798.968] -- 0:04:09 677500 -- [-3800.414] (-3811.128) (-3797.712) (-3794.978) * [-3793.359] (-3795.975) (-3803.784) (-3803.336) -- 0:04:09 678000 -- (-3797.451) (-3814.658) (-3791.568) [-3799.511] * [-3792.540] (-3796.314) (-3796.197) (-3812.694) -- 0:04:08 678500 -- (-3799.505) (-3808.643) [-3794.871] (-3794.694) * [-3796.764] (-3799.414) (-3802.751) (-3807.731) -- 0:04:08 679000 -- [-3797.698] (-3803.586) (-3798.114) (-3797.258) * [-3800.350] (-3810.349) (-3797.491) (-3810.547) -- 0:04:08 679500 -- (-3804.486) (-3801.195) (-3798.617) [-3796.651] * (-3802.284) (-3807.386) (-3790.981) [-3799.098] -- 0:04:07 680000 -- (-3808.139) [-3800.901] (-3798.743) (-3795.624) * (-3797.659) (-3800.642) [-3795.547] (-3808.244) -- 0:04:07 Average standard deviation of split frequencies: 0.003925 680500 -- (-3800.285) (-3792.950) (-3803.586) [-3793.986] * (-3795.594) [-3800.924] (-3793.611) (-3802.936) -- 0:04:06 681000 -- [-3800.991] (-3798.131) (-3803.455) (-3799.141) * (-3789.788) (-3799.868) (-3798.917) [-3803.271] -- 0:04:06 681500 -- (-3810.026) [-3798.109] (-3794.083) (-3808.768) * (-3797.729) (-3805.314) [-3794.743] (-3796.179) -- 0:04:06 682000 -- (-3802.370) [-3791.140] (-3795.999) (-3798.540) * (-3800.133) (-3808.266) (-3796.311) [-3794.355] -- 0:04:05 682500 -- (-3800.646) (-3808.148) (-3796.531) [-3797.583] * (-3805.211) [-3799.253] (-3801.300) (-3798.324) -- 0:04:05 683000 -- [-3789.486] (-3818.100) (-3804.938) (-3804.367) * (-3802.398) [-3797.154] (-3798.713) (-3807.537) -- 0:04:05 683500 -- (-3800.787) (-3808.458) [-3795.043] (-3796.007) * (-3794.036) [-3792.848] (-3806.512) (-3797.285) -- 0:04:04 684000 -- (-3807.808) [-3787.797] (-3802.756) (-3792.904) * [-3803.508] (-3802.918) (-3798.715) (-3796.045) -- 0:04:04 684500 -- (-3800.502) [-3793.861] (-3804.764) (-3797.704) * (-3803.926) (-3796.418) [-3792.913] (-3794.972) -- 0:04:03 685000 -- [-3798.556] (-3791.960) (-3799.768) (-3800.290) * (-3812.640) (-3797.573) [-3798.236] (-3794.038) -- 0:04:03 Average standard deviation of split frequencies: 0.003837 685500 -- (-3801.961) [-3800.267] (-3798.089) (-3803.316) * (-3801.605) (-3806.120) [-3791.531] (-3794.752) -- 0:04:03 686000 -- (-3799.055) (-3809.235) [-3809.851] (-3805.845) * (-3797.576) (-3794.209) (-3801.648) [-3789.506] -- 0:04:02 686500 -- (-3809.821) (-3796.834) [-3792.631] (-3808.570) * (-3806.701) (-3801.927) [-3797.410] (-3796.387) -- 0:04:02 687000 -- (-3810.571) (-3799.976) (-3801.698) [-3790.626] * (-3811.221) (-3797.584) (-3794.569) [-3804.544] -- 0:04:01 687500 -- (-3802.891) [-3803.567] (-3803.922) (-3806.413) * (-3807.746) (-3795.825) (-3805.731) [-3794.474] -- 0:04:01 688000 -- (-3801.948) (-3809.539) [-3792.688] (-3798.325) * (-3815.518) (-3802.051) [-3800.738] (-3790.788) -- 0:04:01 688500 -- (-3793.037) (-3800.702) (-3807.692) [-3798.098] * (-3807.470) (-3796.152) (-3797.176) [-3800.695] -- 0:04:00 689000 -- (-3793.141) [-3797.066] (-3802.000) (-3802.656) * (-3803.638) [-3790.633] (-3797.408) (-3796.101) -- 0:04:00 689500 -- (-3797.001) (-3796.640) [-3806.330] (-3801.613) * [-3796.014] (-3792.544) (-3801.222) (-3801.080) -- 0:04:00 690000 -- (-3796.415) (-3801.171) [-3802.648] (-3795.647) * [-3793.299] (-3804.831) (-3812.585) (-3803.143) -- 0:03:59 Average standard deviation of split frequencies: 0.004095 690500 -- (-3797.077) (-3799.902) (-3803.508) [-3793.934] * [-3795.002] (-3799.538) (-3810.960) (-3808.406) -- 0:03:59 691000 -- (-3799.052) [-3792.519] (-3804.253) (-3807.722) * (-3805.879) (-3806.939) (-3803.786) [-3794.256] -- 0:03:58 691500 -- (-3803.729) [-3802.063] (-3801.523) (-3803.471) * (-3803.595) (-3809.340) (-3800.792) [-3794.596] -- 0:03:58 692000 -- (-3796.927) (-3800.842) [-3791.974] (-3794.097) * (-3797.500) (-3801.569) [-3798.585] (-3799.749) -- 0:03:58 692500 -- (-3800.194) [-3804.768] (-3795.172) (-3801.562) * (-3793.574) (-3803.734) (-3803.270) [-3793.241] -- 0:03:57 693000 -- [-3802.496] (-3796.681) (-3802.470) (-3800.011) * (-3798.904) (-3802.442) [-3792.713] (-3804.267) -- 0:03:57 693500 -- (-3806.644) [-3793.710] (-3805.841) (-3800.783) * (-3797.873) [-3797.421] (-3804.427) (-3799.822) -- 0:03:56 694000 -- (-3796.603) [-3794.651] (-3806.277) (-3797.272) * [-3790.881] (-3796.721) (-3811.810) (-3792.859) -- 0:03:56 694500 -- [-3796.224] (-3803.440) (-3799.958) (-3795.910) * (-3801.481) [-3804.764] (-3809.217) (-3799.448) -- 0:03:56 695000 -- [-3796.472] (-3809.312) (-3793.295) (-3798.304) * (-3802.846) [-3801.643] (-3804.712) (-3798.169) -- 0:03:55 Average standard deviation of split frequencies: 0.003161 695500 -- (-3797.500) (-3801.664) [-3790.546] (-3796.289) * (-3810.315) (-3793.257) [-3796.817] (-3796.531) -- 0:03:55 696000 -- [-3800.668] (-3803.282) (-3793.977) (-3805.156) * (-3811.462) [-3804.390] (-3802.553) (-3803.409) -- 0:03:54 696500 -- [-3800.280] (-3809.879) (-3796.120) (-3804.223) * (-3803.342) (-3812.684) [-3805.086] (-3802.197) -- 0:03:54 697000 -- (-3803.299) (-3807.766) (-3806.584) [-3798.117] * (-3796.767) (-3806.144) (-3803.082) [-3800.033] -- 0:03:54 697500 -- (-3795.613) (-3800.041) (-3815.303) [-3793.396] * (-3796.707) (-3800.473) (-3800.522) [-3793.457] -- 0:03:53 698000 -- [-3794.702] (-3808.147) (-3799.625) (-3795.297) * (-3795.501) [-3792.687] (-3800.505) (-3807.277) -- 0:03:53 698500 -- (-3803.288) (-3802.170) [-3789.707] (-3793.126) * (-3800.173) (-3793.515) (-3795.130) [-3796.764] -- 0:03:53 699000 -- (-3802.124) (-3797.826) [-3793.404] (-3809.406) * (-3803.240) (-3799.296) [-3791.740] (-3797.322) -- 0:03:52 699500 -- (-3803.507) [-3803.842] (-3812.921) (-3793.676) * [-3800.785] (-3792.068) (-3792.037) (-3798.245) -- 0:03:52 700000 -- [-3805.868] (-3793.434) (-3806.491) (-3794.642) * (-3796.192) [-3795.711] (-3799.739) (-3800.492) -- 0:03:51 Average standard deviation of split frequencies: 0.003196 700500 -- [-3792.407] (-3796.121) (-3805.008) (-3793.384) * [-3801.909] (-3797.762) (-3788.980) (-3796.479) -- 0:03:51 701000 -- (-3792.997) (-3792.070) [-3802.362] (-3798.091) * (-3809.626) [-3799.696] (-3799.803) (-3796.456) -- 0:03:51 701500 -- (-3799.432) (-3812.086) [-3803.484] (-3803.603) * [-3803.250] (-3805.033) (-3804.526) (-3792.300) -- 0:03:50 702000 -- (-3795.787) [-3803.005] (-3803.236) (-3806.456) * (-3796.377) (-3815.263) [-3800.026] (-3800.157) -- 0:03:50 702500 -- (-3800.523) (-3808.218) (-3802.520) [-3801.148] * (-3794.498) [-3800.904] (-3802.467) (-3800.541) -- 0:03:49 703000 -- (-3790.836) (-3806.086) (-3798.396) [-3794.453] * [-3807.935] (-3805.185) (-3801.950) (-3796.953) -- 0:03:49 703500 -- (-3806.662) (-3806.082) [-3796.079] (-3803.211) * (-3796.019) (-3797.482) [-3798.731] (-3795.012) -- 0:03:49 704000 -- (-3811.342) (-3797.212) [-3796.135] (-3820.059) * (-3800.376) (-3800.381) (-3803.744) [-3794.466] -- 0:03:48 704500 -- [-3802.956] (-3797.298) (-3801.515) (-3802.984) * [-3794.438] (-3808.185) (-3793.807) (-3793.048) -- 0:03:48 705000 -- (-3804.128) (-3798.984) (-3795.157) [-3799.665] * [-3800.181] (-3802.333) (-3789.450) (-3803.180) -- 0:03:48 Average standard deviation of split frequencies: 0.003005 705500 -- (-3806.059) (-3796.486) (-3809.137) [-3790.149] * (-3799.874) (-3795.170) [-3795.676] (-3805.063) -- 0:03:47 706000 -- (-3805.215) (-3807.345) (-3802.213) [-3789.328] * (-3810.241) (-3795.918) [-3792.588] (-3799.143) -- 0:03:47 706500 -- [-3795.004] (-3814.061) (-3806.516) (-3796.380) * [-3799.426] (-3809.001) (-3791.153) (-3801.405) -- 0:03:46 707000 -- (-3797.615) (-3801.265) (-3799.656) [-3798.829] * (-3801.627) [-3798.261] (-3802.754) (-3802.252) -- 0:03:46 707500 -- (-3798.401) [-3798.998] (-3796.276) (-3811.847) * (-3805.133) [-3791.675] (-3803.437) (-3805.450) -- 0:03:46 708000 -- [-3794.867] (-3812.161) (-3798.604) (-3799.925) * (-3804.075) (-3799.433) (-3805.698) [-3797.998] -- 0:03:45 708500 -- (-3800.499) (-3801.500) (-3794.303) [-3799.380] * (-3797.727) [-3795.300] (-3804.733) (-3804.854) -- 0:03:45 709000 -- (-3794.405) (-3798.366) (-3804.154) [-3798.275] * (-3793.403) [-3793.257] (-3805.297) (-3799.876) -- 0:03:44 709500 -- (-3803.583) (-3787.888) (-3803.415) [-3798.182] * (-3790.126) (-3797.837) [-3793.967] (-3812.518) -- 0:03:44 710000 -- [-3807.572] (-3796.486) (-3797.820) (-3803.888) * (-3793.497) (-3802.484) [-3804.918] (-3799.938) -- 0:03:44 Average standard deviation of split frequencies: 0.002543 710500 -- (-3811.466) [-3794.862] (-3809.791) (-3805.384) * [-3789.284] (-3798.109) (-3795.614) (-3802.245) -- 0:03:43 711000 -- (-3796.926) [-3796.597] (-3802.059) (-3797.267) * (-3802.969) (-3791.702) [-3800.901] (-3805.008) -- 0:03:43 711500 -- (-3799.566) [-3797.560] (-3799.170) (-3797.982) * (-3796.260) [-3793.257] (-3799.918) (-3801.293) -- 0:03:43 712000 -- [-3792.830] (-3807.764) (-3795.979) (-3799.632) * (-3790.893) (-3795.009) (-3796.371) [-3798.675] -- 0:03:42 712500 -- (-3796.269) (-3800.265) [-3791.027] (-3808.228) * (-3795.771) (-3814.357) (-3797.116) [-3798.961] -- 0:03:42 713000 -- [-3791.635] (-3808.441) (-3794.783) (-3809.716) * (-3804.111) (-3795.805) [-3795.531] (-3806.747) -- 0:03:41 713500 -- (-3794.536) [-3798.460] (-3799.283) (-3805.250) * [-3798.152] (-3793.808) (-3793.791) (-3790.544) -- 0:03:41 714000 -- (-3801.211) (-3790.384) (-3795.106) [-3800.868] * (-3807.094) (-3795.691) [-3793.043] (-3801.509) -- 0:03:41 714500 -- [-3796.075] (-3795.844) (-3798.471) (-3794.080) * (-3800.894) [-3792.265] (-3797.679) (-3803.652) -- 0:03:40 715000 -- [-3803.607] (-3793.333) (-3802.981) (-3796.538) * [-3798.988] (-3799.268) (-3791.100) (-3800.251) -- 0:03:40 Average standard deviation of split frequencies: 0.002359 715500 -- (-3794.555) (-3801.729) [-3797.865] (-3804.415) * (-3797.765) [-3795.872] (-3801.900) (-3792.861) -- 0:03:39 716000 -- [-3792.400] (-3793.241) (-3805.280) (-3798.949) * (-3799.474) [-3798.937] (-3802.224) (-3798.613) -- 0:03:39 716500 -- (-3791.712) [-3790.262] (-3802.431) (-3805.220) * (-3794.690) [-3799.147] (-3801.884) (-3795.146) -- 0:03:39 717000 -- (-3798.912) [-3796.507] (-3804.937) (-3794.803) * (-3794.274) [-3798.747] (-3803.128) (-3799.853) -- 0:03:38 717500 -- (-3798.538) (-3799.962) (-3802.398) [-3790.403] * (-3795.339) (-3800.358) (-3795.056) [-3796.354] -- 0:03:38 718000 -- (-3809.627) (-3800.854) (-3796.499) [-3790.799] * (-3795.398) (-3804.160) (-3807.454) [-3796.424] -- 0:03:37 718500 -- (-3800.148) [-3796.669] (-3811.314) (-3796.638) * (-3796.343) (-3807.573) [-3794.454] (-3800.635) -- 0:03:37 719000 -- (-3790.457) [-3791.173] (-3799.397) (-3796.119) * [-3804.241] (-3804.614) (-3797.332) (-3794.226) -- 0:03:37 719500 -- [-3798.505] (-3797.497) (-3799.061) (-3800.847) * (-3796.656) [-3796.956] (-3802.992) (-3797.039) -- 0:03:36 720000 -- (-3803.264) (-3809.191) (-3796.005) [-3794.676] * (-3803.335) [-3791.141] (-3800.689) (-3802.245) -- 0:03:36 Average standard deviation of split frequencies: 0.003053 720500 -- (-3806.643) (-3808.309) [-3795.935] (-3793.457) * (-3804.257) [-3796.538] (-3796.726) (-3799.760) -- 0:03:36 721000 -- [-3796.008] (-3810.535) (-3799.063) (-3796.866) * (-3789.886) [-3793.671] (-3800.885) (-3801.894) -- 0:03:35 721500 -- (-3809.359) (-3819.912) [-3800.933] (-3805.634) * [-3797.161] (-3805.444) (-3804.105) (-3795.918) -- 0:03:35 722000 -- [-3799.986] (-3802.804) (-3800.328) (-3799.710) * [-3801.071] (-3802.795) (-3807.827) (-3794.669) -- 0:03:34 722500 -- [-3804.161] (-3797.125) (-3810.362) (-3797.045) * (-3811.855) (-3796.283) (-3807.002) [-3793.412] -- 0:03:34 723000 -- (-3798.617) (-3801.450) [-3795.604] (-3796.176) * (-3805.825) [-3791.140] (-3800.205) (-3797.294) -- 0:03:34 723500 -- (-3790.231) [-3794.785] (-3805.045) (-3795.734) * (-3800.483) (-3791.907) [-3797.049] (-3811.930) -- 0:03:33 724000 -- (-3793.938) (-3813.327) (-3799.277) [-3794.757] * (-3801.738) [-3793.889] (-3810.980) (-3802.831) -- 0:03:33 724500 -- [-3796.504] (-3797.738) (-3795.329) (-3803.725) * (-3796.516) (-3797.090) (-3807.274) [-3796.880] -- 0:03:32 725000 -- [-3796.857] (-3801.158) (-3806.153) (-3806.131) * (-3799.158) (-3798.864) (-3794.398) [-3797.536] -- 0:03:32 Average standard deviation of split frequencies: 0.003679 725500 -- [-3796.081] (-3808.190) (-3809.435) (-3797.511) * (-3797.118) (-3801.891) (-3798.546) [-3796.680] -- 0:03:32 726000 -- (-3798.471) (-3802.721) (-3793.365) [-3800.949] * (-3801.303) [-3795.103] (-3804.726) (-3807.358) -- 0:03:31 726500 -- (-3800.490) (-3798.127) (-3794.211) [-3795.675] * (-3805.329) (-3803.267) (-3793.234) [-3802.309] -- 0:03:31 727000 -- (-3809.769) [-3795.937] (-3801.991) (-3797.783) * (-3798.654) [-3798.247] (-3801.867) (-3801.255) -- 0:03:31 727500 -- (-3794.580) (-3796.565) [-3807.722] (-3801.096) * (-3796.860) (-3806.705) [-3800.737] (-3800.052) -- 0:03:30 728000 -- (-3791.915) [-3793.934] (-3799.138) (-3799.280) * (-3797.249) (-3800.503) (-3793.087) [-3794.941] -- 0:03:30 728500 -- (-3799.496) (-3800.984) (-3802.835) [-3796.973] * (-3795.857) (-3798.345) [-3793.033] (-3797.317) -- 0:03:29 729000 -- (-3796.751) (-3795.505) [-3792.981] (-3805.966) * (-3803.884) (-3803.148) [-3796.905] (-3806.245) -- 0:03:29 729500 -- [-3798.924] (-3802.241) (-3798.736) (-3808.290) * (-3804.573) (-3801.023) (-3808.825) [-3799.742] -- 0:03:29 730000 -- (-3798.694) [-3793.572] (-3803.801) (-3797.444) * [-3793.637] (-3797.068) (-3794.942) (-3803.721) -- 0:03:28 Average standard deviation of split frequencies: 0.003441 730500 -- (-3794.574) (-3796.788) (-3799.505) [-3794.239] * (-3812.283) (-3796.583) [-3800.074] (-3794.413) -- 0:03:28 731000 -- (-3796.097) [-3801.427] (-3808.095) (-3807.426) * (-3797.957) (-3804.049) [-3796.279] (-3802.940) -- 0:03:27 731500 -- [-3797.966] (-3799.486) (-3796.769) (-3802.813) * (-3794.025) (-3798.630) (-3804.924) [-3792.230] -- 0:03:27 732000 -- (-3803.317) [-3803.997] (-3794.314) (-3800.180) * [-3797.541] (-3798.360) (-3808.394) (-3802.646) -- 0:03:27 732500 -- (-3802.045) (-3794.973) (-3794.107) [-3799.201] * [-3794.506] (-3804.301) (-3796.946) (-3801.002) -- 0:03:26 733000 -- (-3800.000) (-3797.668) [-3793.094] (-3805.679) * [-3789.319] (-3792.114) (-3802.528) (-3793.606) -- 0:03:26 733500 -- [-3804.558] (-3806.644) (-3794.267) (-3796.482) * (-3796.167) (-3809.253) [-3804.841] (-3807.701) -- 0:03:26 734000 -- (-3802.221) (-3816.194) (-3802.829) [-3800.615] * (-3796.905) [-3798.916] (-3804.223) (-3801.901) -- 0:03:25 734500 -- (-3794.795) [-3795.115] (-3802.831) (-3794.784) * [-3803.578] (-3800.420) (-3800.537) (-3803.456) -- 0:03:25 735000 -- (-3796.684) (-3806.795) (-3807.889) [-3796.281] * (-3793.878) (-3801.670) (-3796.654) [-3794.588] -- 0:03:24 Average standard deviation of split frequencies: 0.003202 735500 -- [-3794.025] (-3795.167) (-3798.424) (-3795.620) * (-3799.563) (-3810.194) (-3796.196) [-3797.309] -- 0:03:24 736000 -- (-3798.237) (-3802.132) [-3799.459] (-3797.534) * (-3799.348) (-3810.491) (-3794.951) [-3798.110] -- 0:03:24 736500 -- [-3794.765] (-3796.762) (-3810.366) (-3801.913) * (-3804.588) (-3796.759) (-3802.252) [-3795.252] -- 0:03:23 737000 -- [-3791.166] (-3800.441) (-3801.653) (-3798.443) * (-3798.121) (-3795.131) (-3793.824) [-3801.978] -- 0:03:23 737500 -- [-3804.224] (-3806.283) (-3793.079) (-3801.551) * (-3802.973) (-3800.661) (-3798.992) [-3802.517] -- 0:03:22 738000 -- (-3806.280) (-3802.265) [-3796.614] (-3799.764) * [-3799.037] (-3800.363) (-3800.325) (-3800.659) -- 0:03:22 738500 -- (-3798.737) (-3798.714) (-3810.011) [-3796.471] * [-3799.019] (-3798.446) (-3802.452) (-3795.477) -- 0:03:22 739000 -- (-3799.206) [-3797.651] (-3803.686) (-3794.053) * (-3792.297) (-3811.885) (-3799.454) [-3795.302] -- 0:03:21 739500 -- (-3803.722) [-3796.944] (-3804.535) (-3791.824) * (-3793.684) [-3798.669] (-3799.552) (-3800.808) -- 0:03:21 740000 -- [-3792.911] (-3792.773) (-3803.009) (-3804.334) * [-3797.158] (-3802.212) (-3798.969) (-3797.096) -- 0:03:20 Average standard deviation of split frequencies: 0.002864 740500 -- (-3802.401) (-3795.463) [-3795.099] (-3797.034) * (-3797.709) (-3802.992) [-3792.803] (-3795.439) -- 0:03:20 741000 -- (-3810.568) [-3795.837] (-3808.683) (-3797.170) * (-3799.203) (-3805.161) [-3794.322] (-3796.066) -- 0:03:20 741500 -- (-3802.338) [-3795.945] (-3800.348) (-3793.103) * (-3803.824) (-3799.930) (-3796.621) [-3793.592] -- 0:03:19 742000 -- (-3797.965) (-3793.850) (-3801.296) [-3794.162] * (-3790.545) (-3798.988) (-3798.213) [-3791.202] -- 0:03:19 742500 -- (-3806.014) (-3794.807) (-3796.035) [-3801.607] * [-3799.161] (-3800.103) (-3797.140) (-3791.954) -- 0:03:19 743000 -- (-3803.964) [-3795.184] (-3800.013) (-3798.312) * (-3799.072) (-3798.560) (-3795.108) [-3790.976] -- 0:03:18 743500 -- (-3802.843) [-3790.109] (-3799.708) (-3792.875) * (-3793.334) (-3799.297) [-3790.780] (-3797.993) -- 0:03:18 744000 -- (-3792.191) [-3789.634] (-3801.049) (-3809.442) * (-3793.620) (-3815.804) (-3790.085) [-3795.616] -- 0:03:17 744500 -- [-3793.676] (-3798.345) (-3804.715) (-3806.881) * (-3793.068) [-3795.725] (-3796.793) (-3803.359) -- 0:03:17 745000 -- (-3796.283) (-3795.672) (-3795.038) [-3801.596] * [-3788.241] (-3802.261) (-3797.327) (-3793.301) -- 0:03:17 Average standard deviation of split frequencies: 0.003107 745500 -- [-3797.322] (-3792.701) (-3801.397) (-3813.541) * (-3797.137) [-3796.928] (-3795.127) (-3796.644) -- 0:03:16 746000 -- (-3815.838) (-3791.826) (-3800.807) [-3810.015] * (-3798.892) (-3800.675) [-3799.033] (-3797.260) -- 0:03:16 746500 -- (-3791.680) (-3804.855) (-3796.239) [-3792.467] * (-3799.604) [-3794.351] (-3790.479) (-3792.849) -- 0:03:15 747000 -- (-3797.390) [-3798.424] (-3800.326) (-3793.540) * [-3796.557] (-3790.105) (-3795.633) (-3790.726) -- 0:03:15 747500 -- (-3801.798) (-3810.580) (-3808.253) [-3798.415] * (-3797.149) (-3795.699) [-3799.524] (-3798.928) -- 0:03:15 748000 -- (-3794.901) (-3797.654) [-3794.776] (-3805.213) * (-3792.466) (-3802.751) [-3797.884] (-3796.859) -- 0:03:14 748500 -- [-3794.995] (-3816.236) (-3807.557) (-3795.309) * [-3798.324] (-3810.688) (-3795.827) (-3799.246) -- 0:03:14 749000 -- (-3793.387) [-3796.414] (-3811.834) (-3801.419) * (-3798.642) [-3796.266] (-3791.457) (-3797.621) -- 0:03:14 749500 -- (-3792.877) (-3804.655) (-3815.782) [-3791.997] * (-3798.430) [-3794.291] (-3799.353) (-3802.798) -- 0:03:13 750000 -- [-3794.023] (-3796.319) (-3803.308) (-3803.802) * (-3801.105) [-3802.754] (-3803.964) (-3804.367) -- 0:03:13 Average standard deviation of split frequencies: 0.003192 750500 -- [-3792.646] (-3795.407) (-3794.731) (-3811.503) * [-3796.206] (-3797.360) (-3803.455) (-3801.995) -- 0:03:12 751000 -- [-3798.488] (-3803.148) (-3797.031) (-3800.548) * [-3795.775] (-3797.570) (-3801.069) (-3801.441) -- 0:03:12 751500 -- (-3806.458) (-3793.067) (-3801.535) [-3792.563] * (-3803.202) [-3794.547] (-3799.880) (-3795.647) -- 0:03:12 752000 -- [-3795.084] (-3795.315) (-3798.924) (-3798.515) * (-3797.338) [-3793.605] (-3796.726) (-3797.929) -- 0:03:11 752500 -- (-3796.426) (-3812.129) [-3798.802] (-3803.217) * (-3798.057) (-3796.193) (-3797.299) [-3799.065] -- 0:03:11 753000 -- [-3792.468] (-3793.494) (-3795.678) (-3796.776) * (-3801.078) (-3799.483) [-3792.907] (-3803.543) -- 0:03:10 753500 -- (-3806.144) (-3790.806) [-3791.546] (-3807.489) * (-3790.404) [-3796.305] (-3801.401) (-3794.620) -- 0:03:10 754000 -- [-3793.454] (-3806.958) (-3802.786) (-3797.341) * (-3795.818) (-3807.471) [-3794.709] (-3795.321) -- 0:03:10 754500 -- (-3799.440) (-3804.720) [-3798.433] (-3802.187) * (-3791.284) (-3804.809) (-3792.747) [-3804.645] -- 0:03:09 755000 -- [-3800.977] (-3796.919) (-3797.077) (-3808.165) * [-3791.873] (-3800.169) (-3794.815) (-3807.312) -- 0:03:09 Average standard deviation of split frequencies: 0.003689 755500 -- (-3797.117) [-3792.885] (-3791.846) (-3797.350) * (-3792.872) (-3804.411) [-3791.708] (-3804.153) -- 0:03:08 756000 -- (-3788.787) (-3799.264) (-3793.848) [-3796.184] * (-3798.153) [-3797.336] (-3802.840) (-3807.840) -- 0:03:08 756500 -- (-3804.038) [-3792.939] (-3793.714) (-3801.649) * (-3792.359) [-3794.638] (-3808.340) (-3802.262) -- 0:03:08 757000 -- (-3801.209) (-3803.128) (-3794.277) [-3798.223] * (-3793.115) (-3800.293) [-3790.783] (-3808.529) -- 0:03:07 757500 -- (-3800.526) (-3803.928) (-3802.158) [-3793.605] * (-3805.100) (-3800.406) [-3795.421] (-3802.640) -- 0:03:07 758000 -- (-3800.471) (-3801.115) (-3795.232) [-3789.186] * [-3798.786] (-3800.030) (-3798.447) (-3805.780) -- 0:03:07 758500 -- (-3804.210) (-3798.892) (-3801.084) [-3794.697] * (-3798.557) [-3790.412] (-3799.029) (-3808.170) -- 0:03:06 759000 -- (-3811.349) (-3799.476) [-3792.861] (-3793.344) * (-3799.055) (-3811.520) (-3790.979) [-3795.556] -- 0:03:06 759500 -- (-3802.980) [-3804.237] (-3793.714) (-3796.813) * (-3805.264) [-3800.486] (-3794.643) (-3795.730) -- 0:03:05 760000 -- (-3804.469) (-3799.668) [-3790.818] (-3794.647) * [-3796.505] (-3821.092) (-3797.148) (-3795.631) -- 0:03:05 Average standard deviation of split frequencies: 0.003460 760500 -- (-3806.339) (-3794.954) (-3802.236) [-3795.320] * (-3812.450) (-3803.151) [-3801.372] (-3804.644) -- 0:03:05 761000 -- (-3798.440) (-3800.394) [-3792.180] (-3796.543) * (-3800.138) (-3794.575) [-3797.733] (-3793.318) -- 0:03:04 761500 -- (-3795.590) (-3796.828) [-3799.830] (-3802.062) * (-3799.008) (-3795.276) (-3790.065) [-3791.857] -- 0:03:04 762000 -- (-3799.284) (-3802.148) (-3801.270) [-3810.864] * (-3799.390) [-3790.263] (-3807.009) (-3795.166) -- 0:03:03 762500 -- (-3796.865) (-3797.134) [-3794.538] (-3803.164) * [-3805.424] (-3799.568) (-3798.977) (-3810.726) -- 0:03:03 763000 -- (-3812.217) (-3794.599) (-3798.673) [-3794.271] * [-3796.961] (-3803.310) (-3814.118) (-3799.351) -- 0:03:03 763500 -- (-3810.820) (-3806.945) [-3791.272] (-3798.354) * (-3798.292) [-3793.576] (-3800.776) (-3805.475) -- 0:03:02 764000 -- [-3797.279] (-3803.228) (-3810.598) (-3802.186) * (-3791.058) (-3798.172) (-3796.061) [-3790.634] -- 0:03:02 764500 -- [-3795.349] (-3797.690) (-3800.974) (-3802.144) * (-3800.258) [-3797.843] (-3795.313) (-3790.804) -- 0:03:02 765000 -- (-3800.150) (-3805.378) (-3793.522) [-3798.436] * [-3793.040] (-3798.325) (-3789.584) (-3797.245) -- 0:03:01 Average standard deviation of split frequencies: 0.003641 765500 -- [-3798.107] (-3806.598) (-3796.719) (-3799.511) * [-3801.195] (-3801.746) (-3797.217) (-3791.173) -- 0:03:01 766000 -- [-3796.359] (-3811.823) (-3803.846) (-3792.497) * [-3796.526] (-3796.423) (-3796.889) (-3795.908) -- 0:03:00 766500 -- (-3799.417) (-3808.614) (-3806.233) [-3798.491] * (-3800.198) (-3789.223) [-3793.998] (-3806.919) -- 0:03:00 767000 -- (-3801.285) [-3792.962] (-3802.285) (-3792.983) * (-3797.917) (-3797.503) [-3801.107] (-3803.064) -- 0:03:00 767500 -- [-3798.469] (-3800.594) (-3799.272) (-3803.418) * (-3798.250) (-3801.068) (-3823.059) [-3795.805] -- 0:02:59 768000 -- [-3797.265] (-3797.797) (-3802.455) (-3790.766) * (-3803.849) [-3801.662] (-3797.202) (-3793.752) -- 0:02:59 768500 -- [-3792.882] (-3797.438) (-3802.469) (-3801.372) * [-3794.640] (-3798.547) (-3796.301) (-3797.302) -- 0:02:58 769000 -- [-3795.585] (-3797.266) (-3798.936) (-3801.791) * (-3797.666) (-3796.945) (-3798.431) [-3796.918] -- 0:02:58 769500 -- (-3808.892) (-3797.243) (-3803.643) [-3795.753] * (-3798.617) (-3801.611) (-3807.433) [-3791.222] -- 0:02:58 770000 -- (-3801.741) (-3799.471) [-3799.024] (-3791.058) * [-3792.392] (-3795.634) (-3799.461) (-3792.924) -- 0:02:57 Average standard deviation of split frequencies: 0.003517 770500 -- (-3814.927) (-3798.131) [-3793.034] (-3801.732) * [-3791.138] (-3800.028) (-3803.079) (-3796.519) -- 0:02:57 771000 -- [-3809.778] (-3806.508) (-3795.135) (-3795.619) * (-3795.485) (-3799.242) (-3794.689) [-3796.696] -- 0:02:57 771500 -- [-3797.260] (-3802.929) (-3798.891) (-3797.876) * (-3797.607) (-3801.927) [-3799.012] (-3791.376) -- 0:02:56 772000 -- (-3814.216) (-3805.048) (-3805.645) [-3801.811] * (-3797.080) (-3795.367) [-3800.577] (-3798.261) -- 0:02:56 772500 -- (-3807.919) [-3793.463] (-3799.573) (-3797.228) * [-3793.831] (-3800.221) (-3795.948) (-3798.053) -- 0:02:55 773000 -- (-3805.734) (-3800.431) [-3793.041] (-3802.503) * (-3800.570) (-3795.790) (-3797.993) [-3795.965] -- 0:02:55 773500 -- (-3813.647) [-3791.798] (-3791.478) (-3797.783) * (-3804.855) [-3795.121] (-3806.310) (-3802.910) -- 0:02:55 774000 -- (-3802.718) (-3797.428) [-3796.649] (-3810.185) * [-3796.590] (-3801.203) (-3814.066) (-3795.523) -- 0:02:54 774500 -- (-3794.527) [-3795.018] (-3796.073) (-3797.658) * (-3802.788) (-3803.733) (-3817.079) [-3792.861] -- 0:02:54 775000 -- (-3803.651) (-3801.212) (-3806.995) [-3796.594] * (-3810.564) (-3805.676) [-3801.564] (-3800.069) -- 0:02:53 Average standard deviation of split frequencies: 0.003999 775500 -- (-3795.554) [-3797.370] (-3816.553) (-3798.731) * (-3802.850) (-3798.272) (-3807.403) [-3796.682] -- 0:02:53 776000 -- (-3793.577) (-3795.872) (-3799.575) [-3795.467] * (-3796.422) (-3801.318) [-3804.809] (-3812.526) -- 0:02:53 776500 -- (-3797.947) (-3798.845) [-3797.755] (-3805.396) * (-3799.704) [-3795.710] (-3800.294) (-3800.040) -- 0:02:52 777000 -- [-3801.011] (-3796.217) (-3800.918) (-3801.973) * (-3790.527) [-3795.015] (-3808.314) (-3806.214) -- 0:02:52 777500 -- (-3798.952) (-3793.220) (-3806.125) [-3790.278] * [-3790.501] (-3794.233) (-3800.571) (-3803.919) -- 0:02:51 778000 -- (-3799.538) [-3791.978] (-3791.158) (-3803.289) * (-3805.084) (-3797.958) (-3804.144) [-3796.451] -- 0:02:51 778500 -- (-3792.111) (-3805.277) (-3799.265) [-3798.369] * (-3802.624) [-3796.188] (-3806.855) (-3797.549) -- 0:02:51 779000 -- (-3804.244) (-3803.178) (-3805.801) [-3800.757] * (-3803.801) [-3795.928] (-3803.607) (-3804.776) -- 0:02:50 779500 -- (-3797.455) (-3802.850) [-3797.554] (-3801.036) * (-3806.328) (-3802.888) [-3801.694] (-3801.658) -- 0:02:50 780000 -- [-3806.139] (-3812.287) (-3797.612) (-3796.408) * (-3809.470) (-3797.980) (-3796.134) [-3795.168] -- 0:02:50 Average standard deviation of split frequencies: 0.004177 780500 -- (-3796.295) (-3796.394) (-3797.784) [-3798.742] * (-3793.769) [-3796.287] (-3798.252) (-3790.367) -- 0:02:49 781000 -- (-3805.541) (-3800.174) (-3792.222) [-3796.479] * [-3792.106] (-3798.276) (-3796.519) (-3796.413) -- 0:02:49 781500 -- (-3799.221) (-3797.003) (-3799.291) [-3792.892] * (-3800.592) (-3799.366) [-3794.522] (-3797.363) -- 0:02:48 782000 -- (-3805.531) [-3793.100] (-3801.267) (-3809.657) * [-3807.072] (-3797.185) (-3791.310) (-3795.957) -- 0:02:48 782500 -- [-3810.940] (-3805.986) (-3806.742) (-3802.917) * (-3810.394) (-3796.361) [-3796.661] (-3804.780) -- 0:02:48 783000 -- (-3805.192) (-3800.856) (-3795.042) [-3795.478] * (-3805.681) [-3794.073] (-3807.363) (-3801.367) -- 0:02:47 783500 -- (-3800.761) (-3793.513) [-3797.077] (-3790.740) * (-3797.932) (-3801.759) (-3797.579) [-3802.246] -- 0:02:47 784000 -- (-3802.161) (-3797.247) (-3808.085) [-3794.154] * (-3792.220) [-3794.200] (-3793.508) (-3799.048) -- 0:02:46 784500 -- (-3804.946) (-3816.231) [-3797.504] (-3797.344) * (-3803.105) [-3800.775] (-3804.581) (-3803.231) -- 0:02:46 785000 -- [-3796.213] (-3805.458) (-3802.213) (-3794.297) * [-3797.667] (-3800.400) (-3804.226) (-3791.173) -- 0:02:46 Average standard deviation of split frequencies: 0.003449 785500 -- (-3798.627) [-3796.791] (-3801.722) (-3806.848) * [-3794.383] (-3803.062) (-3796.100) (-3792.537) -- 0:02:45 786000 -- [-3798.088] (-3798.101) (-3807.805) (-3808.332) * [-3796.683] (-3803.003) (-3804.088) (-3789.656) -- 0:02:45 786500 -- (-3800.894) [-3804.004] (-3797.844) (-3806.493) * [-3800.856] (-3808.261) (-3800.855) (-3789.969) -- 0:02:45 787000 -- (-3799.806) (-3807.266) (-3792.360) [-3800.612] * [-3791.471] (-3805.441) (-3801.657) (-3805.634) -- 0:02:44 787500 -- [-3798.569] (-3799.923) (-3796.072) (-3797.591) * (-3791.959) [-3795.628] (-3804.799) (-3797.401) -- 0:02:44 788000 -- (-3807.492) (-3800.041) [-3793.957] (-3803.154) * [-3799.009] (-3798.724) (-3805.361) (-3797.171) -- 0:02:43 788500 -- [-3796.776] (-3794.826) (-3801.569) (-3804.309) * [-3804.044] (-3808.987) (-3803.960) (-3796.528) -- 0:02:43 789000 -- [-3798.448] (-3793.962) (-3794.941) (-3796.120) * (-3803.086) [-3802.328] (-3803.184) (-3792.551) -- 0:02:43 789500 -- (-3802.321) (-3802.429) [-3794.667] (-3803.720) * (-3801.258) (-3795.796) [-3794.885] (-3800.975) -- 0:02:42 790000 -- (-3796.504) (-3806.601) (-3798.081) [-3794.024] * (-3795.803) [-3790.055] (-3803.150) (-3802.271) -- 0:02:42 Average standard deviation of split frequencies: 0.003428 790500 -- [-3796.326] (-3806.206) (-3797.493) (-3797.743) * (-3800.894) (-3798.033) [-3797.939] (-3799.465) -- 0:02:41 791000 -- (-3795.376) (-3802.404) [-3794.717] (-3806.934) * (-3814.376) (-3798.886) [-3797.411] (-3799.452) -- 0:02:41 791500 -- (-3802.132) [-3793.574] (-3793.232) (-3804.826) * (-3801.124) [-3792.241] (-3796.780) (-3802.179) -- 0:02:41 792000 -- (-3803.713) (-3798.242) [-3801.572] (-3802.565) * (-3801.582) (-3797.599) [-3801.366] (-3797.664) -- 0:02:40 792500 -- [-3798.608] (-3790.611) (-3800.050) (-3797.245) * (-3801.916) [-3795.109] (-3801.290) (-3796.823) -- 0:02:40 793000 -- (-3800.906) (-3801.613) [-3804.179] (-3810.513) * (-3804.286) (-3798.355) (-3801.808) [-3796.633] -- 0:02:40 793500 -- [-3798.810] (-3809.628) (-3795.108) (-3801.016) * [-3801.702] (-3805.714) (-3796.418) (-3793.615) -- 0:02:39 794000 -- [-3791.305] (-3802.514) (-3796.417) (-3809.744) * (-3803.777) [-3796.506] (-3801.112) (-3792.868) -- 0:02:39 794500 -- [-3796.973] (-3796.295) (-3791.829) (-3808.120) * (-3803.405) (-3806.559) (-3800.014) [-3798.367] -- 0:02:38 795000 -- (-3803.281) (-3794.590) [-3793.401] (-3794.659) * (-3798.739) (-3810.603) (-3806.786) [-3799.558] -- 0:02:38 Average standard deviation of split frequencies: 0.003504 795500 -- (-3797.695) (-3801.686) (-3800.433) [-3800.075] * [-3795.129] (-3806.166) (-3800.304) (-3796.301) -- 0:02:38 796000 -- [-3800.494] (-3797.926) (-3794.056) (-3807.919) * [-3793.128] (-3802.319) (-3809.875) (-3802.464) -- 0:02:37 796500 -- (-3803.670) (-3815.580) (-3793.385) [-3796.512] * [-3801.250] (-3794.393) (-3802.624) (-3797.045) -- 0:02:37 797000 -- (-3792.282) [-3794.517] (-3799.242) (-3804.535) * [-3794.322] (-3791.467) (-3794.972) (-3808.316) -- 0:02:36 797500 -- (-3795.309) [-3795.890] (-3800.014) (-3807.357) * (-3804.115) (-3788.823) (-3797.446) [-3802.994] -- 0:02:36 798000 -- [-3792.337] (-3801.787) (-3803.502) (-3799.430) * (-3802.522) (-3793.203) (-3799.192) [-3797.747] -- 0:02:36 798500 -- [-3798.541] (-3803.212) (-3802.275) (-3806.464) * (-3811.082) [-3797.027] (-3792.594) (-3801.679) -- 0:02:35 799000 -- (-3791.632) [-3794.295] (-3799.220) (-3807.773) * (-3803.157) (-3799.236) [-3796.587] (-3796.511) -- 0:02:35 799500 -- (-3799.379) (-3795.052) (-3802.995) [-3799.728] * (-3803.390) (-3797.160) [-3796.478] (-3808.417) -- 0:02:34 800000 -- [-3789.393] (-3813.068) (-3797.615) (-3808.863) * (-3802.574) (-3795.066) [-3801.003] (-3805.634) -- 0:02:34 Average standard deviation of split frequencies: 0.003434 800500 -- (-3799.391) (-3798.502) [-3798.122] (-3806.290) * (-3795.538) (-3790.327) [-3791.732] (-3812.216) -- 0:02:34 801000 -- (-3794.046) (-3802.173) (-3793.191) [-3798.083] * (-3803.196) (-3800.368) [-3792.532] (-3811.655) -- 0:02:33 801500 -- [-3798.301] (-3801.249) (-3789.653) (-3803.242) * (-3797.480) [-3799.593] (-3794.559) (-3795.261) -- 0:02:33 802000 -- (-3799.788) (-3799.368) (-3797.672) [-3793.340] * (-3795.049) (-3804.612) (-3796.588) [-3795.414] -- 0:02:33 802500 -- (-3792.911) [-3802.449] (-3799.740) (-3790.798) * (-3803.906) (-3798.462) (-3801.758) [-3793.979] -- 0:02:32 803000 -- [-3793.728] (-3797.353) (-3796.914) (-3800.719) * (-3814.295) [-3798.189] (-3799.063) (-3804.016) -- 0:02:32 803500 -- (-3805.206) (-3798.594) (-3800.111) [-3796.744] * (-3796.389) (-3798.849) [-3804.017] (-3799.565) -- 0:02:31 804000 -- (-3800.780) [-3798.314] (-3798.926) (-3802.271) * (-3799.609) (-3807.986) (-3804.198) [-3800.781] -- 0:02:31 804500 -- [-3798.153] (-3789.455) (-3808.600) (-3803.383) * (-3801.288) [-3795.405] (-3797.354) (-3796.704) -- 0:02:31 805000 -- [-3803.744] (-3801.432) (-3799.516) (-3806.882) * (-3796.738) [-3799.370] (-3803.036) (-3801.138) -- 0:02:30 Average standard deviation of split frequencies: 0.003558 805500 -- (-3811.159) [-3793.217] (-3801.336) (-3802.144) * (-3799.649) (-3798.919) [-3797.107] (-3801.157) -- 0:02:30 806000 -- (-3797.809) (-3793.990) (-3804.769) [-3793.920] * (-3798.629) (-3798.715) [-3796.185] (-3804.352) -- 0:02:29 806500 -- [-3798.675] (-3797.959) (-3805.139) (-3799.518) * (-3792.831) (-3807.680) [-3790.957] (-3793.345) -- 0:02:29 807000 -- (-3799.751) (-3800.342) [-3792.547] (-3799.750) * (-3806.715) (-3807.081) (-3793.178) [-3796.708] -- 0:02:28 807500 -- (-3803.986) (-3796.289) (-3807.445) [-3799.193] * (-3802.395) [-3805.192] (-3806.424) (-3805.706) -- 0:02:28 808000 -- (-3798.923) (-3810.799) (-3800.912) [-3796.332] * (-3796.417) [-3798.894] (-3798.617) (-3804.094) -- 0:02:28 808500 -- (-3804.350) (-3802.563) [-3799.573] (-3787.301) * (-3793.289) (-3793.723) [-3792.115] (-3798.052) -- 0:02:28 809000 -- (-3798.973) (-3804.532) (-3797.514) [-3798.760] * [-3796.643] (-3798.106) (-3787.105) (-3797.934) -- 0:02:27 809500 -- (-3806.782) (-3811.906) (-3798.379) [-3792.441] * (-3797.309) (-3805.797) [-3797.956] (-3798.245) -- 0:02:27 810000 -- (-3794.668) [-3799.832] (-3797.765) (-3793.453) * (-3804.194) (-3809.530) (-3798.428) [-3791.389] -- 0:02:26 Average standard deviation of split frequencies: 0.003586 810500 -- (-3796.769) [-3801.286] (-3798.824) (-3794.951) * (-3800.961) [-3797.291] (-3801.218) (-3792.336) -- 0:02:26 811000 -- [-3802.206] (-3807.056) (-3803.181) (-3796.316) * (-3800.370) [-3800.269] (-3800.318) (-3807.049) -- 0:02:26 811500 -- (-3797.083) (-3802.384) (-3799.109) [-3796.159] * (-3798.744) (-3796.181) [-3791.326] (-3813.375) -- 0:02:25 812000 -- [-3795.234] (-3799.291) (-3797.571) (-3798.275) * [-3797.550] (-3801.775) (-3793.467) (-3801.050) -- 0:02:25 812500 -- [-3797.960] (-3801.733) (-3792.723) (-3806.382) * [-3793.383] (-3798.169) (-3801.255) (-3797.951) -- 0:02:24 813000 -- (-3795.575) [-3797.768] (-3801.224) (-3801.222) * (-3803.425) [-3795.219] (-3798.877) (-3798.789) -- 0:02:24 813500 -- (-3790.151) [-3796.802] (-3797.170) (-3801.351) * (-3797.924) (-3801.678) [-3797.283] (-3811.685) -- 0:02:23 814000 -- (-3799.344) (-3801.046) [-3792.579] (-3801.841) * (-3796.323) (-3804.902) (-3799.753) [-3796.904] -- 0:02:23 814500 -- [-3797.029] (-3799.494) (-3800.035) (-3817.007) * (-3792.466) (-3808.512) (-3799.366) [-3796.068] -- 0:02:23 815000 -- [-3796.301] (-3801.616) (-3801.247) (-3793.723) * (-3796.474) [-3795.748] (-3796.397) (-3799.956) -- 0:02:23 Average standard deviation of split frequencies: 0.003611 815500 -- (-3803.225) (-3804.288) [-3791.890] (-3790.579) * (-3805.572) [-3792.991] (-3800.857) (-3795.866) -- 0:02:22 816000 -- (-3796.476) (-3799.313) [-3795.994] (-3796.317) * [-3791.903] (-3805.858) (-3799.196) (-3792.716) -- 0:02:22 816500 -- [-3793.895] (-3794.868) (-3799.224) (-3795.946) * (-3793.139) (-3804.418) [-3790.343] (-3801.317) -- 0:02:21 817000 -- (-3794.180) (-3795.816) [-3793.299] (-3794.144) * [-3793.520] (-3795.594) (-3804.344) (-3797.109) -- 0:02:21 817500 -- [-3795.000] (-3792.855) (-3797.237) (-3800.979) * [-3793.223] (-3796.093) (-3791.462) (-3805.257) -- 0:02:21 818000 -- [-3793.318] (-3795.414) (-3801.775) (-3812.049) * (-3805.144) [-3794.106] (-3806.166) (-3805.610) -- 0:02:20 818500 -- (-3800.458) (-3798.852) [-3793.369] (-3798.240) * (-3801.044) (-3801.000) [-3810.560] (-3798.812) -- 0:02:20 819000 -- (-3795.861) (-3802.157) (-3793.315) [-3805.842] * (-3798.313) (-3797.479) [-3800.952] (-3799.979) -- 0:02:19 819500 -- (-3800.042) (-3797.145) [-3801.336] (-3799.533) * [-3796.147] (-3793.726) (-3803.154) (-3800.491) -- 0:02:19 820000 -- (-3802.529) (-3800.179) [-3796.869] (-3804.884) * [-3794.259] (-3806.600) (-3799.302) (-3803.948) -- 0:02:18 Average standard deviation of split frequencies: 0.003494 820500 -- (-3802.185) (-3797.448) (-3816.123) [-3797.484] * (-3802.604) (-3798.123) [-3790.746] (-3804.020) -- 0:02:18 821000 -- [-3799.756] (-3803.615) (-3799.809) (-3799.151) * (-3797.529) [-3796.822] (-3792.779) (-3793.487) -- 0:02:18 821500 -- (-3801.618) (-3821.018) [-3796.090] (-3798.754) * (-3809.239) (-3794.308) (-3803.926) [-3796.427] -- 0:02:17 822000 -- (-3802.081) (-3803.902) [-3792.521] (-3795.993) * (-3798.329) (-3801.487) [-3804.016] (-3795.407) -- 0:02:17 822500 -- (-3801.798) (-3794.620) [-3791.195] (-3801.302) * (-3797.868) (-3800.512) (-3800.476) [-3796.578] -- 0:02:17 823000 -- [-3802.121] (-3796.621) (-3795.126) (-3800.604) * (-3802.873) (-3795.853) [-3798.451] (-3801.681) -- 0:02:16 823500 -- (-3799.600) (-3795.116) [-3795.105] (-3800.928) * (-3798.598) [-3803.644] (-3798.881) (-3803.565) -- 0:02:16 824000 -- (-3807.685) (-3802.457) [-3792.527] (-3797.762) * (-3813.341) (-3793.269) [-3793.150] (-3804.817) -- 0:02:16 824500 -- (-3799.770) [-3799.001] (-3798.081) (-3800.562) * [-3791.373] (-3798.264) (-3800.514) (-3801.844) -- 0:02:15 825000 -- (-3802.217) (-3806.965) (-3797.729) [-3790.933] * (-3791.771) (-3799.655) (-3804.629) [-3799.906] -- 0:02:15 Average standard deviation of split frequencies: 0.003377 825500 -- [-3796.143] (-3800.032) (-3794.134) (-3793.815) * (-3791.269) (-3805.588) [-3795.809] (-3798.735) -- 0:02:14 826000 -- (-3797.175) (-3809.824) [-3794.873] (-3795.958) * (-3791.845) (-3806.530) (-3794.258) [-3795.658] -- 0:02:14 826500 -- (-3793.521) (-3795.616) (-3805.968) [-3795.663] * (-3805.128) (-3795.803) [-3792.836] (-3798.035) -- 0:02:13 827000 -- [-3797.234] (-3798.336) (-3804.167) (-3804.197) * (-3796.584) (-3807.033) [-3802.261] (-3806.419) -- 0:02:13 827500 -- [-3799.230] (-3798.161) (-3809.048) (-3800.899) * (-3797.341) [-3796.967] (-3802.882) (-3801.387) -- 0:02:13 828000 -- (-3793.463) (-3798.863) [-3798.539] (-3796.858) * (-3799.331) (-3799.046) [-3794.812] (-3793.834) -- 0:02:12 828500 -- (-3795.992) [-3798.872] (-3800.035) (-3806.149) * [-3799.226] (-3807.609) (-3814.427) (-3797.690) -- 0:02:12 829000 -- (-3797.148) [-3794.246] (-3796.602) (-3802.542) * (-3793.335) (-3805.460) [-3800.504] (-3800.793) -- 0:02:12 829500 -- (-3794.459) (-3796.294) (-3805.018) [-3802.775] * [-3799.103] (-3807.004) (-3797.412) (-3805.686) -- 0:02:11 830000 -- (-3802.229) (-3798.452) [-3804.245] (-3804.614) * (-3798.548) [-3797.106] (-3800.403) (-3812.503) -- 0:02:11 Average standard deviation of split frequencies: 0.003121 830500 -- (-3801.828) [-3795.181] (-3804.472) (-3800.463) * (-3797.208) (-3797.715) (-3798.690) [-3799.597] -- 0:02:11 831000 -- (-3801.543) (-3796.961) (-3794.775) [-3800.928] * (-3807.355) [-3800.471] (-3805.280) (-3792.242) -- 0:02:10 831500 -- (-3798.497) [-3796.331] (-3801.186) (-3796.764) * [-3798.264] (-3797.595) (-3796.126) (-3802.807) -- 0:02:10 832000 -- (-3795.790) [-3806.207] (-3796.570) (-3808.680) * (-3792.817) [-3791.860] (-3799.567) (-3814.138) -- 0:02:09 832500 -- (-3798.548) [-3796.648] (-3801.193) (-3805.447) * (-3796.242) [-3797.017] (-3796.577) (-3805.132) -- 0:02:09 833000 -- (-3797.247) [-3795.537] (-3802.250) (-3798.700) * (-3807.894) [-3803.613] (-3798.187) (-3800.516) -- 0:02:09 833500 -- [-3793.886] (-3803.260) (-3794.442) (-3802.278) * (-3799.437) (-3797.472) (-3797.170) [-3800.254] -- 0:02:08 834000 -- (-3802.065) (-3805.777) [-3792.675] (-3793.818) * [-3798.767] (-3801.459) (-3797.343) (-3797.372) -- 0:02:08 834500 -- [-3793.060] (-3801.414) (-3799.922) (-3799.678) * [-3791.138] (-3800.812) (-3791.339) (-3800.283) -- 0:02:07 835000 -- [-3796.460] (-3797.185) (-3807.768) (-3799.813) * (-3798.423) (-3803.209) [-3798.338] (-3798.346) -- 0:02:07 Average standard deviation of split frequencies: 0.003148 835500 -- [-3799.053] (-3809.177) (-3801.608) (-3797.632) * (-3799.576) (-3799.909) (-3798.529) [-3794.358] -- 0:02:06 836000 -- (-3804.418) (-3820.006) (-3797.609) [-3797.857] * [-3799.699] (-3802.212) (-3800.716) (-3800.914) -- 0:02:06 836500 -- (-3804.079) (-3811.051) (-3795.615) [-3796.176] * (-3794.210) [-3794.006] (-3794.559) (-3817.593) -- 0:02:06 837000 -- (-3802.212) (-3804.805) [-3795.323] (-3795.553) * [-3802.091] (-3803.716) (-3804.540) (-3798.165) -- 0:02:05 837500 -- [-3800.691] (-3795.905) (-3801.534) (-3799.371) * (-3803.488) (-3805.030) [-3797.486] (-3807.832) -- 0:02:05 838000 -- (-3795.395) [-3795.611] (-3790.032) (-3801.183) * (-3797.191) (-3801.424) [-3797.399] (-3804.413) -- 0:02:05 838500 -- [-3793.685] (-3807.590) (-3795.323) (-3791.844) * (-3803.294) (-3792.257) (-3794.457) [-3802.627] -- 0:02:04 839000 -- [-3791.553] (-3803.799) (-3820.918) (-3796.673) * [-3796.138] (-3796.811) (-3803.147) (-3802.555) -- 0:02:04 839500 -- [-3799.349] (-3805.332) (-3808.555) (-3796.034) * [-3798.952] (-3792.899) (-3796.791) (-3798.600) -- 0:02:04 840000 -- (-3803.796) [-3799.681] (-3810.289) (-3799.648) * (-3797.620) (-3791.815) [-3803.152] (-3797.845) -- 0:02:03 Average standard deviation of split frequencies: 0.003084 840500 -- (-3797.365) (-3795.599) [-3797.927] (-3798.472) * (-3790.390) (-3807.061) [-3802.891] (-3802.891) -- 0:02:03 841000 -- (-3799.142) [-3794.941] (-3797.192) (-3803.323) * [-3791.203] (-3803.535) (-3792.550) (-3801.442) -- 0:02:02 841500 -- (-3800.096) (-3797.869) [-3799.520] (-3798.823) * (-3794.771) (-3798.247) (-3801.859) [-3796.966] -- 0:02:02 842000 -- (-3799.136) (-3790.303) (-3800.995) [-3792.345] * (-3803.386) [-3794.864] (-3805.653) (-3795.946) -- 0:02:01 842500 -- (-3796.819) [-3797.826] (-3810.408) (-3804.672) * (-3800.384) (-3802.753) [-3809.293] (-3801.734) -- 0:02:01 843000 -- (-3796.827) (-3797.870) (-3804.301) [-3794.130] * (-3811.090) [-3795.043] (-3808.863) (-3805.381) -- 0:02:01 843500 -- [-3793.617] (-3799.286) (-3801.466) (-3802.356) * (-3799.664) (-3801.384) (-3804.519) [-3799.176] -- 0:02:00 844000 -- (-3805.360) (-3798.682) [-3794.228] (-3794.960) * [-3796.295] (-3807.204) (-3795.490) (-3810.692) -- 0:02:00 844500 -- (-3802.967) (-3795.675) (-3795.334) [-3789.552] * (-3810.454) (-3813.089) [-3803.633] (-3795.779) -- 0:02:00 845000 -- [-3798.440] (-3805.397) (-3797.081) (-3795.540) * [-3797.906] (-3805.760) (-3798.020) (-3805.320) -- 0:01:59 Average standard deviation of split frequencies: 0.002879 845500 -- (-3809.689) (-3802.692) [-3794.269] (-3800.701) * [-3794.532] (-3799.185) (-3793.302) (-3809.044) -- 0:01:59 846000 -- (-3800.580) (-3804.577) [-3796.395] (-3797.502) * [-3798.970] (-3792.523) (-3807.053) (-3804.900) -- 0:01:59 846500 -- [-3802.280] (-3799.405) (-3798.508) (-3800.035) * [-3794.541] (-3801.063) (-3799.715) (-3797.775) -- 0:01:58 847000 -- (-3806.171) (-3799.105) (-3799.915) [-3805.837] * (-3802.346) [-3807.755] (-3808.464) (-3790.219) -- 0:01:58 847500 -- (-3815.280) (-3795.794) (-3794.108) [-3806.115] * [-3795.434] (-3801.120) (-3806.159) (-3798.769) -- 0:01:57 848000 -- (-3803.807) [-3794.893] (-3794.374) (-3802.739) * (-3796.342) [-3796.066] (-3799.436) (-3798.699) -- 0:01:57 848500 -- (-3800.807) (-3795.172) [-3797.560] (-3794.488) * [-3792.951] (-3792.942) (-3797.210) (-3798.236) -- 0:01:56 849000 -- (-3803.565) (-3803.893) [-3799.262] (-3795.012) * [-3795.130] (-3805.440) (-3801.667) (-3801.782) -- 0:01:56 849500 -- (-3805.718) [-3799.566] (-3793.217) (-3804.516) * (-3798.573) [-3793.255] (-3794.142) (-3798.362) -- 0:01:56 850000 -- (-3797.362) (-3797.275) (-3800.701) [-3789.800] * (-3804.792) (-3793.224) (-3789.849) [-3801.651] -- 0:01:55 Average standard deviation of split frequencies: 0.003140 850500 -- (-3793.590) (-3794.228) [-3794.391] (-3801.953) * [-3798.956] (-3795.652) (-3797.018) (-3795.132) -- 0:01:55 851000 -- [-3805.328] (-3794.612) (-3803.280) (-3799.827) * (-3794.431) (-3799.253) (-3788.862) [-3802.097] -- 0:01:55 851500 -- [-3788.741] (-3793.052) (-3799.125) (-3800.582) * (-3799.142) [-3801.920] (-3802.579) (-3806.597) -- 0:01:54 852000 -- [-3797.277] (-3795.483) (-3802.018) (-3794.985) * [-3800.235] (-3806.896) (-3802.390) (-3819.425) -- 0:01:54 852500 -- (-3806.445) (-3809.104) (-3806.340) [-3803.445] * [-3799.880] (-3799.787) (-3796.248) (-3791.677) -- 0:01:54 853000 -- (-3801.109) (-3793.242) (-3798.438) [-3798.925] * (-3794.710) [-3796.897] (-3798.056) (-3798.071) -- 0:01:53 853500 -- [-3793.797] (-3798.332) (-3793.565) (-3802.745) * [-3789.800] (-3793.923) (-3800.476) (-3810.850) -- 0:01:53 854000 -- (-3801.021) [-3796.342] (-3808.279) (-3796.562) * (-3798.467) [-3797.227] (-3810.437) (-3802.904) -- 0:01:52 854500 -- [-3795.673] (-3798.470) (-3797.864) (-3817.645) * (-3802.159) (-3806.481) [-3786.888] (-3798.454) -- 0:01:52 855000 -- (-3789.137) [-3800.421] (-3798.499) (-3794.228) * [-3804.455] (-3799.988) (-3808.853) (-3806.182) -- 0:01:51 Average standard deviation of split frequencies: 0.003396 855500 -- (-3804.584) [-3792.342] (-3801.757) (-3804.664) * (-3798.964) [-3792.907] (-3793.590) (-3790.992) -- 0:01:51 856000 -- (-3796.920) [-3796.326] (-3801.837) (-3802.157) * (-3797.240) (-3801.437) (-3796.736) [-3795.352] -- 0:01:51 856500 -- [-3795.508] (-3792.437) (-3807.021) (-3820.074) * [-3802.299] (-3805.175) (-3794.948) (-3800.183) -- 0:01:50 857000 -- (-3811.563) (-3798.995) (-3798.277) [-3796.270] * (-3801.241) [-3796.224] (-3795.398) (-3807.074) -- 0:01:50 857500 -- (-3800.217) (-3804.911) (-3797.246) [-3801.127] * (-3795.818) (-3806.766) (-3796.428) [-3797.963] -- 0:01:50 858000 -- [-3787.715] (-3795.203) (-3802.689) (-3800.605) * (-3805.804) (-3802.771) [-3793.212] (-3808.020) -- 0:01:49 858500 -- (-3797.839) [-3802.861] (-3803.987) (-3797.165) * (-3808.872) (-3788.986) (-3803.301) [-3811.013] -- 0:01:49 859000 -- (-3800.457) [-3797.087] (-3801.831) (-3802.993) * (-3803.466) (-3803.210) (-3794.785) [-3799.082] -- 0:01:48 859500 -- [-3798.073] (-3794.960) (-3811.536) (-3812.905) * (-3793.125) (-3801.472) [-3795.208] (-3796.019) -- 0:01:48 860000 -- (-3791.945) (-3797.176) (-3807.508) [-3805.407] * (-3797.464) [-3793.864] (-3805.959) (-3789.379) -- 0:01:48 Average standard deviation of split frequencies: 0.003469 860500 -- (-3792.951) [-3794.058] (-3801.347) (-3803.937) * [-3792.586] (-3802.285) (-3807.461) (-3800.998) -- 0:01:47 861000 -- (-3792.323) [-3803.964] (-3811.565) (-3797.362) * (-3791.198) (-3801.527) (-3806.217) [-3794.097] -- 0:01:47 861500 -- (-3796.393) (-3799.521) (-3801.959) [-3799.587] * (-3797.595) (-3798.006) [-3794.879] (-3805.176) -- 0:01:46 862000 -- (-3805.676) (-3810.782) [-3795.359] (-3799.093) * (-3794.850) (-3801.031) [-3803.000] (-3801.159) -- 0:01:46 862500 -- (-3810.337) (-3792.621) (-3812.061) [-3796.244] * (-3806.818) (-3801.424) [-3792.976] (-3800.872) -- 0:01:46 863000 -- (-3802.165) (-3799.920) [-3802.762] (-3794.936) * (-3793.660) (-3799.112) (-3801.200) [-3797.163] -- 0:01:45 863500 -- (-3812.499) (-3798.333) (-3799.005) [-3801.373] * (-3801.554) [-3800.126] (-3797.872) (-3803.204) -- 0:01:45 864000 -- [-3798.760] (-3804.641) (-3801.601) (-3799.868) * (-3791.393) [-3798.777] (-3797.344) (-3803.155) -- 0:01:44 864500 -- (-3798.958) (-3805.114) (-3796.664) [-3792.673] * [-3794.214] (-3787.511) (-3797.297) (-3801.296) -- 0:01:44 865000 -- (-3797.272) (-3799.571) (-3794.789) [-3795.407] * (-3797.206) [-3791.058] (-3798.688) (-3804.784) -- 0:01:44 Average standard deviation of split frequencies: 0.003130 865500 -- (-3804.757) (-3802.286) (-3799.899) [-3795.039] * (-3800.828) (-3801.720) (-3799.885) [-3793.148] -- 0:01:43 866000 -- [-3791.186] (-3800.840) (-3801.569) (-3798.150) * (-3802.841) (-3797.069) [-3800.132] (-3800.643) -- 0:01:43 866500 -- [-3792.083] (-3806.689) (-3799.214) (-3810.876) * (-3802.528) [-3798.669] (-3800.409) (-3796.337) -- 0:01:43 867000 -- (-3797.387) (-3797.965) [-3805.823] (-3806.132) * (-3809.445) (-3789.595) (-3802.440) [-3793.538] -- 0:01:42 867500 -- (-3802.902) (-3802.490) [-3801.528] (-3797.966) * (-3795.778) [-3797.624] (-3795.922) (-3803.119) -- 0:01:42 868000 -- [-3801.203] (-3808.539) (-3793.800) (-3803.977) * [-3795.611] (-3801.499) (-3793.002) (-3801.099) -- 0:01:41 868500 -- (-3803.607) (-3810.793) (-3798.761) [-3798.176] * (-3789.860) [-3801.367] (-3794.139) (-3803.036) -- 0:01:41 869000 -- (-3799.380) [-3798.752] (-3795.885) (-3800.096) * (-3788.282) [-3804.399] (-3793.100) (-3796.682) -- 0:01:41 869500 -- (-3806.914) (-3800.916) [-3801.791] (-3791.848) * (-3795.021) [-3800.676] (-3793.439) (-3805.566) -- 0:01:40 870000 -- (-3803.341) (-3802.825) (-3803.805) [-3790.156] * (-3793.565) [-3796.052] (-3794.335) (-3791.051) -- 0:01:40 Average standard deviation of split frequencies: 0.003158 870500 -- (-3791.245) (-3808.081) [-3803.175] (-3799.205) * (-3794.374) [-3791.411] (-3798.921) (-3801.638) -- 0:01:39 871000 -- (-3801.154) (-3802.529) (-3795.491) [-3794.708] * (-3805.238) (-3796.036) (-3803.265) [-3799.412] -- 0:01:39 871500 -- [-3794.381] (-3794.906) (-3798.034) (-3797.742) * [-3800.723] (-3792.307) (-3797.795) (-3799.736) -- 0:01:39 872000 -- (-3796.347) (-3796.899) [-3809.378] (-3791.850) * (-3795.961) (-3795.520) [-3792.339] (-3809.601) -- 0:01:38 872500 -- (-3804.543) (-3797.302) [-3806.095] (-3799.788) * (-3802.688) (-3798.968) [-3796.090] (-3799.938) -- 0:01:38 873000 -- (-3796.835) (-3802.499) [-3791.579] (-3800.865) * (-3808.377) [-3791.183] (-3799.232) (-3797.890) -- 0:01:38 873500 -- (-3801.694) [-3792.758] (-3799.166) (-3801.360) * (-3797.727) [-3793.129] (-3798.772) (-3800.578) -- 0:01:37 874000 -- (-3808.103) [-3793.768] (-3802.101) (-3795.877) * (-3798.639) (-3798.312) [-3792.194] (-3804.622) -- 0:01:37 874500 -- (-3793.932) (-3807.646) (-3802.402) [-3802.136] * (-3801.200) (-3806.853) [-3795.284] (-3806.992) -- 0:01:37 875000 -- (-3797.271) (-3801.051) (-3800.244) [-3796.084] * (-3796.541) (-3796.419) (-3800.173) [-3798.079] -- 0:01:36 Average standard deviation of split frequencies: 0.003677 875500 -- (-3804.416) (-3796.493) (-3798.775) [-3795.457] * (-3803.942) (-3792.348) [-3805.041] (-3813.119) -- 0:01:36 876000 -- (-3802.152) (-3789.503) [-3796.734] (-3808.792) * (-3802.691) (-3796.377) [-3801.123] (-3804.254) -- 0:01:35 876500 -- (-3812.860) (-3811.865) (-3804.411) [-3796.846] * (-3806.396) (-3810.678) [-3801.844] (-3797.811) -- 0:01:35 877000 -- (-3803.256) [-3798.051] (-3801.060) (-3792.782) * [-3810.418] (-3810.244) (-3791.623) (-3797.537) -- 0:01:34 877500 -- [-3801.802] (-3794.001) (-3803.743) (-3795.209) * [-3800.908] (-3799.615) (-3796.967) (-3803.676) -- 0:01:34 878000 -- (-3799.637) (-3798.354) (-3793.139) [-3792.573] * [-3791.665] (-3801.675) (-3793.472) (-3801.415) -- 0:01:34 878500 -- (-3802.648) (-3800.984) (-3795.519) [-3796.365] * (-3793.056) (-3797.878) (-3797.972) [-3807.585] -- 0:01:33 879000 -- (-3806.915) [-3788.762] (-3799.591) (-3816.584) * (-3790.822) [-3793.156] (-3799.363) (-3813.914) -- 0:01:33 879500 -- (-3805.200) (-3811.366) [-3795.971] (-3802.826) * [-3802.905] (-3799.056) (-3797.167) (-3806.441) -- 0:01:33 880000 -- (-3814.802) [-3796.523] (-3803.308) (-3803.522) * (-3797.878) (-3806.117) [-3793.288] (-3800.238) -- 0:01:32 Average standard deviation of split frequencies: 0.003747 880500 -- (-3805.195) [-3788.936] (-3796.486) (-3795.908) * [-3793.583] (-3802.316) (-3802.950) (-3797.533) -- 0:01:32 881000 -- (-3791.801) [-3800.176] (-3794.621) (-3795.119) * (-3791.506) (-3812.057) [-3793.764] (-3796.317) -- 0:01:31 881500 -- [-3794.853] (-3802.261) (-3794.747) (-3793.671) * (-3791.713) (-3799.440) (-3795.918) [-3799.470] -- 0:01:31 882000 -- (-3800.638) (-3795.599) (-3803.082) [-3797.345] * [-3792.716] (-3796.783) (-3803.321) (-3805.715) -- 0:01:31 882500 -- (-3802.395) (-3798.794) [-3799.802] (-3797.247) * [-3798.233] (-3793.702) (-3792.739) (-3809.049) -- 0:01:30 883000 -- (-3798.999) (-3814.724) [-3794.017] (-3799.876) * (-3802.870) [-3792.963] (-3796.254) (-3802.249) -- 0:01:30 883500 -- [-3791.934] (-3806.552) (-3790.521) (-3801.029) * [-3795.268] (-3808.651) (-3796.884) (-3800.676) -- 0:01:29 884000 -- (-3791.001) [-3806.330] (-3797.082) (-3796.919) * (-3795.675) (-3806.790) [-3795.841] (-3808.338) -- 0:01:29 884500 -- (-3795.735) (-3798.222) (-3799.260) [-3796.213] * (-3800.064) [-3804.079] (-3797.799) (-3807.664) -- 0:01:29 885000 -- (-3798.235) (-3796.767) [-3796.214] (-3802.422) * [-3796.934] (-3795.223) (-3812.364) (-3795.769) -- 0:01:28 Average standard deviation of split frequencies: 0.003946 885500 -- [-3790.750] (-3791.068) (-3802.131) (-3798.910) * (-3804.949) (-3800.680) [-3798.029] (-3803.296) -- 0:01:28 886000 -- [-3798.566] (-3797.313) (-3812.659) (-3794.917) * (-3798.102) [-3808.642] (-3804.164) (-3797.780) -- 0:01:28 886500 -- (-3802.366) (-3802.605) (-3797.417) [-3804.160] * (-3801.350) [-3798.128] (-3797.799) (-3794.496) -- 0:01:27 887000 -- [-3789.317] (-3796.853) (-3791.854) (-3795.393) * (-3800.178) [-3792.330] (-3803.501) (-3800.017) -- 0:01:27 887500 -- (-3801.960) (-3795.781) [-3801.902] (-3798.840) * [-3797.167] (-3809.913) (-3796.646) (-3799.467) -- 0:01:26 888000 -- (-3795.868) (-3803.701) (-3795.898) [-3805.368] * (-3797.052) (-3801.564) [-3793.764] (-3805.578) -- 0:01:26 888500 -- (-3797.695) (-3800.242) (-3797.192) [-3795.904] * [-3796.676] (-3806.934) (-3795.238) (-3808.737) -- 0:01:26 889000 -- (-3807.072) (-3806.873) [-3794.890] (-3809.845) * (-3798.008) (-3811.959) [-3808.255] (-3797.771) -- 0:01:25 889500 -- (-3792.540) (-3807.531) (-3796.653) [-3791.990] * [-3804.626] (-3799.212) (-3791.507) (-3806.490) -- 0:01:25 890000 -- (-3809.584) (-3805.046) [-3799.107] (-3793.274) * (-3801.945) [-3803.464] (-3795.191) (-3808.716) -- 0:01:24 Average standard deviation of split frequencies: 0.003881 890500 -- (-3800.030) (-3804.951) (-3798.724) [-3793.795] * [-3798.430] (-3798.036) (-3795.812) (-3802.158) -- 0:01:24 891000 -- (-3798.128) [-3801.164] (-3807.034) (-3801.296) * [-3797.777] (-3797.428) (-3802.669) (-3797.869) -- 0:01:24 891500 -- (-3797.852) (-3802.909) (-3798.799) [-3804.368] * (-3800.277) [-3796.219] (-3796.845) (-3803.776) -- 0:01:23 892000 -- (-3796.000) (-3801.833) [-3800.354] (-3794.112) * [-3791.023] (-3800.633) (-3804.642) (-3798.779) -- 0:01:23 892500 -- [-3799.033] (-3792.696) (-3797.346) (-3802.734) * [-3794.102] (-3792.284) (-3801.885) (-3800.322) -- 0:01:22 893000 -- (-3792.063) [-3796.497] (-3800.562) (-3806.254) * [-3789.814] (-3794.029) (-3792.939) (-3798.317) -- 0:01:22 893500 -- (-3799.837) [-3799.127] (-3797.690) (-3805.607) * [-3798.109] (-3797.741) (-3794.164) (-3809.514) -- 0:01:22 894000 -- (-3789.972) (-3795.284) (-3801.960) [-3789.144] * [-3797.260] (-3798.775) (-3804.421) (-3796.381) -- 0:01:21 894500 -- [-3792.565] (-3804.688) (-3798.555) (-3792.796) * [-3796.493] (-3800.940) (-3807.376) (-3804.347) -- 0:01:21 895000 -- [-3796.253] (-3793.480) (-3802.018) (-3794.573) * (-3790.934) (-3801.476) [-3797.457] (-3799.946) -- 0:01:21 Average standard deviation of split frequencies: 0.004034 895500 -- [-3797.739] (-3802.929) (-3807.330) (-3791.634) * (-3798.595) [-3797.453] (-3807.514) (-3810.650) -- 0:01:20 896000 -- (-3796.440) (-3799.490) (-3802.612) [-3794.319] * (-3808.742) [-3794.141] (-3799.673) (-3794.115) -- 0:01:20 896500 -- [-3794.452] (-3811.731) (-3800.495) (-3796.272) * (-3799.980) (-3794.463) [-3797.256] (-3801.763) -- 0:01:19 897000 -- (-3800.209) (-3807.964) [-3792.806] (-3802.358) * [-3789.629] (-3807.186) (-3800.229) (-3800.617) -- 0:01:19 897500 -- [-3791.159] (-3798.200) (-3796.176) (-3802.363) * [-3796.676] (-3803.436) (-3803.493) (-3794.041) -- 0:01:19 898000 -- (-3797.493) (-3796.936) [-3800.944] (-3797.081) * [-3799.144] (-3801.064) (-3800.421) (-3796.238) -- 0:01:18 898500 -- [-3796.539] (-3809.502) (-3804.789) (-3804.621) * (-3796.771) (-3801.013) (-3797.914) [-3798.468] -- 0:01:18 899000 -- [-3798.449] (-3799.509) (-3796.868) (-3797.712) * [-3794.885] (-3793.546) (-3812.268) (-3792.279) -- 0:01:17 899500 -- (-3795.041) (-3793.948) (-3803.300) [-3791.767] * [-3798.250] (-3797.547) (-3804.782) (-3797.628) -- 0:01:17 900000 -- (-3796.234) [-3795.916] (-3799.491) (-3797.700) * (-3808.128) (-3797.313) (-3802.022) [-3802.496] -- 0:01:17 Average standard deviation of split frequencies: 0.004013 900500 -- (-3803.265) (-3803.543) [-3792.516] (-3795.534) * [-3799.566] (-3808.911) (-3794.756) (-3799.398) -- 0:01:16 901000 -- [-3800.604] (-3798.550) (-3813.113) (-3793.867) * (-3802.401) [-3796.764] (-3803.414) (-3806.286) -- 0:01:16 901500 -- (-3796.161) (-3802.457) [-3794.223] (-3798.833) * (-3794.206) (-3798.612) [-3793.152] (-3807.864) -- 0:01:16 902000 -- [-3796.808] (-3803.782) (-3800.520) (-3789.868) * (-3798.791) (-3799.202) [-3796.900] (-3794.838) -- 0:01:15 902500 -- (-3803.887) (-3797.276) (-3807.560) [-3796.269] * [-3795.278] (-3800.854) (-3796.183) (-3791.850) -- 0:01:15 903000 -- (-3801.767) [-3793.141] (-3801.356) (-3803.810) * (-3806.386) [-3800.403] (-3795.359) (-3798.507) -- 0:01:14 903500 -- (-3799.072) [-3795.947] (-3798.991) (-3801.601) * (-3800.451) [-3800.257] (-3796.727) (-3800.372) -- 0:01:14 904000 -- (-3796.663) [-3795.013] (-3811.643) (-3800.081) * (-3796.538) (-3794.656) (-3801.901) [-3799.350] -- 0:01:14 904500 -- (-3811.160) (-3797.954) [-3800.791] (-3791.982) * [-3791.657] (-3799.003) (-3801.536) (-3800.401) -- 0:01:13 905000 -- (-3801.734) [-3798.476] (-3802.546) (-3789.660) * (-3795.300) [-3796.149] (-3799.898) (-3794.889) -- 0:01:13 Average standard deviation of split frequencies: 0.004206 905500 -- (-3797.821) (-3798.822) [-3798.094] (-3792.567) * [-3792.968] (-3797.558) (-3806.712) (-3800.347) -- 0:01:12 906000 -- (-3802.346) (-3802.274) (-3796.035) [-3800.605] * (-3797.756) (-3802.114) (-3814.550) [-3795.121] -- 0:01:12 906500 -- [-3802.582] (-3802.448) (-3802.788) (-3800.592) * (-3795.646) (-3802.408) (-3806.198) [-3792.779] -- 0:01:12 907000 -- (-3796.941) (-3787.625) [-3797.668] (-3795.790) * (-3801.679) [-3791.137] (-3800.663) (-3800.418) -- 0:01:11 907500 -- (-3800.750) (-3800.358) (-3805.559) [-3797.837] * (-3810.944) (-3799.306) (-3791.458) [-3798.564] -- 0:01:11 908000 -- (-3798.315) (-3807.879) (-3806.676) [-3790.458] * (-3801.881) (-3799.041) [-3798.589] (-3801.554) -- 0:01:11 908500 -- (-3803.608) (-3805.245) (-3806.038) [-3801.838] * (-3799.756) [-3786.945] (-3798.948) (-3795.577) -- 0:01:10 909000 -- [-3791.517] (-3798.573) (-3795.727) (-3800.084) * (-3799.353) (-3800.091) [-3799.730] (-3797.184) -- 0:01:10 909500 -- (-3795.419) (-3800.125) (-3803.944) [-3794.379] * (-3797.214) (-3797.401) (-3796.182) [-3798.380] -- 0:01:09 910000 -- [-3796.563] (-3801.552) (-3799.742) (-3805.136) * (-3795.749) [-3794.053] (-3801.515) (-3798.369) -- 0:01:09 Average standard deviation of split frequencies: 0.004184 910500 -- [-3792.041] (-3796.580) (-3805.580) (-3798.605) * [-3801.688] (-3803.406) (-3794.282) (-3795.992) -- 0:01:09 911000 -- (-3794.954) [-3808.091] (-3795.454) (-3808.159) * (-3801.672) (-3788.827) (-3798.225) [-3797.453] -- 0:01:08 911500 -- (-3799.816) [-3799.216] (-3798.206) (-3794.789) * (-3803.462) [-3799.637] (-3803.387) (-3796.916) -- 0:01:08 912000 -- (-3802.426) (-3801.116) (-3804.580) [-3797.425] * (-3796.943) (-3797.862) (-3791.815) [-3797.433] -- 0:01:07 912500 -- (-3803.794) [-3798.389] (-3796.389) (-3814.592) * (-3803.027) [-3796.819] (-3795.439) (-3799.342) -- 0:01:07 913000 -- (-3807.338) (-3816.806) (-3795.095) [-3795.891] * (-3805.353) (-3797.312) (-3800.061) [-3790.168] -- 0:01:07 913500 -- (-3796.524) (-3806.259) (-3814.675) [-3800.434] * (-3810.543) (-3805.220) (-3807.492) [-3789.948] -- 0:01:06 914000 -- (-3797.189) (-3803.681) (-3806.467) [-3798.693] * (-3806.168) (-3798.611) [-3801.019] (-3799.501) -- 0:01:06 914500 -- (-3797.588) (-3803.308) [-3800.134] (-3801.361) * (-3800.283) [-3800.648] (-3799.676) (-3807.623) -- 0:01:06 915000 -- (-3799.213) [-3800.084] (-3793.733) (-3805.845) * (-3797.155) (-3809.993) (-3797.911) [-3800.252] -- 0:01:05 Average standard deviation of split frequencies: 0.003903 915500 -- (-3805.459) (-3798.937) [-3798.120] (-3801.966) * [-3793.019] (-3793.284) (-3802.707) (-3815.195) -- 0:01:05 916000 -- (-3797.702) [-3794.957] (-3800.458) (-3806.257) * [-3797.798] (-3798.823) (-3799.543) (-3811.341) -- 0:01:04 916500 -- (-3802.180) [-3795.116] (-3792.311) (-3796.384) * (-3802.775) [-3794.552] (-3797.323) (-3796.052) -- 0:01:04 917000 -- (-3807.129) (-3807.833) (-3797.395) [-3793.355] * [-3792.645] (-3793.725) (-3796.097) (-3807.921) -- 0:01:04 917500 -- (-3803.115) [-3791.338] (-3797.008) (-3799.803) * [-3792.449] (-3793.365) (-3801.056) (-3807.717) -- 0:01:03 918000 -- [-3798.007] (-3795.717) (-3794.582) (-3797.356) * (-3803.864) [-3795.852] (-3799.254) (-3807.439) -- 0:01:03 918500 -- (-3802.760) (-3794.945) [-3795.478] (-3805.224) * (-3803.048) [-3793.210] (-3798.664) (-3799.628) -- 0:01:02 919000 -- (-3801.102) (-3793.163) [-3792.381] (-3798.010) * (-3800.245) (-3802.584) [-3800.685] (-3799.536) -- 0:01:02 919500 -- (-3800.797) (-3798.243) (-3791.335) [-3798.812] * (-3813.472) [-3796.383] (-3799.730) (-3807.902) -- 0:01:02 920000 -- (-3796.286) (-3798.593) [-3793.998] (-3791.811) * (-3797.872) (-3796.627) (-3802.302) [-3791.217] -- 0:01:01 Average standard deviation of split frequencies: 0.003670 920500 -- (-3809.306) (-3800.690) [-3794.621] (-3790.942) * [-3795.409] (-3800.677) (-3804.532) (-3798.566) -- 0:01:01 921000 -- (-3804.147) [-3803.714] (-3799.649) (-3793.111) * (-3797.871) [-3795.595] (-3803.716) (-3800.185) -- 0:01:00 921500 -- (-3794.581) (-3801.181) (-3802.474) [-3792.456] * [-3794.798] (-3801.540) (-3796.139) (-3799.868) -- 0:01:00 922000 -- (-3800.278) (-3793.121) [-3797.577] (-3797.123) * [-3796.037] (-3792.405) (-3796.230) (-3792.554) -- 0:01:00 922500 -- (-3790.207) [-3795.550] (-3800.437) (-3800.596) * (-3794.162) (-3796.025) [-3795.390] (-3805.295) -- 0:00:59 923000 -- [-3792.727] (-3799.410) (-3799.556) (-3796.324) * (-3816.003) (-3796.620) (-3800.803) [-3801.352] -- 0:00:59 923500 -- [-3796.324] (-3798.101) (-3794.952) (-3799.411) * (-3805.324) [-3791.996] (-3803.888) (-3809.783) -- 0:00:59 924000 -- (-3798.893) (-3806.390) (-3796.436) [-3800.425] * (-3817.166) (-3793.687) (-3802.036) [-3794.505] -- 0:00:58 924500 -- [-3790.412] (-3797.548) (-3801.495) (-3810.397) * (-3815.113) (-3793.664) (-3797.289) [-3790.762] -- 0:00:58 925000 -- [-3795.890] (-3805.673) (-3786.671) (-3797.969) * (-3805.885) (-3801.805) (-3794.602) [-3797.565] -- 0:00:57 Average standard deviation of split frequencies: 0.003818 925500 -- (-3800.392) (-3805.247) (-3798.537) [-3793.653] * [-3799.453] (-3801.220) (-3796.682) (-3793.480) -- 0:00:57 926000 -- (-3794.252) (-3804.127) (-3795.153) [-3792.583] * (-3798.249) [-3798.054] (-3797.409) (-3804.709) -- 0:00:57 926500 -- [-3796.990] (-3801.663) (-3796.815) (-3800.301) * (-3804.034) [-3795.720] (-3796.252) (-3793.141) -- 0:00:56 927000 -- (-3804.763) [-3797.711] (-3804.975) (-3798.541) * [-3795.299] (-3808.492) (-3796.117) (-3796.550) -- 0:00:56 927500 -- (-3806.892) [-3797.053] (-3791.865) (-3801.474) * (-3801.090) (-3801.907) [-3792.894] (-3798.573) -- 0:00:55 928000 -- (-3803.882) (-3804.392) [-3794.468] (-3803.865) * (-3797.806) [-3793.930] (-3790.516) (-3800.234) -- 0:00:55 928500 -- (-3801.934) (-3794.676) [-3796.624] (-3797.393) * (-3801.058) (-3799.899) (-3792.972) [-3794.755] -- 0:00:55 929000 -- (-3800.134) (-3798.409) (-3803.225) [-3790.811] * [-3799.314] (-3804.208) (-3804.308) (-3802.849) -- 0:00:54 929500 -- (-3801.820) (-3804.622) [-3793.513] (-3799.605) * (-3808.880) (-3803.711) [-3801.332] (-3797.134) -- 0:00:54 930000 -- [-3798.742] (-3798.025) (-3798.874) (-3802.010) * (-3799.223) (-3796.247) [-3795.031] (-3801.676) -- 0:00:54 Average standard deviation of split frequencies: 0.003757 930500 -- [-3801.153] (-3794.643) (-3797.086) (-3798.489) * (-3797.255) (-3811.072) [-3792.469] (-3792.295) -- 0:00:53 931000 -- (-3798.880) [-3802.609] (-3812.523) (-3799.306) * (-3801.192) (-3802.703) (-3792.242) [-3793.341] -- 0:00:53 931500 -- (-3797.007) (-3806.880) (-3806.854) [-3791.778] * (-3799.004) [-3799.653] (-3794.886) (-3803.619) -- 0:00:52 932000 -- (-3803.506) [-3796.058] (-3797.983) (-3790.537) * (-3802.917) (-3797.187) [-3799.815] (-3812.715) -- 0:00:52 932500 -- (-3801.900) (-3794.405) [-3795.534] (-3798.074) * [-3797.869] (-3793.091) (-3794.854) (-3812.102) -- 0:00:52 933000 -- (-3803.774) (-3800.059) [-3806.406] (-3806.558) * (-3794.234) (-3816.829) [-3795.486] (-3798.320) -- 0:00:51 933500 -- [-3797.890] (-3794.547) (-3798.627) (-3799.708) * (-3805.633) (-3804.955) (-3794.669) [-3792.618] -- 0:00:51 934000 -- (-3796.227) (-3792.724) [-3791.487] (-3803.782) * (-3800.884) (-3792.014) (-3797.400) [-3795.128] -- 0:00:50 934500 -- (-3794.008) (-3799.830) (-3795.984) [-3794.922] * (-3797.187) [-3801.315] (-3792.844) (-3793.019) -- 0:00:50 935000 -- (-3802.316) (-3798.225) (-3802.353) [-3796.634] * (-3795.810) [-3791.893] (-3799.128) (-3797.636) -- 0:00:50 Average standard deviation of split frequencies: 0.003609 935500 -- (-3797.549) (-3801.732) [-3797.832] (-3797.381) * (-3797.661) [-3792.415] (-3804.116) (-3793.284) -- 0:00:49 936000 -- (-3796.109) [-3799.920] (-3805.735) (-3803.740) * [-3793.194] (-3797.010) (-3803.315) (-3792.615) -- 0:00:49 936500 -- (-3802.482) [-3795.506] (-3798.969) (-3801.087) * [-3794.481] (-3806.773) (-3804.211) (-3819.872) -- 0:00:49 937000 -- (-3804.000) [-3796.678] (-3797.745) (-3800.109) * [-3800.621] (-3801.535) (-3805.414) (-3807.707) -- 0:00:48 937500 -- (-3796.697) [-3797.199] (-3808.030) (-3804.027) * [-3794.484] (-3798.181) (-3803.665) (-3804.332) -- 0:00:48 938000 -- (-3806.571) (-3799.701) [-3797.972] (-3799.560) * [-3796.375] (-3798.115) (-3804.394) (-3794.050) -- 0:00:47 938500 -- (-3794.581) (-3796.639) (-3795.282) [-3798.078] * (-3804.306) (-3791.771) (-3811.007) [-3794.097] -- 0:00:47 939000 -- (-3792.565) [-3795.716] (-3793.375) (-3803.976) * (-3803.152) (-3808.793) (-3801.998) [-3797.198] -- 0:00:47 939500 -- [-3795.006] (-3794.057) (-3795.504) (-3797.117) * [-3795.969] (-3794.951) (-3803.169) (-3802.334) -- 0:00:46 940000 -- (-3802.141) (-3798.847) [-3796.238] (-3802.105) * (-3801.481) (-3800.058) [-3801.538] (-3806.017) -- 0:00:46 Average standard deviation of split frequencies: 0.003926 940500 -- (-3803.118) (-3802.984) (-3800.302) [-3796.611] * (-3805.842) (-3799.652) [-3798.236] (-3799.721) -- 0:00:45 941000 -- (-3800.698) [-3791.399] (-3805.815) (-3802.400) * (-3799.614) (-3800.694) (-3795.429) [-3803.758] -- 0:00:45 941500 -- (-3802.090) (-3798.779) (-3803.943) [-3800.039] * (-3799.187) [-3794.946] (-3793.595) (-3804.041) -- 0:00:45 942000 -- (-3795.980) (-3795.546) (-3806.520) [-3797.427] * (-3810.486) (-3800.767) [-3793.338] (-3797.446) -- 0:00:44 942500 -- (-3797.029) (-3797.977) (-3802.568) [-3801.034] * (-3794.351) [-3803.796] (-3810.345) (-3798.393) -- 0:00:44 943000 -- [-3796.136] (-3806.940) (-3797.042) (-3791.346) * (-3822.900) (-3804.423) [-3801.366] (-3801.375) -- 0:00:44 943500 -- (-3795.790) (-3800.897) (-3802.003) [-3797.966] * (-3799.754) [-3805.133] (-3801.404) (-3812.023) -- 0:00:43 944000 -- (-3804.193) (-3791.578) (-3798.579) [-3800.090] * (-3796.217) (-3797.812) [-3794.051] (-3801.433) -- 0:00:43 944500 -- (-3805.014) (-3800.087) (-3789.819) [-3796.864] * (-3796.548) (-3805.076) (-3801.749) [-3796.571] -- 0:00:42 945000 -- (-3793.658) (-3797.650) (-3803.713) [-3793.161] * (-3794.015) (-3801.115) [-3794.189] (-3797.745) -- 0:00:42 Average standard deviation of split frequencies: 0.003820 945500 -- (-3798.201) (-3793.041) [-3789.722] (-3800.380) * [-3796.772] (-3800.762) (-3789.837) (-3797.331) -- 0:00:42 946000 -- (-3799.052) (-3794.148) [-3801.656] (-3798.908) * [-3792.440] (-3799.591) (-3799.645) (-3803.736) -- 0:00:41 946500 -- (-3809.054) [-3798.320] (-3801.104) (-3797.903) * [-3802.916] (-3801.084) (-3803.414) (-3805.077) -- 0:00:41 947000 -- (-3794.168) [-3799.409] (-3807.800) (-3802.345) * (-3797.001) (-3793.666) (-3800.310) [-3799.069] -- 0:00:40 947500 -- (-3808.229) (-3790.366) [-3798.645] (-3804.448) * (-3802.510) [-3797.033] (-3800.640) (-3787.891) -- 0:00:40 948000 -- (-3800.645) [-3793.171] (-3793.514) (-3802.895) * (-3806.057) (-3796.035) (-3796.906) [-3793.789] -- 0:00:40 948500 -- (-3803.007) (-3801.185) [-3802.057] (-3804.579) * (-3806.199) [-3790.675] (-3790.129) (-3798.528) -- 0:00:39 949000 -- (-3801.347) (-3799.087) (-3806.091) [-3797.123] * (-3802.477) [-3798.631] (-3797.129) (-3800.710) -- 0:00:39 949500 -- (-3803.524) (-3806.992) (-3794.120) [-3789.837] * [-3794.118] (-3799.559) (-3794.576) (-3803.076) -- 0:00:38 950000 -- [-3802.542] (-3810.089) (-3799.988) (-3794.002) * (-3799.993) [-3799.424] (-3798.631) (-3809.471) -- 0:00:38 Average standard deviation of split frequencies: 0.003926 950500 -- (-3799.321) (-3802.594) (-3802.622) [-3791.796] * [-3802.651] (-3809.112) (-3809.573) (-3809.046) -- 0:00:38 951000 -- (-3806.849) (-3807.954) (-3806.624) [-3792.664] * [-3794.786] (-3808.939) (-3800.186) (-3804.579) -- 0:00:37 951500 -- [-3796.338] (-3798.260) (-3797.624) (-3802.845) * [-3798.416] (-3806.206) (-3797.340) (-3794.813) -- 0:00:37 952000 -- [-3796.394] (-3796.353) (-3800.298) (-3805.017) * (-3803.768) [-3797.485] (-3798.124) (-3798.220) -- 0:00:37 952500 -- (-3793.819) (-3796.708) [-3795.334] (-3802.403) * (-3806.926) (-3799.121) [-3796.139] (-3795.995) -- 0:00:36 953000 -- (-3792.123) (-3805.302) [-3794.315] (-3796.453) * (-3797.515) (-3800.246) (-3803.683) [-3797.769] -- 0:00:36 953500 -- (-3791.960) (-3798.471) [-3795.322] (-3806.129) * [-3805.964] (-3806.695) (-3798.150) (-3808.064) -- 0:00:35 954000 -- (-3794.325) [-3800.896] (-3802.522) (-3796.220) * (-3808.227) (-3794.430) (-3798.519) [-3798.798] -- 0:00:35 954500 -- (-3793.766) (-3796.692) (-3794.688) [-3802.928] * [-3811.495] (-3797.949) (-3805.832) (-3801.855) -- 0:00:35 955000 -- (-3800.025) [-3795.409] (-3806.473) (-3810.222) * (-3794.319) (-3796.852) [-3793.423] (-3798.446) -- 0:00:34 Average standard deviation of split frequencies: 0.004109 955500 -- (-3802.172) (-3793.835) [-3793.301] (-3803.442) * (-3796.114) (-3801.083) [-3797.767] (-3807.561) -- 0:00:34 956000 -- (-3811.787) (-3796.000) [-3796.554] (-3805.590) * [-3794.237] (-3796.830) (-3801.927) (-3803.216) -- 0:00:33 956500 -- (-3804.326) (-3795.423) (-3797.455) [-3802.780] * (-3798.120) (-3803.925) (-3794.122) [-3795.845] -- 0:00:33 957000 -- [-3801.191] (-3795.034) (-3794.824) (-3794.157) * [-3798.290] (-3799.425) (-3797.478) (-3799.563) -- 0:00:33 957500 -- (-3802.173) (-3800.317) [-3791.625] (-3794.966) * (-3798.981) [-3809.525] (-3798.649) (-3805.936) -- 0:00:32 958000 -- [-3796.350] (-3792.353) (-3800.898) (-3793.864) * (-3797.968) (-3805.277) [-3797.819] (-3805.349) -- 0:00:32 958500 -- (-3796.812) (-3801.372) (-3802.633) [-3798.800] * [-3793.435] (-3807.845) (-3793.644) (-3799.404) -- 0:00:32 959000 -- [-3785.983] (-3795.269) (-3793.716) (-3801.120) * (-3798.100) [-3802.933] (-3801.002) (-3803.269) -- 0:00:31 959500 -- (-3799.507) [-3794.276] (-3802.645) (-3809.360) * [-3794.493] (-3797.874) (-3800.466) (-3799.049) -- 0:00:31 960000 -- [-3803.395] (-3798.595) (-3803.842) (-3793.145) * (-3798.723) (-3795.859) (-3800.643) [-3794.036] -- 0:00:30 Average standard deviation of split frequencies: 0.004171 960500 -- [-3793.512] (-3804.037) (-3793.846) (-3798.661) * (-3805.838) (-3799.155) [-3800.121] (-3793.611) -- 0:00:30 961000 -- (-3798.020) (-3798.398) (-3792.403) [-3797.347] * [-3793.664] (-3801.720) (-3814.538) (-3797.415) -- 0:00:30 961500 -- (-3801.587) (-3795.619) [-3799.118] (-3791.346) * (-3801.107) [-3800.596] (-3804.009) (-3792.231) -- 0:00:29 962000 -- (-3802.290) (-3805.748) [-3794.131] (-3802.686) * (-3798.526) (-3809.356) [-3805.203] (-3794.097) -- 0:00:29 962500 -- (-3817.974) (-3807.424) (-3795.645) [-3802.593] * (-3798.491) [-3797.124] (-3803.207) (-3792.172) -- 0:00:28 963000 -- (-3820.299) [-3798.211] (-3791.999) (-3801.533) * (-3797.181) (-3799.508) (-3795.795) [-3801.272] -- 0:00:28 963500 -- (-3808.576) [-3800.225] (-3799.555) (-3798.887) * (-3801.983) [-3799.183] (-3800.363) (-3796.679) -- 0:00:28 964000 -- (-3796.762) [-3800.916] (-3807.949) (-3799.466) * (-3799.543) (-3801.060) [-3806.226] (-3795.149) -- 0:00:27 964500 -- [-3799.632] (-3804.778) (-3799.080) (-3800.249) * (-3797.592) (-3797.924) (-3814.273) [-3792.765] -- 0:00:27 965000 -- (-3803.105) (-3801.653) [-3799.588] (-3803.945) * (-3800.792) (-3798.292) (-3800.904) [-3789.524] -- 0:00:27 Average standard deviation of split frequencies: 0.003945 965500 -- [-3803.690] (-3794.084) (-3797.256) (-3798.451) * [-3799.139] (-3812.347) (-3793.603) (-3802.086) -- 0:00:26 966000 -- (-3810.659) [-3800.179] (-3805.650) (-3801.980) * [-3791.270] (-3806.808) (-3798.147) (-3805.010) -- 0:00:26 966500 -- [-3795.097] (-3807.070) (-3787.970) (-3804.226) * [-3788.797] (-3811.376) (-3799.631) (-3804.466) -- 0:00:25 967000 -- [-3795.516] (-3795.904) (-3798.880) (-3800.720) * [-3800.806] (-3803.770) (-3800.332) (-3800.543) -- 0:00:25 967500 -- [-3789.491] (-3799.659) (-3798.142) (-3798.926) * [-3792.910] (-3799.365) (-3795.502) (-3800.089) -- 0:00:25 968000 -- (-3796.898) (-3795.927) [-3792.556] (-3795.869) * (-3796.824) (-3803.308) (-3791.477) [-3792.079] -- 0:00:24 968500 -- (-3796.344) [-3797.519] (-3808.130) (-3794.541) * (-3799.026) (-3798.340) (-3795.471) [-3792.194] -- 0:00:24 969000 -- (-3802.379) [-3802.293] (-3799.628) (-3822.550) * (-3800.473) [-3800.222] (-3801.950) (-3802.013) -- 0:00:23 969500 -- [-3795.455] (-3800.406) (-3806.290) (-3801.691) * [-3789.587] (-3795.117) (-3794.592) (-3792.649) -- 0:00:23 970000 -- [-3803.546] (-3798.711) (-3797.608) (-3799.859) * (-3803.486) [-3806.463] (-3801.394) (-3803.300) -- 0:00:23 Average standard deviation of split frequencies: 0.004330 970500 -- (-3794.811) (-3810.683) [-3795.773] (-3802.012) * (-3800.963) (-3804.807) (-3796.473) [-3795.569] -- 0:00:22 971000 -- (-3801.416) [-3792.691] (-3791.550) (-3792.164) * (-3796.993) (-3793.041) (-3798.483) [-3801.373] -- 0:00:22 971500 -- (-3795.276) (-3795.161) [-3792.193] (-3798.333) * (-3799.796) (-3795.354) (-3801.330) [-3800.278] -- 0:00:22 972000 -- [-3800.289] (-3794.730) (-3799.635) (-3800.290) * (-3797.478) [-3805.355] (-3796.968) (-3803.813) -- 0:00:21 972500 -- [-3799.580] (-3793.789) (-3803.867) (-3796.683) * (-3804.833) [-3799.641] (-3801.037) (-3800.100) -- 0:00:21 973000 -- (-3798.767) (-3791.504) (-3799.846) [-3798.624] * (-3794.818) [-3793.059] (-3795.486) (-3804.424) -- 0:00:20 973500 -- [-3797.126] (-3801.772) (-3797.770) (-3794.689) * [-3793.298] (-3802.299) (-3792.869) (-3802.343) -- 0:00:20 974000 -- (-3803.080) [-3800.709] (-3807.668) (-3796.894) * [-3795.610] (-3803.102) (-3796.291) (-3803.113) -- 0:00:20 974500 -- (-3800.368) (-3804.809) [-3799.032] (-3793.558) * (-3800.885) (-3799.770) [-3810.439] (-3794.071) -- 0:00:19 975000 -- [-3795.690] (-3809.968) (-3812.116) (-3801.965) * (-3809.328) (-3799.960) [-3797.403] (-3798.519) -- 0:00:19 Average standard deviation of split frequencies: 0.004427 975500 -- (-3792.933) (-3794.662) [-3800.390] (-3794.055) * (-3793.640) (-3794.602) (-3801.301) [-3799.427] -- 0:00:18 976000 -- [-3794.286] (-3800.927) (-3799.819) (-3795.716) * [-3795.739] (-3797.499) (-3807.238) (-3795.520) -- 0:00:18 976500 -- (-3806.352) (-3797.301) (-3797.638) [-3789.882] * (-3794.761) (-3805.460) (-3799.385) [-3801.011] -- 0:00:18 977000 -- (-3814.305) (-3799.047) [-3801.483] (-3797.930) * (-3796.990) [-3798.965] (-3799.893) (-3806.605) -- 0:00:17 977500 -- (-3793.514) (-3798.003) [-3796.139] (-3806.679) * (-3800.766) [-3796.823] (-3798.665) (-3799.222) -- 0:00:17 978000 -- (-3794.323) (-3804.093) [-3797.057] (-3795.880) * (-3805.839) [-3789.599] (-3792.872) (-3799.963) -- 0:00:16 978500 -- [-3801.182] (-3798.368) (-3797.045) (-3792.511) * (-3798.711) [-3793.227] (-3796.989) (-3794.992) -- 0:00:16 979000 -- (-3799.461) (-3795.921) [-3792.039] (-3798.661) * (-3797.592) (-3802.614) (-3797.707) [-3798.544] -- 0:00:16 979500 -- (-3800.124) (-3795.370) [-3792.812] (-3804.935) * (-3796.627) (-3798.148) (-3799.759) [-3793.224] -- 0:00:15 980000 -- [-3794.874] (-3803.047) (-3798.583) (-3810.212) * (-3796.928) (-3802.794) (-3805.678) [-3801.867] -- 0:00:15 Average standard deviation of split frequencies: 0.004406 980500 -- [-3790.742] (-3801.606) (-3800.752) (-3803.853) * [-3793.051] (-3799.877) (-3794.915) (-3804.931) -- 0:00:15 981000 -- [-3794.637] (-3810.395) (-3813.746) (-3804.423) * (-3801.344) [-3797.686] (-3801.663) (-3806.937) -- 0:00:14 981500 -- (-3796.470) (-3805.219) [-3796.318] (-3796.379) * (-3796.515) (-3799.039) (-3805.712) [-3793.178] -- 0:00:14 982000 -- (-3796.016) [-3794.730] (-3794.854) (-3799.548) * (-3798.206) (-3794.504) (-3804.247) [-3804.693] -- 0:00:13 982500 -- (-3803.565) (-3799.010) (-3798.176) [-3794.032] * [-3792.389] (-3790.183) (-3798.016) (-3808.455) -- 0:00:13 983000 -- (-3796.896) (-3804.760) [-3800.601] (-3795.832) * (-3799.435) (-3792.714) (-3799.576) [-3804.025] -- 0:00:13 983500 -- (-3799.954) (-3806.275) [-3794.684] (-3799.720) * (-3814.343) (-3796.550) (-3804.090) [-3803.595] -- 0:00:12 984000 -- (-3798.871) (-3809.015) [-3798.851] (-3803.922) * (-3807.820) [-3794.131] (-3796.964) (-3796.093) -- 0:00:12 984500 -- [-3791.427] (-3796.575) (-3797.713) (-3806.748) * (-3801.939) [-3796.211] (-3794.557) (-3794.438) -- 0:00:11 985000 -- (-3794.689) (-3801.774) [-3795.644] (-3803.855) * (-3799.991) (-3796.133) [-3797.577] (-3805.687) -- 0:00:11 Average standard deviation of split frequencies: 0.004741 985500 -- (-3804.733) (-3798.116) (-3795.675) [-3797.399] * (-3805.185) (-3797.184) [-3797.899] (-3792.141) -- 0:00:11 986000 -- (-3809.088) (-3800.156) (-3799.841) [-3800.903] * (-3794.327) [-3804.320] (-3795.319) (-3799.561) -- 0:00:10 986500 -- [-3804.389] (-3798.771) (-3799.118) (-3806.314) * (-3798.880) (-3805.066) [-3792.930] (-3809.917) -- 0:00:10 987000 -- (-3797.445) (-3814.961) [-3796.036] (-3797.297) * (-3799.931) (-3812.544) (-3795.496) [-3802.930] -- 0:00:10 987500 -- (-3794.303) (-3804.337) [-3800.693] (-3800.375) * (-3818.395) (-3796.710) [-3800.557] (-3796.493) -- 0:00:09 988000 -- (-3797.848) (-3797.358) [-3793.479] (-3815.939) * (-3801.821) (-3801.354) [-3793.551] (-3797.115) -- 0:00:09 988500 -- (-3796.472) (-3797.988) [-3793.124] (-3800.342) * (-3799.107) [-3800.337] (-3788.820) (-3808.191) -- 0:00:08 989000 -- (-3812.889) [-3794.126] (-3804.704) (-3795.610) * [-3797.740] (-3808.050) (-3794.725) (-3796.845) -- 0:00:08 989500 -- (-3803.037) [-3795.966] (-3799.995) (-3796.577) * [-3793.755] (-3811.171) (-3802.054) (-3800.357) -- 0:00:08 990000 -- [-3792.702] (-3801.787) (-3811.936) (-3798.900) * [-3793.031] (-3804.466) (-3798.966) (-3801.752) -- 0:00:07 Average standard deviation of split frequencies: 0.004719 990500 -- (-3799.511) [-3799.076] (-3808.026) (-3793.235) * (-3815.930) [-3799.941] (-3797.265) (-3804.388) -- 0:00:07 991000 -- (-3802.605) (-3792.863) [-3798.551] (-3801.135) * (-3805.314) (-3801.319) [-3801.328] (-3808.951) -- 0:00:06 991500 -- (-3791.363) (-3797.833) (-3794.361) [-3793.150] * (-3795.527) (-3797.215) [-3800.121] (-3800.555) -- 0:00:06 992000 -- (-3792.781) [-3794.398] (-3805.227) (-3800.258) * (-3803.290) [-3792.826] (-3799.551) (-3797.156) -- 0:00:06 992500 -- (-3800.835) [-3804.497] (-3805.085) (-3799.634) * (-3808.161) [-3798.946] (-3793.841) (-3794.290) -- 0:00:05 993000 -- (-3799.434) (-3798.044) (-3795.856) [-3798.571] * (-3790.169) (-3796.282) (-3799.699) [-3786.416] -- 0:00:05 993500 -- (-3794.896) [-3794.108] (-3797.830) (-3805.920) * (-3800.637) [-3799.805] (-3797.565) (-3800.260) -- 0:00:05 994000 -- (-3798.099) (-3795.425) [-3796.218] (-3814.632) * (-3799.169) (-3795.510) [-3790.462] (-3808.852) -- 0:00:04 994500 -- (-3809.455) (-3800.146) (-3802.325) [-3799.332] * (-3805.980) (-3796.805) [-3797.547] (-3804.454) -- 0:00:04 995000 -- (-3807.244) (-3790.598) [-3791.669] (-3802.693) * (-3801.781) (-3803.885) (-3789.971) [-3795.252] -- 0:00:03 Average standard deviation of split frequencies: 0.004694 995500 -- (-3798.887) (-3797.319) (-3795.337) [-3793.244] * (-3796.919) (-3799.179) [-3794.883] (-3807.212) -- 0:00:03 996000 -- (-3795.558) (-3800.340) (-3792.204) [-3790.441] * [-3796.419] (-3799.961) (-3804.943) (-3806.032) -- 0:00:03 996500 -- (-3794.591) (-3796.316) [-3794.353] (-3805.441) * (-3798.855) [-3793.824] (-3799.380) (-3802.417) -- 0:00:02 997000 -- (-3801.464) (-3795.798) [-3795.437] (-3789.298) * (-3798.406) [-3795.044] (-3791.611) (-3800.102) -- 0:00:02 997500 -- (-3800.061) (-3801.037) [-3793.221] (-3797.691) * [-3799.095] (-3800.171) (-3800.362) (-3804.093) -- 0:00:01 998000 -- (-3798.574) [-3798.350] (-3798.561) (-3807.146) * (-3802.676) (-3799.782) (-3804.884) [-3796.647] -- 0:00:01 998500 -- [-3797.529] (-3799.128) (-3801.878) (-3793.944) * (-3800.527) (-3793.876) (-3800.408) [-3798.909] -- 0:00:01 999000 -- (-3800.980) (-3796.353) (-3803.924) [-3792.477] * (-3792.319) [-3798.018] (-3803.469) (-3803.378) -- 0:00:00 999500 -- (-3797.303) [-3795.327] (-3792.793) (-3797.871) * [-3800.407] (-3797.309) (-3799.529) (-3792.404) -- 0:00:00 1000000 -- [-3792.017] (-3805.097) (-3802.000) (-3799.171) * (-3804.781) (-3800.260) (-3794.852) [-3794.125] -- 0:00:00 Average standard deviation of split frequencies: 0.005025 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -3792.016634 -- 25.865934 Chain 1 -- -3792.016638 -- 25.865934 Chain 2 -- -3805.097276 -- 25.019296 Chain 2 -- -3805.097303 -- 25.019296 Chain 3 -- -3801.999688 -- 25.991211 Chain 3 -- -3801.999689 -- 25.991211 Chain 4 -- -3799.170959 -- 21.831365 Chain 4 -- -3799.170945 -- 21.831365 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -3804.780732 -- 22.988069 Chain 1 -- -3804.780730 -- 22.988069 Chain 2 -- -3800.259587 -- 24.574768 Chain 2 -- -3800.259551 -- 24.574768 Chain 3 -- -3794.851973 -- 22.240434 Chain 3 -- -3794.851989 -- 22.240434 Chain 4 -- -3794.125052 -- 22.182583 Chain 4 -- -3794.125072 -- 22.182583 Analysis completed in 12 mins 52 seconds Analysis used 772.00 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -3784.57 Likelihood of best state for "cold" chain of run 2 was -3784.91 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 35.6 % ( 23 %) Dirichlet(Revmat{all}) 53.6 % ( 43 %) Slider(Revmat{all}) 23.2 % ( 21 %) Dirichlet(Pi{all}) 25.6 % ( 24 %) Slider(Pi{all}) 30.2 % ( 24 %) Multiplier(Alpha{1,2}) 40.3 % ( 27 %) Multiplier(Alpha{3}) 43.4 % ( 27 %) Slider(Pinvar{all}) 6.3 % ( 7 %) ExtSPR(Tau{all},V{all}) 1.2 % ( 0 %) ExtTBR(Tau{all},V{all}) 9.6 % ( 13 %) NNI(Tau{all},V{all}) 9.2 % ( 11 %) ParsSPR(Tau{all},V{all}) 26.2 % ( 21 %) Multiplier(V{all}) 35.6 % ( 37 %) Nodeslider(V{all}) 24.9 % ( 30 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 36.3 % ( 29 %) Dirichlet(Revmat{all}) 53.4 % ( 34 %) Slider(Revmat{all}) 22.9 % ( 26 %) Dirichlet(Pi{all}) 26.0 % ( 35 %) Slider(Pi{all}) 30.0 % ( 40 %) Multiplier(Alpha{1,2}) 40.8 % ( 28 %) Multiplier(Alpha{3}) 42.9 % ( 22 %) Slider(Pinvar{all}) 6.4 % ( 6 %) ExtSPR(Tau{all},V{all}) 1.3 % ( 2 %) ExtTBR(Tau{all},V{all}) 9.4 % ( 10 %) NNI(Tau{all},V{all}) 8.9 % ( 8 %) ParsSPR(Tau{all},V{all}) 26.3 % ( 22 %) Multiplier(V{all}) 35.7 % ( 32 %) Nodeslider(V{all}) 25.2 % ( 27 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.76 0.57 0.40 2 | 167188 0.78 0.59 3 | 166570 166121 0.79 4 | 166547 166576 166998 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.76 0.56 0.41 2 | 166841 0.78 0.59 3 | 166205 166778 0.80 4 | 166851 166450 166875 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -3795.30 | * 1 2 2 1| | 2 2 2 1 * | | 2 1 1 11 1 2 | | 1 1 12 * * 21 2 1 | |1 112 2 2* 2 1 11 1 2| |2 2 2 2 1 2 *2 1 12 1 | | 22 2 * 1 222 2 2 2 | | 1 22 1 11 1 2 2 1 111 1 2 2 | | 1 1 2 1 2 12 1 2 1 2 2 | | 1 11 1 2 1 2 1 2 2 | | 2 1 2 1 1 | | 1 2 | | 2 | | 1 | | 1 2 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -3799.19 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3791.39 -3806.54 2 -3791.75 -3806.00 -------------------------------------- TOTAL -3791.55 -3806.31 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.818261 0.005606 0.682099 0.973720 0.814690 1156.42 1264.12 1.000 r(A<->C){all} 0.112024 0.000315 0.078845 0.148238 0.111219 974.19 1082.30 1.001 r(A<->G){all} 0.194985 0.000641 0.147241 0.245500 0.194076 880.32 947.91 1.000 r(A<->T){all} 0.087840 0.000487 0.047650 0.130732 0.087114 1014.47 1023.26 1.001 r(C<->G){all} 0.074378 0.000209 0.047224 0.103341 0.073563 1009.64 1113.78 1.000 r(C<->T){all} 0.419273 0.001338 0.351006 0.494734 0.418343 792.34 969.14 1.000 r(G<->T){all} 0.111498 0.000526 0.067259 0.155817 0.109902 962.29 969.03 1.000 pi(A){all} 0.237498 0.000134 0.216282 0.261418 0.237468 881.48 1029.53 1.000 pi(C){all} 0.303736 0.000155 0.279112 0.327142 0.303797 694.05 765.33 1.000 pi(G){all} 0.290525 0.000161 0.265042 0.313314 0.290546 1017.49 1023.65 1.000 pi(T){all} 0.168241 0.000100 0.148884 0.187509 0.168005 961.69 1096.85 1.000 alpha{1,2} 0.259575 0.002964 0.158873 0.362656 0.253171 929.54 1049.12 1.000 alpha{3} 1.656767 0.372235 0.687642 2.916412 1.551977 1214.23 1241.71 1.000 pinvar{all} 0.415405 0.004302 0.285353 0.533822 0.423057 949.05 1005.51 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 7 -- C7 8 -- C8 9 -- C9 10 -- C10 11 -- C11 12 -- C12 Key to taxon bipartitions (saved to file "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------------ 1 -- .*********** 2 -- .*.......... 3 -- ..*......... 4 -- ...*........ 5 -- ....*....... 6 -- .....*...... 7 -- ......*..... 8 -- .......*.... 9 -- ........*... 10 -- .........*.. 11 -- ..........*. 12 -- ...........* 13 -- .**......... 14 -- .....******* 15 -- ..........** 16 -- .....***.*.. 17 -- .....***.... 18 -- ...********* 19 -- ......**.... 20 -- .....*****.. 21 -- ...**....... 22 -- ....******** 23 -- ........*.** 24 -- ...*.******* ------------------ Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 13 3002 1.000000 0.000000 1.000000 1.000000 2 14 3002 1.000000 0.000000 1.000000 1.000000 2 15 3002 1.000000 0.000000 1.000000 1.000000 2 16 3000 0.999334 0.000000 0.999334 0.999334 2 17 2998 0.998668 0.000942 0.998001 0.999334 2 18 2997 0.998334 0.000471 0.998001 0.998668 2 19 2865 0.954364 0.004240 0.951366 0.957362 2 20 2413 0.803797 0.007066 0.798801 0.808794 2 21 1652 0.550300 0.018844 0.536975 0.563624 2 22 890 0.296469 0.001884 0.295137 0.297801 2 23 543 0.180879 0.006124 0.176549 0.185210 2 24 460 0.153231 0.020728 0.138574 0.167888 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.008963 0.000013 0.002828 0.016333 0.008538 1.000 2 length{all}[2] 0.003732 0.000005 0.000295 0.008195 0.003255 1.001 2 length{all}[3] 0.002388 0.000003 0.000005 0.005806 0.002006 1.002 2 length{all}[4] 0.025211 0.000041 0.013922 0.038382 0.024654 1.000 2 length{all}[5] 0.015380 0.000025 0.006037 0.025284 0.014824 1.000 2 length{all}[6] 0.145105 0.000614 0.098626 0.195378 0.143130 1.000 2 length{all}[7] 0.058829 0.000151 0.036930 0.083615 0.057845 1.000 2 length{all}[8] 0.024777 0.000069 0.011289 0.042904 0.023765 1.000 2 length{all}[9] 0.084778 0.000276 0.051903 0.115731 0.083518 1.000 2 length{all}[10] 0.126448 0.000553 0.083981 0.176373 0.124475 1.000 2 length{all}[11] 0.030677 0.000076 0.015149 0.047875 0.029942 1.000 2 length{all}[12] 0.092068 0.000265 0.060778 0.122729 0.090697 1.000 2 length{all}[13] 0.007638 0.000011 0.001793 0.014218 0.007118 1.000 2 length{all}[14] 0.028139 0.000073 0.012134 0.044969 0.027203 1.000 2 length{all}[15] 0.031216 0.000099 0.012387 0.051010 0.030400 1.000 2 length{all}[16] 0.041868 0.000222 0.014821 0.071576 0.040666 1.000 2 length{all}[17] 0.039507 0.000234 0.012342 0.068960 0.037930 1.000 2 length{all}[18] 0.010006 0.000018 0.002734 0.018421 0.009555 1.000 2 length{all}[19] 0.022849 0.000124 0.002003 0.044089 0.021735 1.000 2 length{all}[20] 0.017166 0.000077 0.002215 0.034952 0.016257 1.000 2 length{all}[21] 0.004759 0.000014 0.000008 0.011858 0.003911 0.999 2 length{all}[22] 0.003368 0.000007 0.000005 0.008776 0.002741 1.000 2 length{all}[23] 0.008867 0.000031 0.000292 0.019400 0.007969 1.004 2 length{all}[24] 0.003039 0.000007 0.000003 0.008483 0.002216 0.998 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.005025 Maximum standard deviation of split frequencies = 0.020728 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.004 Clade credibility values: /---------------------------------------------------------------------- C1 (1) | | /---------- C2 (2) |----------------------------100----------------------------+ | \---------- C3 (3) | | /---------- C4 (4) + /------------------------55-----------------------+ | | \---------- C5 (5) | | | | /-------------------- C6 (6) | | | | | /---100---+ /---------- C7 (7) \---100---+ | \----95---+ | /---100---+ \---------- C8 (8) | | | | /----80---+ \------------------------------ C10 (10) | | | | | \---------------------------------------- C9 (9) \---100---+ | /---------- C11 (11) \------------------100------------------+ \---------- C12 (12) Phylogram (based on average branch lengths): /-- C1 (1) | | /- C2 (2) |-+ | \ C3 (3) | | /------ C4 (4) + /+ | |\--- C5 (5) | | | | /-------------------------------------- C6 (6) | | | | | /--------+ /--------------- C7 (7) \--+ | \-----+ | /----------+ \------ C8 (8) | | | | /---+ \-------------------------------- C10 (10) | | | | | \---------------------- C9 (9) \------+ | /------- C11 (11) \-------+ \----------------------- C12 (12) |------------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (31 trees sampled): 50 % credible set contains 2 trees 90 % credible set contains 5 trees 95 % credible set contains 8 trees 99 % credible set contains 16 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 12 ls = 1176 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Reading seq # 7: C7 Reading seq # 8: C8 Reading seq # 9: C9 Reading seq #10: C10 Reading seq #11: C11 Reading seq #12: C12 Sites with gaps or missing data are removed. 123 ambiguity characters in seq. 1 129 ambiguity characters in seq. 2 129 ambiguity characters in seq. 3 111 ambiguity characters in seq. 4 111 ambiguity characters in seq. 5 153 ambiguity characters in seq. 6 162 ambiguity characters in seq. 7 150 ambiguity characters in seq. 8 123 ambiguity characters in seq. 9 165 ambiguity characters in seq. 10 120 ambiguity characters in seq. 11 105 ambiguity characters in seq. 12 75 sites are removed. 24 49 50 57 183 184 185 186 187 188 189 190 201 202 203 204 205 206 207 208 218 219 220 227 228 302 303 304 305 306 307 313 314 315 316 317 318 319 320 321 322 323 333 334 335 336 337 338 339 340 341 342 343 344 345 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 Sequences read.. Counting site patterns.. 0:00 185 patterns at 317 / 317 sites (100.0%), 0:00 Counting codons.. NG distances for seqs.: 1 2 3 4 5 6 7 8 9 10 11 12 528 bytes for distance 180560 bytes for conP 25160 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, (2, 3), ((4, 5), ((((6, (7, 8)), 10), 9), (11, 12)))); MP score: 273 1 0.056757 2 0.005376 3 0.004137 4 0.004111 5 0.004109 6 0.004109 7 0.004109 8 0.004109 902800 bytes for conP, adjusted 0.013855 0.011848 0.003240 0.003223 0.011223 0.000000 0.032460 0.019747 0.034410 0.008176 0.035382 0.017731 0.152793 0.030972 0.079400 0.039245 0.148165 0.119713 0.032159 0.049724 0.136452 0.300000 1.300000 ntime & nrate & np: 21 2 23 Bounds (np=23): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 23 lnL0 = -3273.247726 Iterating by ming2 Initial: fx= 3273.247726 x= 0.01385 0.01185 0.00324 0.00322 0.01122 0.00000 0.03246 0.01975 0.03441 0.00818 0.03538 0.01773 0.15279 0.03097 0.07940 0.03925 0.14817 0.11971 0.03216 0.04972 0.13645 0.30000 1.30000 1 h-m-p 0.0000 0.0000 713.6685 ++ 3273.246383 m 0.0000 28 | 1/23 2 h-m-p 0.0000 0.0002 1650.2393 +YCYCCC 3253.796305 5 0.0001 63 | 1/23 3 h-m-p 0.0001 0.0003 671.3586 +YYYYCCCCC 3224.788175 8 0.0002 102 | 1/23 4 h-m-p 0.0000 0.0001 3719.1118 +YYCYCCC 3166.309591 6 0.0001 138 | 1/23 5 h-m-p 0.0000 0.0000 12190.2813 +CYYCC 3151.219249 4 0.0000 172 | 1/23 6 h-m-p 0.0000 0.0000 7520.9443 ++ 3083.672560 m 0.0000 198 | 1/23 7 h-m-p 0.0000 0.0000 67357.0338 +YYYYCCC 2998.409921 6 0.0000 233 | 1/23 8 h-m-p 0.0000 0.0001 2070.4541 CYCCCC 2990.879348 5 0.0000 268 | 1/23 9 h-m-p 0.0000 0.0002 212.3532 CCCCC 2989.317498 4 0.0001 302 | 1/23 10 h-m-p 0.0002 0.0011 37.3028 YYC 2989.171173 2 0.0002 330 | 1/23 11 h-m-p 0.0001 0.0009 51.8504 +YCCC 2988.814571 3 0.0004 362 | 1/23 12 h-m-p 0.0001 0.0006 54.2941 YCC 2988.739181 2 0.0001 391 | 1/23 13 h-m-p 0.0002 0.0019 26.8141 +YYC 2988.424685 2 0.0005 420 | 1/23 14 h-m-p 0.0005 0.0037 27.4136 YCCC 2987.451410 3 0.0010 451 | 1/23 15 h-m-p 0.0010 0.0080 27.1861 +YCYCCC 2970.193706 5 0.0061 486 | 1/23 16 h-m-p 0.0000 0.0001 674.0800 +YYCYCC 2963.169327 5 0.0001 520 | 1/23 17 h-m-p 0.0000 0.0001 205.6719 +YCYCCC 2960.525059 5 0.0001 555 | 1/23 18 h-m-p 0.0001 0.0008 152.0696 +YCYCCC 2946.552313 5 0.0006 591 | 1/23 19 h-m-p 0.0001 0.0005 113.2200 +YYCCC 2944.326327 4 0.0003 624 | 1/23 20 h-m-p 0.0001 0.0005 113.5306 CCCC 2943.667446 3 0.0001 656 | 1/23 21 h-m-p 0.0005 0.0389 30.1288 CCC 2943.451482 2 0.0005 686 | 1/23 22 h-m-p 0.0016 0.0082 2.8374 YCCCC 2943.064319 4 0.0037 719 | 1/23 23 h-m-p 0.0004 0.0046 27.8896 +CCC 2939.561769 2 0.0021 750 | 1/23 24 h-m-p 0.0000 0.0002 58.5425 +YYYC 2938.356222 3 0.0002 780 | 1/23 25 h-m-p 0.0077 0.1548 1.4312 ++YCYCCC 2922.840595 5 0.0826 816 | 1/23 26 h-m-p 0.2242 1.1210 0.0840 YCCCC 2915.870268 4 0.5336 849 | 1/23 27 h-m-p 0.4571 2.2854 0.0659 CCCC 2913.340234 3 0.6055 903 | 1/23 28 h-m-p 1.2411 6.2056 0.0319 YYC 2912.128563 2 0.9756 953 | 1/23 29 h-m-p 0.8023 4.0116 0.0179 YYC 2911.697661 2 0.6918 1003 | 1/23 30 h-m-p 1.0704 7.1793 0.0116 YCCC 2911.513441 3 0.6765 1056 | 1/23 31 h-m-p 1.2848 7.7396 0.0061 CC 2911.375470 1 1.2710 1106 | 1/23 32 h-m-p 1.6000 8.0000 0.0023 CC 2911.309905 1 2.0394 1156 | 1/23 33 h-m-p 1.6000 8.0000 0.0028 YC 2911.250644 1 1.0794 1205 | 1/23 34 h-m-p 1.2051 8.0000 0.0025 YC 2911.166242 1 2.3893 1254 | 1/23 35 h-m-p 1.6000 8.0000 0.0016 +YC 2911.035209 1 5.0133 1304 | 1/23 36 h-m-p 1.6000 8.0000 0.0033 YC 2910.731466 1 3.7949 1353 | 1/23 37 h-m-p 1.6000 8.0000 0.0060 +YC 2909.996782 1 5.0453 1403 | 1/23 38 h-m-p 1.6000 8.0000 0.0146 +YCCC 2908.419909 3 4.7088 1457 | 1/23 39 h-m-p 1.6000 8.0000 0.0271 YCCC 2906.827132 3 3.9033 1510 | 1/23 40 h-m-p 1.6000 8.0000 0.0434 CCC 2905.685843 2 2.3209 1562 | 1/23 41 h-m-p 1.6000 8.0000 0.0180 CCC 2905.412230 2 1.9796 1614 | 1/23 42 h-m-p 1.6000 8.0000 0.0055 YCC 2905.213441 2 2.8697 1665 | 1/23 43 h-m-p 1.6000 8.0000 0.0050 +CC 2904.887889 1 5.5664 1716 | 1/23 44 h-m-p 1.6000 8.0000 0.0066 ++ 2902.850199 m 8.0000 1764 | 1/23 45 h-m-p 0.3673 1.8367 0.0377 +YYYCYCCC 2898.834977 7 1.5483 1823 | 1/23 46 h-m-p 0.1139 3.4038 0.5132 +YCCC 2893.926552 3 0.7301 1877 | 1/23 47 h-m-p 0.3517 1.7583 0.1695 +YYYYC 2889.749815 4 1.3695 1930 | 1/23 48 h-m-p 1.4041 7.0205 0.0864 CCCC 2888.097258 3 1.9413 1984 | 1/23 49 h-m-p 0.4104 2.0520 0.0948 +YYCCC 2886.980594 4 1.3410 2039 | 1/23 50 h-m-p 0.5931 2.9653 0.1474 YC 2885.426929 1 1.2740 2088 | 1/23 51 h-m-p 0.3324 1.6619 0.0787 +YYCYC 2884.175051 4 1.1170 2142 | 1/23 52 h-m-p 0.6754 3.3772 0.0308 CCCC 2883.749503 3 0.9885 2196 | 1/23 53 h-m-p 0.5213 2.6066 0.0041 CYCCC 2883.629245 4 0.8676 2251 | 1/23 54 h-m-p 0.1799 8.0000 0.0196 ++YCC 2883.400358 2 1.9115 2304 | 1/23 55 h-m-p 1.6000 8.0000 0.0108 YCCC 2883.156874 3 2.6299 2357 | 1/23 56 h-m-p 0.9863 8.0000 0.0288 YC 2883.095000 1 1.6139 2406 | 1/23 57 h-m-p 1.6000 8.0000 0.0096 YC 2883.086349 1 1.2130 2455 | 1/23 58 h-m-p 1.6000 8.0000 0.0039 CC 2883.084731 1 1.3009 2505 | 1/23 59 h-m-p 1.6000 8.0000 0.0003 C 2883.084418 0 1.7094 2553 | 1/23 60 h-m-p 1.6000 8.0000 0.0001 C 2883.084376 0 1.5246 2601 | 1/23 61 h-m-p 1.6000 8.0000 0.0001 C 2883.084356 0 2.4972 2649 | 1/23 62 h-m-p 1.6000 8.0000 0.0001 C 2883.084352 0 1.3187 2697 | 1/23 63 h-m-p 1.6000 8.0000 0.0000 Y 2883.084352 0 0.8585 2745 | 1/23 64 h-m-p 0.3708 8.0000 0.0000 ---------------.. | 1/23 65 h-m-p 0.0011 0.5491 0.0114 ----------- | 1/23 66 h-m-p 0.0011 0.5491 0.0114 ----------- Out.. lnL = -2883.084352 2921 lfun, 2921 eigenQcodon, 61341 P(t) Time used: 0:28 Model 1: NearlyNeutral TREE # 1 (1, (2, 3), ((4, 5), ((((6, (7, 8)), 10), 9), (11, 12)))); MP score: 273 1 0.032049 2 0.004781 3 0.004123 4 0.004111 5 0.004110 6 0.004110 7 0.004110 8 0.004110 0.013928 0.011850 0.003196 0.003214 0.011286 0.000000 0.032475 0.019866 0.034315 0.008193 0.035321 0.017837 0.152680 0.031040 0.079390 0.039208 0.148133 0.119749 0.032251 0.049654 0.136277 2.586999 0.630989 0.207592 ntime & nrate & np: 21 2 24 Bounds (np=24): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 6.526392 np = 24 lnL0 = -2913.463798 Iterating by ming2 Initial: fx= 2913.463798 x= 0.01393 0.01185 0.00320 0.00321 0.01129 0.00000 0.03248 0.01987 0.03432 0.00819 0.03532 0.01784 0.15268 0.03104 0.07939 0.03921 0.14813 0.11975 0.03225 0.04965 0.13628 2.58700 0.63099 0.20759 1 h-m-p 0.0000 0.0000 561.9375 ++ 2913.461696 m 0.0000 53 | 1/24 2 h-m-p 0.0000 0.0000 786.5372 +YYYYCC 2909.584118 5 0.0000 111 | 1/24 3 h-m-p 0.0000 0.0000 4560.4627 ++ 2898.974588 m 0.0000 161 | 1/24 4 h-m-p 0.0000 0.0000 17886.8857 h-m-p: 4.95902945e-23 2.47951472e-22 1.78868857e+04 2898.974588 .. | 1/24 5 h-m-p 0.0000 0.0006 1715.9068 YYYYC 2892.822241 4 0.0000 262 | 1/24 6 h-m-p 0.0000 0.0001 498.3649 ++ 2878.007272 m 0.0001 312 | 1/24 7 h-m-p 0.0000 0.0000 26706.8606 +YCYYYYYY 2869.716661 7 0.0000 371 | 1/24 8 h-m-p 0.0000 0.0001 1680.0066 ++ 2816.042841 m 0.0001 421 | 2/24 9 h-m-p 0.0001 0.0003 210.5883 YCYCCC 2813.929054 5 0.0001 479 | 1/24 10 h-m-p 0.0000 0.0000 750.8072 CCCC 2813.655420 3 0.0000 534 | 1/24 11 h-m-p 0.0000 0.0002 225.9269 +YCYC 2812.610863 3 0.0001 589 | 1/24 12 h-m-p 0.0001 0.0006 122.8426 CCC 2811.889832 2 0.0001 643 | 1/24 13 h-m-p 0.0001 0.0007 76.2210 CCCC 2810.963168 3 0.0002 699 | 1/24 14 h-m-p 0.0001 0.0010 108.7692 YCCC 2809.328905 3 0.0003 754 | 1/24 15 h-m-p 0.0001 0.0004 182.9431 CCC 2808.716634 2 0.0001 808 | 1/24 16 h-m-p 0.0001 0.0008 116.3933 CYC 2808.208777 2 0.0001 861 | 1/24 17 h-m-p 0.0004 0.0026 35.0041 CCC 2808.147795 2 0.0001 915 | 1/24 18 h-m-p 0.0002 0.0036 21.8571 CC 2808.109810 1 0.0002 967 | 1/24 19 h-m-p 0.0003 0.0079 18.0124 CC 2808.078043 1 0.0003 1019 | 1/24 20 h-m-p 0.0006 0.0124 10.7681 YC 2808.067691 1 0.0003 1070 | 1/24 21 h-m-p 0.0008 0.0357 4.0580 YC 2808.064085 1 0.0005 1121 | 1/24 22 h-m-p 0.0007 0.0270 2.6444 YC 2808.062510 1 0.0004 1172 | 1/24 23 h-m-p 0.0006 0.1038 1.7156 +YC 2808.055367 1 0.0017 1224 | 1/24 24 h-m-p 0.0005 0.0336 6.0998 YC 2808.031476 1 0.0012 1275 | 1/24 25 h-m-p 0.0005 0.0998 15.5824 ++CCC 2807.555064 2 0.0078 1331 | 1/24 26 h-m-p 0.0009 0.0046 140.4379 CC 2807.065447 1 0.0009 1383 | 1/24 27 h-m-p 0.0007 0.0104 176.1938 CC 2806.558728 1 0.0007 1435 | 1/24 28 h-m-p 0.0070 0.0352 7.8052 YC 2806.522552 1 0.0011 1486 | 1/24 29 h-m-p 0.0033 0.4723 2.6197 ++YCCC 2804.973525 3 0.1304 1543 | 1/24 30 h-m-p 0.4493 2.2467 0.0336 YCCCC 2804.086955 4 0.9171 1600 | 1/24 31 h-m-p 0.7882 8.0000 0.0391 CCC 2803.945270 2 0.9297 1654 | 1/24 32 h-m-p 1.6000 8.0000 0.0090 CCC 2803.805565 2 2.0265 1708 | 1/24 33 h-m-p 1.3228 8.0000 0.0138 YC 2803.695184 1 2.1141 1759 | 1/24 34 h-m-p 1.6000 8.0000 0.0069 CCC 2803.624854 2 2.1265 1813 | 1/24 35 h-m-p 1.6000 8.0000 0.0088 CYC 2803.559578 2 1.8231 1866 | 1/24 36 h-m-p 1.6000 8.0000 0.0069 CC 2803.553571 1 1.2883 1918 | 1/24 37 h-m-p 1.6000 8.0000 0.0004 C 2803.553275 0 1.2970 1968 | 1/24 38 h-m-p 1.6000 8.0000 0.0002 +C 2803.553071 0 5.8650 2019 | 1/24 39 h-m-p 1.6000 8.0000 0.0003 +Y 2803.552150 0 6.7449 2070 | 1/24 40 h-m-p 0.8787 8.0000 0.0021 C 2803.552015 0 1.1471 2120 | 1/24 41 h-m-p 1.6000 8.0000 0.0004 Y 2803.552013 0 1.0504 2170 | 1/24 42 h-m-p 1.6000 8.0000 0.0000 Y 2803.552013 0 0.9491 2220 | 1/24 43 h-m-p 1.6000 8.0000 0.0000 C 2803.552013 0 1.8272 2270 | 1/24 44 h-m-p 0.7692 8.0000 0.0000 Y 2803.552013 0 0.7692 2320 | 1/24 45 h-m-p 0.8032 8.0000 0.0000 ----------------.. | 1/24 46 h-m-p 0.0160 8.0000 0.0009 --C 2803.552013 0 0.0003 2436 | 1/24 47 h-m-p 0.0160 8.0000 0.0009 -------------.. | 1/24 48 h-m-p 0.0013 0.6669 0.0071 ----------- Out.. lnL = -2803.552013 2557 lfun, 7671 eigenQcodon, 107394 P(t) Time used: 1:17 Model 2: PositiveSelection TREE # 1 (1, (2, 3), ((4, 5), ((((6, (7, 8)), 10), 9), (11, 12)))); MP score: 273 1 0.092842 2 0.006247 3 0.004158 4 0.004114 5 0.004112 6 0.004112 7 0.004112 8 0.004112 9 0.004112 initial w for M2:NSpselection reset. 0.013914 0.011875 0.003255 0.003259 0.011190 0.000000 0.032451 0.019808 0.034418 0.008257 0.035422 0.017742 0.152776 0.031003 0.079376 0.039165 0.148076 0.119741 0.032149 0.049774 0.136432 2.536628 1.237723 0.153992 0.218428 2.873198 ntime & nrate & np: 21 3 26 Bounds (np=26): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 4.607535 np = 26 lnL0 = -2936.876320 Iterating by ming2 Initial: fx= 2936.876320 x= 0.01391 0.01188 0.00326 0.00326 0.01119 0.00000 0.03245 0.01981 0.03442 0.00826 0.03542 0.01774 0.15278 0.03100 0.07938 0.03917 0.14808 0.11974 0.03215 0.04977 0.13643 2.53663 1.23772 0.15399 0.21843 2.87320 1 h-m-p 0.0000 0.0000 616.1577 ++ 2936.873365 m 0.0000 57 | 1/26 2 h-m-p 0.0000 0.0000 697.7132 +YYCYC 2934.704976 4 0.0000 118 | 1/26 3 h-m-p 0.0000 0.0000 1410.7773 +YCYCC 2929.450272 4 0.0000 179 | 1/26 4 h-m-p 0.0000 0.0001 1717.3931 ++ 2905.253300 m 0.0001 233 | 1/26 5 h-m-p 0.0000 0.0000 4884.8163 h-m-p: 1.28427830e-22 6.42139152e-22 4.88481626e+03 2905.253300 .. | 1/26 6 h-m-p 0.0000 0.0004 1822.3678 +CYCCC 2882.749422 4 0.0000 346 | 1/26 7 h-m-p 0.0000 0.0002 401.7723 ++ 2860.329364 m 0.0002 400 | 1/26 8 h-m-p 0.0000 0.0000 43392.6368 +YYYYYCCCC 2856.305962 8 0.0000 466 | 1/26 9 h-m-p 0.0000 0.0000 1944.3684 ++ 2847.031319 m 0.0000 520 | 2/26 10 h-m-p 0.0001 0.0010 183.6336 +YCYCCC 2838.696567 5 0.0007 583 | 2/26 11 h-m-p 0.0000 0.0002 538.5917 +YCCC 2835.731176 3 0.0001 642 | 2/26 12 h-m-p 0.0002 0.0009 295.8072 CYC 2833.344181 2 0.0002 698 | 2/26 13 h-m-p 0.0002 0.0010 102.5980 YCYCCC 2831.583282 5 0.0005 759 | 2/26 14 h-m-p 0.0004 0.0029 121.6946 +YCCCC 2827.770914 4 0.0012 820 | 1/26 15 h-m-p 0.0002 0.0012 512.0274 YYCCC 2826.804668 4 0.0001 879 | 1/26 16 h-m-p 0.0001 0.0008 588.2076 +YCCCC 2820.113465 4 0.0005 941 | 1/26 17 h-m-p 0.0003 0.0016 277.6337 YCCC 2815.464972 3 0.0008 1000 | 1/26 18 h-m-p 0.0001 0.0006 175.6421 +CYC 2813.797205 2 0.0005 1058 | 1/26 19 h-m-p 0.0002 0.0008 82.4312 +YCCC 2813.251014 3 0.0004 1118 | 1/26 20 h-m-p 0.0010 0.0057 35.0875 YCCC 2812.675613 3 0.0007 1177 | 1/26 21 h-m-p 0.0010 0.0049 23.2372 CC 2812.389154 1 0.0008 1233 | 1/26 22 h-m-p 0.0002 0.0012 75.3343 CCCC 2812.123133 3 0.0004 1293 | 1/26 23 h-m-p 0.0023 0.0191 13.1329 CC 2811.948930 1 0.0022 1349 | 1/26 24 h-m-p 0.0003 0.0138 97.3932 ++YCYC 2810.380450 3 0.0032 1409 | 1/26 25 h-m-p 0.0004 0.0022 252.7264 CCY 2809.788398 2 0.0004 1467 | 1/26 26 h-m-p 0.0013 0.0066 52.2449 YC 2809.654545 1 0.0005 1522 | 1/26 27 h-m-p 0.0014 0.0225 19.2128 CC 2809.619409 1 0.0005 1578 | 1/26 28 h-m-p 0.0010 0.1737 9.1497 ++CCC 2809.043980 2 0.0191 1638 | 1/26 29 h-m-p 0.0014 0.0093 128.9480 YCCC 2808.035006 3 0.0023 1697 | 1/26 30 h-m-p 0.0008 0.0040 185.6876 YC 2807.784057 1 0.0004 1752 | 1/26 31 h-m-p 0.0333 2.6437 2.3063 ++CYC 2804.435994 2 0.5581 1811 | 1/26 32 h-m-p 0.6592 3.2960 0.7637 CYC 2802.739966 2 0.6460 1868 | 1/26 33 h-m-p 0.2450 1.7921 2.0138 YY 2801.605865 1 0.2297 1923 | 1/26 34 h-m-p 0.3683 2.8090 1.2562 YCCC 2800.350538 3 0.8690 1982 | 1/26 35 h-m-p 0.3889 1.9446 0.8190 CYCCC 2799.784010 4 0.6339 2043 | 1/26 36 h-m-p 0.7290 3.6452 0.4286 YCC 2799.620888 2 0.4636 2100 | 1/26 37 h-m-p 1.4154 8.0000 0.1404 YCC 2799.545020 2 0.8188 2157 | 1/26 38 h-m-p 1.0145 8.0000 0.1133 YC 2799.476174 1 2.2904 2212 | 1/26 39 h-m-p 0.5942 8.0000 0.4368 YC 2799.357325 1 1.3846 2267 | 1/26 40 h-m-p 1.6000 8.0000 0.2008 YCC 2799.296377 2 1.1542 2324 | 1/26 41 h-m-p 1.6000 8.0000 0.0684 CC 2799.226637 1 2.4245 2380 | 1/26 42 h-m-p 0.8524 8.0000 0.1947 +CYC 2798.958212 2 3.9332 2438 | 1/26 43 h-m-p 1.5340 8.0000 0.4992 CC 2798.649210 1 1.5262 2494 | 1/26 44 h-m-p 1.2685 8.0000 0.6005 CCC 2798.545888 2 1.5609 2552 | 1/26 45 h-m-p 1.6000 8.0000 0.5543 CCC 2798.478244 2 2.3195 2610 | 1/26 46 h-m-p 1.6000 8.0000 0.5334 YC 2798.461513 1 1.0075 2665 | 1/26 47 h-m-p 1.6000 8.0000 0.1540 YC 2798.458615 1 0.8203 2720 | 1/26 48 h-m-p 0.9944 8.0000 0.1271 CC 2798.457472 1 1.3301 2776 | 1/26 49 h-m-p 1.6000 8.0000 0.0273 +C 2798.454497 0 5.9393 2831 | 1/26 50 h-m-p 1.6000 8.0000 0.0249 YC 2798.449049 1 3.0094 2886 | 1/26 51 h-m-p 0.5794 8.0000 0.1291 YC 2798.446823 1 1.4335 2941 | 1/26 52 h-m-p 1.6000 8.0000 0.0775 +C 2798.442670 0 6.4730 2996 | 1/26 53 h-m-p 1.6000 8.0000 0.3039 ++ 2798.393638 m 8.0000 3050 | 1/26 54 h-m-p 0.3278 1.6392 4.2191 YYC 2798.374799 2 0.2563 3106 | 1/26 55 h-m-p 1.6000 8.0000 0.3208 CCC 2798.296527 2 1.5038 3164 | 1/26 56 h-m-p 1.6000 8.0000 0.1455 YC 2798.277757 1 1.0459 3219 | 1/26 57 h-m-p 0.7062 8.0000 0.2155 YC 2798.277279 1 0.5113 3274 | 1/26 58 h-m-p 1.6000 8.0000 0.0299 YC 2798.277180 1 0.9403 3329 | 1/26 59 h-m-p 1.6000 8.0000 0.0021 Y 2798.277173 0 1.1081 3383 | 1/26 60 h-m-p 1.6000 8.0000 0.0011 Y 2798.277173 0 1.1646 3437 | 1/26 61 h-m-p 1.6000 8.0000 0.0003 Y 2798.277173 0 1.0601 3491 | 1/26 62 h-m-p 1.6000 8.0000 0.0001 --C 2798.277173 0 0.0250 3547 | 1/26 63 h-m-p 0.0160 8.0000 0.0003 -------------.. | 1/26 64 h-m-p 0.0114 5.6861 0.0252 ------------- Out.. lnL = -2798.277173 3678 lfun, 14712 eigenQcodon, 231714 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2815.951950 S = -2678.075335 -129.972311 Calculating f(w|X), posterior probabilities of site classes. did 10 / 185 patterns 3:02 did 20 / 185 patterns 3:02 did 30 / 185 patterns 3:02 did 40 / 185 patterns 3:02 did 50 / 185 patterns 3:02 did 60 / 185 patterns 3:02 did 70 / 185 patterns 3:02 did 80 / 185 patterns 3:02 did 90 / 185 patterns 3:02 did 100 / 185 patterns 3:02 did 110 / 185 patterns 3:02 did 120 / 185 patterns 3:02 did 130 / 185 patterns 3:02 did 140 / 185 patterns 3:02 did 150 / 185 patterns 3:02 did 160 / 185 patterns 3:02 did 170 / 185 patterns 3:03 did 180 / 185 patterns 3:03 did 185 / 185 patterns 3:03 Time used: 3:03 Model 3: discrete TREE # 1 (1, (2, 3), ((4, 5), ((((6, (7, 8)), 10), 9), (11, 12)))); MP score: 273 1 0.055055 2 0.005335 3 0.004136 4 0.004123 5 0.004119 6 0.004119 7 0.004119 8 0.004119 0.014077 0.012058 0.003321 0.003323 0.011322 0.000000 0.032509 0.019862 0.034299 0.008376 0.035285 0.017696 0.152665 0.031011 0.079491 0.039342 0.148127 0.119643 0.032079 0.049657 0.136411 2.595616 0.387814 0.891300 0.063691 0.145108 0.264927 ntime & nrate & np: 21 4 27 Bounds (np=27): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 11.499314 np = 27 lnL0 = -2874.324948 Iterating by ming2 Initial: fx= 2874.324948 x= 0.01408 0.01206 0.00332 0.00332 0.01132 0.00000 0.03251 0.01986 0.03430 0.00838 0.03529 0.01770 0.15266 0.03101 0.07949 0.03934 0.14813 0.11964 0.03208 0.04966 0.13641 2.59562 0.38781 0.89130 0.06369 0.14511 0.26493 1 h-m-p 0.0000 0.0000 449.0621 ++ 2874.323703 m 0.0000 59 | 1/27 2 h-m-p 0.0000 0.0001 343.5675 ++ 2867.364849 m 0.0001 116 | 1/27 3 h-m-p 0.0000 0.0000 4467.1290 ++ 2854.902394 m 0.0000 172 | 2/27 4 h-m-p 0.0000 0.0000 1900.2054 ++ 2844.172463 m 0.0000 228 | 2/27 5 h-m-p -0.0000 -0.0000 1428289.7686 h-m-p: -2.49167339e-25 -1.24583670e-24 1.42828977e+06 2844.172463 .. | 2/27 6 h-m-p 0.0000 0.0001 998.5894 +YYYCCCC 2833.646134 6 0.0000 345 | 2/27 7 h-m-p 0.0000 0.0000 325.4684 +YYYYC 2831.635239 4 0.0000 405 | 2/27 8 h-m-p 0.0000 0.0000 1116.2690 ++ 2825.234315 m 0.0000 460 | 3/27 9 h-m-p 0.0000 0.0000 363.2574 +YCYCCC 2824.731708 5 0.0000 524 | 3/27 10 h-m-p 0.0000 0.0005 321.5179 +YCC 2822.125747 2 0.0001 582 | 3/27 11 h-m-p 0.0001 0.0005 398.9223 CCC 2819.264512 2 0.0002 640 | 3/27 12 h-m-p 0.0001 0.0003 506.3475 +YCYCCC 2815.123706 5 0.0002 703 | 3/27 13 h-m-p 0.0001 0.0003 790.4397 CCCC 2812.668880 3 0.0001 763 | 3/27 14 h-m-p 0.0003 0.0022 248.6850 YYCC 2811.922681 3 0.0001 821 | 3/27 15 h-m-p 0.0001 0.0004 82.9636 CCCC 2811.709629 3 0.0001 881 | 3/27 16 h-m-p 0.0002 0.0016 42.7692 YCC 2811.618037 2 0.0001 938 | 3/27 17 h-m-p 0.0004 0.0078 14.2273 C 2811.570609 0 0.0004 992 | 3/27 18 h-m-p 0.0005 0.0202 13.4071 CCC 2811.509379 2 0.0007 1050 | 3/27 19 h-m-p 0.0005 0.0117 16.9198 +YCC 2811.319306 2 0.0015 1108 | 3/27 20 h-m-p 0.0003 0.0023 73.8445 CC 2811.056788 1 0.0005 1164 | 3/27 21 h-m-p 0.0003 0.0015 91.4214 YCCCC 2810.658074 4 0.0006 1225 | 3/27 22 h-m-p 0.0003 0.0017 56.6800 YCC 2810.560834 2 0.0003 1282 | 3/27 23 h-m-p 0.0015 0.0212 10.2757 YC 2810.538887 1 0.0006 1337 | 3/27 24 h-m-p 0.0008 0.0587 8.4572 YC 2810.503140 1 0.0017 1392 | 3/27 25 h-m-p 0.0006 0.0093 25.4744 CCC 2810.465759 2 0.0006 1450 | 3/27 26 h-m-p 0.0003 0.0455 53.7534 ++CCCC 2809.630563 3 0.0062 1512 | 2/27 27 h-m-p 0.0006 0.0084 599.5313 YCC 2809.427812 2 0.0002 1569 | 2/27 28 h-m-p 0.0002 0.0048 863.5310 YC 2808.883125 1 0.0003 1625 | 2/27 29 h-m-p 0.0065 0.0325 10.1371 YC 2808.859508 1 0.0010 1681 | 2/27 30 h-m-p 0.0046 0.4414 2.2588 +++YCCC 2807.900620 3 0.2014 1744 | 1/27 31 h-m-p 0.1213 0.6132 3.7513 --YCC 2807.875202 2 0.0035 1804 | 1/27 32 h-m-p 0.0119 0.3471 1.1138 +++ 2805.651982 m 0.3471 1861 | 2/27 33 h-m-p 0.1591 0.7956 1.8805 CYC 2804.990961 2 0.1432 1920 | 2/27 34 h-m-p 0.3464 1.7318 0.4929 CCCC 2803.758537 3 0.4823 1981 | 2/27 35 h-m-p 1.6000 8.0000 0.1252 CCC 2803.165367 2 1.5303 2040 | 1/27 36 h-m-p 0.1048 1.0102 1.8278 --YC 2803.162357 1 0.0031 2098 | 1/27 37 h-m-p 0.0271 1.0884 0.2086 +++ 2802.947659 m 1.0884 2155 | 2/27 38 h-m-p 1.6000 8.0000 0.0798 CCC 2802.849368 2 1.4242 2215 | 2/27 39 h-m-p 1.6000 8.0000 0.0250 YC 2802.832025 1 1.2708 2271 | 2/27 40 h-m-p 1.6000 8.0000 0.0164 YC 2802.829259 1 0.8537 2327 | 2/27 41 h-m-p 1.6000 8.0000 0.0035 Y 2802.828958 0 1.2574 2382 | 2/27 42 h-m-p 1.2092 8.0000 0.0037 YC 2802.828817 1 2.6764 2438 | 2/27 43 h-m-p 0.9740 8.0000 0.0101 ++ 2802.827488 m 8.0000 2493 | 2/27 44 h-m-p 0.2319 8.0000 0.3480 +YYC 2802.824111 2 0.7955 2551 | 2/27 45 h-m-p 1.2126 8.0000 0.2283 YCC 2802.822145 2 0.6940 2609 | 2/27 46 h-m-p 0.8827 8.0000 0.1795 CYCC 2802.812733 3 1.3627 2669 | 2/27 47 h-m-p 1.6000 8.0000 0.0821 CC 2802.808645 1 0.4529 2726 | 2/27 48 h-m-p 0.2374 8.0000 0.1567 +CYCCC 2802.798225 4 1.5626 2789 | 2/27 49 h-m-p 1.6000 8.0000 0.0723 CCC 2802.782885 2 2.8992 2848 | 2/27 50 h-m-p 1.6000 8.0000 0.0153 YC 2802.775648 1 1.0490 2904 | 2/27 51 h-m-p 0.0305 8.0000 0.5263 ++YCYC 2802.762947 3 0.3393 2965 | 2/27 52 h-m-p 1.3788 8.0000 0.1295 YYYC 2802.752032 3 1.2168 3023 | 2/27 53 h-m-p 1.0121 8.0000 0.1557 CYCCC 2802.701135 4 1.6795 3085 | 2/27 54 h-m-p 1.1919 5.9593 0.0761 CC 2802.675304 1 0.4642 3142 | 2/27 55 h-m-p 0.1590 8.0000 0.2221 +CYCCC 2802.614276 4 1.1340 3205 | 2/27 56 h-m-p 1.6000 8.0000 0.0791 CCC 2802.546623 2 2.3760 3264 | 2/27 57 h-m-p 1.6000 8.0000 0.0310 YCCC 2802.454228 3 2.4105 3324 | 2/27 58 h-m-p 0.0669 6.1033 1.1184 +YCCCCC 2802.255906 5 0.3015 3389 | 1/27 59 h-m-p 0.0005 0.0089 727.1053 CYC 2802.248730 2 0.0001 3447 | 1/27 60 h-m-p 0.3798 1.8992 0.0202 ++ 2802.088922 m 1.8992 3503 | 2/27 61 h-m-p 0.2963 7.9001 0.1292 YCC 2801.933324 2 0.5500 3562 | 2/27 62 h-m-p 0.1071 5.6027 0.6636 +YCCCC 2801.601924 4 0.4448 3625 | 1/27 63 h-m-p 0.0006 0.0068 500.5772 YC 2801.594321 1 0.0001 3681 | 1/27 64 h-m-p 0.1813 0.9065 0.0808 ++ 2801.298100 m 0.9065 3737 | 2/27 65 h-m-p 0.0122 0.3914 5.9974 +CCCC 2800.249342 3 0.0810 3800 | 2/27 66 h-m-p 0.6564 8.0000 0.7396 CCCCC 2799.334875 4 0.7664 3863 | 1/27 67 h-m-p 0.0002 0.0025 3138.2059 YCCC 2799.171926 3 0.0001 3923 | 1/27 68 h-m-p 1.6000 8.0000 0.1731 YCCC 2798.620033 3 3.3214 3984 | 1/27 69 h-m-p 1.6000 8.0000 0.3196 CC 2798.392020 1 1.9059 4042 | 1/27 70 h-m-p 1.6000 8.0000 0.0532 CCC 2798.305203 2 1.5651 4102 | 1/27 71 h-m-p 1.6000 8.0000 0.0269 YC 2798.141234 1 3.9535 4159 | 1/27 72 h-m-p 0.4693 2.3465 0.2185 ++ 2797.937722 m 2.3465 4215 | 2/27 73 h-m-p 1.6000 8.0000 0.0595 YC 2797.880236 1 0.8953 4272 | 1/27 74 h-m-p 0.0000 0.0002 4690.6949 -YC 2797.879746 1 0.0000 4329 | 1/27 75 h-m-p 0.0313 0.6716 0.1729 +YC 2797.860630 1 0.2246 4387 | 1/27 76 h-m-p 0.0805 0.4023 0.1665 ++ 2797.852622 m 0.4023 4443 | 2/27 77 h-m-p 0.5524 8.0000 0.1213 YC 2797.843861 1 1.3036 4500 | 1/27 78 h-m-p 0.0000 0.0003 16128.4922 --C 2797.843859 0 0.0000 4557 | 2/27 79 h-m-p 0.1070 8.0000 0.0255 +++YC 2797.835556 1 5.0271 4617 | 1/27 80 h-m-p 0.0000 0.0002 44990.3612 --C 2797.835528 0 0.0000 4674 | 1/27 81 h-m-p 0.2504 1.3862 0.0311 ++ 2797.826914 m 1.3862 4730 | 2/27 82 h-m-p 0.2173 8.0000 0.1983 +YCC 2797.806478 2 1.3592 4790 | 1/27 83 h-m-p 0.0000 0.0013 11225.5783 --C 2797.806471 0 0.0000 4847 | 1/27 84 h-m-p 0.1000 1.0636 0.0504 ++ 2797.804362 m 1.0636 4903 | 2/27 85 h-m-p 1.6000 8.0000 0.0209 YC 2797.804139 1 1.0509 4960 | 1/27 86 h-m-p 0.0000 0.0001 239951.8075 -----Y 2797.804138 0 0.0000 5020 | 2/27 87 h-m-p 1.6000 8.0000 0.0003 C 2797.804133 0 1.3046 5076 | 1/27 88 h-m-p 0.0000 0.0000 178101.9614 -----Y 2797.804133 0 0.0000 5136 | 2/27 89 h-m-p 0.0819 8.0000 0.0003 ++C 2797.804133 0 1.1252 5194 | 1/27 90 h-m-p 0.0000 0.0000 5642872.3163 -----.. | 2/27 91 h-m-p 0.0008 0.4123 0.0133 -C 2797.804133 0 0.0001 5309 | 1/27 92 h-m-p 0.0000 0.0000 1763121.2091 .. | 2/27 93 h-m-p 0.0160 8.0000 0.0277 -----C 2797.804133 0 0.0000 5423 | 1/27 94 h-m-p 0.0000 0.0000 24741855.2634 ---.. | 2/27 95 h-m-p 0.0160 8.0000 0.0187 ----------Y 2797.804133 0 0.0000 5545 | 1/27 96 h-m-p 0.0000 0.0000 53073972975308.7422 h-m-p: 4.40183594e-15 2.20091797e-14 5.30739730e+13 2797.804133 .. | 2/27 97 h-m-p 0.0160 8.0000 0.0187 ------------- Out.. lnL = -2797.804133 5665 lfun, 22660 eigenQcodon, 356895 P(t) Time used: 5:43 Model 7: beta TREE # 1 (1, (2, 3), ((4, 5), ((((6, (7, 8)), 10), 9), (11, 12)))); MP score: 273 1 0.022577 2 0.004552 3 0.004117 4 0.004112 5 0.004112 6 0.004112 7 0.004112 8 0.004112 0.014001 0.011863 0.003261 0.003477 0.011172 0.000000 0.032502 0.019859 0.034336 0.008160 0.035369 0.017806 0.152608 0.030998 0.079303 0.039317 0.148097 0.119577 0.032277 0.049635 0.136355 2.571979 0.275304 1.140227 ntime & nrate & np: 21 1 24 Bounds (np=24): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 10.492471 np = 24 lnL0 = -2837.224376 Iterating by ming2 Initial: fx= 2837.224376 x= 0.01400 0.01186 0.00326 0.00348 0.01117 0.00000 0.03250 0.01986 0.03434 0.00816 0.03537 0.01781 0.15261 0.03100 0.07930 0.03932 0.14810 0.11958 0.03228 0.04964 0.13636 2.57198 0.27530 1.14023 1 h-m-p 0.0000 0.0000 451.0147 ++ 2837.223033 m 0.0000 53 | 1/24 2 h-m-p 0.0000 0.0001 269.3819 +YYCYCCC 2835.685302 6 0.0000 114 | 1/24 3 h-m-p 0.0000 0.0000 2263.3023 +YYCC 2834.291490 3 0.0000 169 | 1/24 4 h-m-p 0.0000 0.0001 1144.0392 +CYCCC 2828.799194 4 0.0001 227 | 1/24 5 h-m-p 0.0001 0.0003 401.6988 +YCCCC 2824.055496 4 0.0002 285 | 1/24 6 h-m-p 0.0000 0.0002 942.1461 YYC 2823.477742 2 0.0000 337 | 1/24 7 h-m-p 0.0000 0.0001 388.0032 CYCCC 2822.485826 4 0.0000 394 | 1/24 8 h-m-p 0.0002 0.0008 48.0221 YCC 2822.396380 2 0.0001 447 | 1/24 9 h-m-p 0.0001 0.0027 38.0015 CYC 2822.335881 2 0.0001 500 | 1/24 10 h-m-p 0.0001 0.0009 58.2856 YYC 2822.293240 2 0.0001 552 | 1/24 11 h-m-p 0.0002 0.0095 16.9846 CC 2822.262336 1 0.0003 604 | 1/24 12 h-m-p 0.0003 0.0162 18.1965 YC 2822.249801 1 0.0002 655 | 1/24 13 h-m-p 0.0001 0.0087 36.9138 +YC 2822.145247 1 0.0007 707 | 1/24 14 h-m-p 0.0002 0.0067 106.1019 +CCC 2821.615997 2 0.0012 762 | 1/24 15 h-m-p 0.0004 0.0034 304.8119 YCCC 2820.484256 3 0.0009 817 | 1/24 16 h-m-p 0.0002 0.0011 717.6987 CYCCC 2819.299750 4 0.0004 874 | 1/24 17 h-m-p 0.0003 0.0017 347.9516 YYC 2818.951531 2 0.0002 926 | 1/24 18 h-m-p 0.0011 0.0069 76.3242 CCC 2818.822179 2 0.0004 980 | 1/24 19 h-m-p 0.0031 0.0154 9.8941 CC 2818.786019 1 0.0009 1032 | 1/24 20 h-m-p 0.0005 0.0198 16.0878 YC 2818.715958 1 0.0009 1083 | 1/24 21 h-m-p 0.0010 0.0120 13.8959 CCC 2818.550668 2 0.0016 1137 | 1/24 22 h-m-p 0.0002 0.0035 123.7887 +YYCCCC 2817.831934 5 0.0007 1196 | 1/24 23 h-m-p 0.0013 0.0063 49.0490 CYCCC 2816.406798 4 0.0025 1254 | 1/24 24 h-m-p 0.0253 0.4791 4.7720 +YYCC 2813.826500 3 0.0785 1309 | 1/24 25 h-m-p 0.2311 1.4941 1.6207 YCCC 2806.924494 3 0.4084 1364 | 1/24 26 h-m-p 0.7451 3.7257 0.1026 CCCCC 2804.632693 4 0.8651 1422 | 1/24 27 h-m-p 0.6500 3.2498 0.0741 CYCCC 2803.908436 4 1.0201 1479 | 1/24 28 h-m-p 1.6000 8.0000 0.0305 YCC 2803.753715 2 0.8621 1532 | 1/24 29 h-m-p 1.1795 7.2878 0.0223 YCCC 2803.703939 3 0.5303 1587 | 1/24 30 h-m-p 0.4503 5.9414 0.0262 YCC 2803.644735 2 0.3300 1640 | 1/24 31 h-m-p 0.6990 8.0000 0.0124 YC 2803.579018 1 1.5518 1691 | 1/24 32 h-m-p 1.6000 8.0000 0.0032 YC 2803.571118 1 0.9424 1742 | 1/24 33 h-m-p 1.2204 8.0000 0.0025 YC 2803.570415 1 0.6256 1793 | 1/24 34 h-m-p 1.6000 8.0000 0.0006 Y 2803.570259 0 1.2655 1843 | 1/24 35 h-m-p 1.2930 8.0000 0.0006 +C 2803.570054 0 4.6360 1894 | 1/24 36 h-m-p 1.6000 8.0000 0.0005 C 2803.569968 0 1.7967 1944 | 1/24 37 h-m-p 1.1749 8.0000 0.0007 +C 2803.569811 0 5.2964 1995 | 1/24 38 h-m-p 1.6000 8.0000 0.0015 C 2803.569800 0 0.4424 2045 | 1/24 39 h-m-p 1.5051 8.0000 0.0004 Y 2803.569790 0 0.7143 2095 | 1/24 40 h-m-p 1.6000 8.0000 0.0001 C 2803.569782 0 1.5005 2145 | 1/24 41 h-m-p 1.4320 8.0000 0.0001 +Y 2803.569772 0 3.8956 2196 | 1/24 42 h-m-p 1.6000 8.0000 0.0002 Y 2803.569771 0 0.2956 2246 | 1/24 43 h-m-p 0.6477 8.0000 0.0001 Y 2803.569771 0 0.5022 2296 | 1/24 44 h-m-p 1.6000 8.0000 0.0000 Y 2803.569770 0 1.0205 2346 | 1/24 45 h-m-p 1.1882 8.0000 0.0000 ++ 2803.569761 m 8.0000 2396 | 1/24 46 h-m-p 1.6000 8.0000 0.0000 ++ 2803.569758 m 8.0000 2446 | 1/24 47 h-m-p 1.2126 8.0000 0.0001 -C 2803.569758 0 0.1136 2497 | 1/24 48 h-m-p 0.1359 8.0000 0.0001 Y 2803.569758 0 0.0707 2547 | 1/24 49 h-m-p 0.0749 8.0000 0.0001 -Y 2803.569758 0 0.0047 2598 | 1/24 50 h-m-p 0.0160 8.0000 0.0002 ---C 2803.569758 0 0.0001 2651 Out.. lnL = -2803.569758 2652 lfun, 29172 eigenQcodon, 556920 P(t) Time used: 9:56 Model 8: beta&w>1 TREE # 1 (1, (2, 3), ((4, 5), ((((6, (7, 8)), 10), 9), (11, 12)))); MP score: 273 1 0.083893 2 0.006031 3 0.004153 4 0.004113 5 0.004111 6 0.004110 7 0.004110 8 0.004110 9 0.004110 initial w for M8:NSbetaw>1 reset. 0.013891 0.011937 0.003252 0.003242 0.011183 0.000000 0.032504 0.019726 0.034368 0.008206 0.035351 0.017790 0.152782 0.031057 0.079422 0.039204 0.148105 0.119741 0.032120 0.049724 0.136412 2.505564 0.900000 1.017971 1.440735 2.095350 ntime & nrate & np: 21 2 26 Bounds (np=26): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 6.044697 np = 26 lnL0 = -2914.537412 Iterating by ming2 Initial: fx= 2914.537412 x= 0.01389 0.01194 0.00325 0.00324 0.01118 0.00000 0.03250 0.01973 0.03437 0.00821 0.03535 0.01779 0.15278 0.03106 0.07942 0.03920 0.14810 0.11974 0.03212 0.04972 0.13641 2.50556 0.90000 1.01797 1.44073 2.09535 1 h-m-p 0.0000 0.0000 526.0501 ++ 2914.535506 m 0.0000 57 | 1/26 2 h-m-p 0.0000 0.0000 476.7265 +YYCCCC 2912.924673 5 0.0000 121 | 1/26 3 h-m-p 0.0000 0.0000 1400.6837 +CCYC 2910.024219 3 0.0000 181 | 1/26 4 h-m-p 0.0000 0.0000 1215.1561 +YYYCCCC 2905.236822 6 0.0000 245 | 1/26 5 h-m-p 0.0000 0.0000 7613.5334 YCCCC 2902.213250 4 0.0000 306 | 1/26 6 h-m-p 0.0000 0.0002 341.8733 +YYCCC 2898.959922 4 0.0001 367 | 1/26 7 h-m-p 0.0000 0.0002 261.1769 CYCCC 2897.958022 4 0.0001 428 | 1/26 8 h-m-p 0.0001 0.0021 281.6083 ++YYC 2889.050138 2 0.0007 486 | 1/26 9 h-m-p 0.0001 0.0004 1331.5017 +YCYYYYC 2857.735043 6 0.0003 548 | 1/26 10 h-m-p 0.0000 0.0000 13495.7101 +YYCYCCC 2836.560793 6 0.0000 612 | 1/26 11 h-m-p 0.0000 0.0000 2070.1279 CCCC 2835.234895 3 0.0000 672 | 1/26 12 h-m-p 0.0002 0.0011 81.5867 YCC 2834.919431 2 0.0001 729 | 1/26 13 h-m-p 0.0003 0.0025 45.3633 CCC 2834.690521 2 0.0003 787 | 1/26 14 h-m-p 0.0002 0.0063 83.1311 +CC 2833.755318 1 0.0008 844 | 1/26 15 h-m-p 0.0003 0.0020 211.6323 CCCC 2832.331582 3 0.0005 904 | 1/26 16 h-m-p 0.0002 0.0011 614.5335 CYC 2830.824928 2 0.0002 961 | 1/26 17 h-m-p 0.0002 0.0008 430.2542 YCCCC 2829.281378 4 0.0003 1022 | 1/26 18 h-m-p 0.0008 0.0039 126.2697 CCCC 2827.341052 3 0.0013 1082 | 1/26 19 h-m-p 0.0003 0.0013 351.0303 CYC 2826.233868 2 0.0003 1139 | 1/26 20 h-m-p 0.0018 0.0090 60.0513 YCC 2825.774168 2 0.0008 1196 | 1/26 21 h-m-p 0.0006 0.0032 31.5852 CCC 2825.713342 2 0.0003 1254 | 1/26 22 h-m-p 0.0006 0.0238 13.0475 YC 2825.625750 1 0.0011 1309 | 1/26 23 h-m-p 0.0047 0.4864 3.1731 ++YCCCC 2821.019588 4 0.1383 1372 | 1/26 24 h-m-p 0.0034 0.0214 130.2577 YCCC 2812.791123 3 0.0061 1431 | 1/26 25 h-m-p 0.1638 0.8189 3.4233 YCYCCC 2806.713407 5 0.3661 1493 | 1/26 26 h-m-p 0.1220 0.6099 2.7897 YCCCC 2804.649341 4 0.2260 1554 | 1/26 27 h-m-p 0.1838 0.9188 1.3246 CCCC 2803.058208 3 0.2434 1614 | 1/26 28 h-m-p 0.3889 1.9445 0.4151 CCCC 2802.003124 3 0.6408 1674 | 1/26 29 h-m-p 0.7173 3.5866 0.2995 CCCC 2801.626197 3 0.8878 1734 | 1/26 30 h-m-p 1.6000 8.0000 0.0776 YCCC 2801.481288 3 0.7366 1793 | 1/26 31 h-m-p 1.4787 8.0000 0.0386 YC 2801.381277 1 0.9474 1848 | 1/26 32 h-m-p 0.3951 8.0000 0.0927 +YC 2801.304450 1 1.1211 1904 | 1/26 33 h-m-p 1.3315 8.0000 0.0780 CYC 2801.261022 2 1.1953 1961 | 1/26 34 h-m-p 1.1963 8.0000 0.0780 YC 2801.164600 1 2.5576 2016 | 1/26 35 h-m-p 1.0775 8.0000 0.1850 +YCCC 2800.951231 3 3.1347 2076 | 1/26 36 h-m-p 0.5416 2.7079 0.6553 YCYCYC 2800.570460 5 1.1005 2138 | 1/26 37 h-m-p 0.1344 0.6718 1.5772 YCCCCC 2800.387897 5 0.1768 2201 | 1/26 38 h-m-p 0.3369 1.6843 0.4211 CCCCC 2799.769562 4 0.4571 2263 | 1/26 39 h-m-p 0.4464 2.2318 0.4015 CCCC 2799.398473 3 0.5185 2323 | 1/26 40 h-m-p 0.7231 3.8987 0.2879 YCCCCC 2799.093004 5 1.0292 2386 | 1/26 41 h-m-p 1.1200 8.0000 0.2645 YCC 2798.845586 2 0.6379 2443 | 1/26 42 h-m-p 0.5455 5.4734 0.3093 YCYC 2798.500529 3 1.4667 2501 | 1/26 43 h-m-p 1.6000 8.0000 0.2290 CCC 2798.282193 2 1.3188 2559 | 1/26 44 h-m-p 0.3988 1.9941 0.5204 YYCCCC 2798.190035 5 0.4344 2621 | 1/26 45 h-m-p 1.3525 8.0000 0.1671 YC 2798.130466 1 0.6400 2676 | 1/26 46 h-m-p 0.4023 4.0377 0.2659 CYCCC 2798.070276 4 0.6094 2737 | 1/26 47 h-m-p 1.2310 8.0000 0.1316 YC 2797.962512 1 2.4579 2792 | 1/26 48 h-m-p 0.7599 3.7995 0.2738 YCCC 2797.939196 3 0.3964 2851 | 1/26 49 h-m-p 0.3171 7.4505 0.3422 CCC 2797.892226 2 0.4119 2909 | 1/26 50 h-m-p 1.5061 8.0000 0.0936 YYC 2797.859707 2 1.5061 2965 | 1/26 51 h-m-p 0.7632 8.0000 0.1847 YC 2797.812572 1 1.7814 3020 | 1/26 52 h-m-p 1.4103 7.0515 0.1666 YYYC 2797.789124 3 1.1686 3077 | 1/26 53 h-m-p 1.6000 8.0000 0.1078 -CC 2797.785800 1 0.1402 3134 | 1/26 54 h-m-p 0.0985 8.0000 0.1534 +YC 2797.779431 1 0.8815 3190 | 1/26 55 h-m-p 1.6000 8.0000 0.0737 YY 2797.776722 1 1.6000 3245 | 1/26 56 h-m-p 1.6000 8.0000 0.0180 YC 2797.775919 1 1.2262 3300 | 1/26 57 h-m-p 0.9137 8.0000 0.0241 CC 2797.775375 1 1.4120 3356 | 1/26 58 h-m-p 1.6000 8.0000 0.0042 C 2797.774983 0 1.9076 3410 | 1/26 59 h-m-p 1.6000 8.0000 0.0030 C 2797.774800 0 2.2563 3464 | 1/26 60 h-m-p 1.5722 8.0000 0.0044 C 2797.774737 0 2.0802 3518 | 1/26 61 h-m-p 1.6000 8.0000 0.0010 Y 2797.774670 0 3.4360 3572 | 1/26 62 h-m-p 1.6000 8.0000 0.0014 Y 2797.774665 0 0.8049 3626 | 1/26 63 h-m-p 1.1073 8.0000 0.0010 Y 2797.774663 0 0.6636 3680 | 1/26 64 h-m-p 0.7757 8.0000 0.0009 C 2797.774663 0 0.6756 3734 | 1/26 65 h-m-p 0.8662 8.0000 0.0007 +Y 2797.774662 0 2.2507 3789 | 1/26 66 h-m-p 1.6000 8.0000 0.0004 Y 2797.774661 0 3.7080 3843 | 1/26 67 h-m-p 1.3727 8.0000 0.0012 Y 2797.774660 0 0.9099 3897 | 1/26 68 h-m-p 1.6000 8.0000 0.0003 ++ 2797.774652 m 8.0000 3951 | 1/26 69 h-m-p 1.6000 8.0000 0.0016 ------Y 2797.774652 0 0.0001 4011 | 1/26 70 h-m-p 0.0160 8.0000 0.0306 +C 2797.774651 0 0.0646 4066 | 1/26 71 h-m-p 1.6000 8.0000 0.0001 +C 2797.774649 0 6.2421 4121 | 1/26 72 h-m-p 1.6000 8.0000 0.0003 -C 2797.774649 0 0.0903 4176 | 1/26 73 h-m-p 0.1263 8.0000 0.0002 ---------------.. | 1/26 74 h-m-p 0.0004 0.2011 0.2629 ---------- Out.. lnL = -2797.774649 4306 lfun, 51672 eigenQcodon, 994686 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2817.756081 S = -2678.652099 -131.328121 Calculating f(w|X), posterior probabilities of site classes. did 10 / 185 patterns 17:27 did 20 / 185 patterns 17:27 did 30 / 185 patterns 17:27 did 40 / 185 patterns 17:27 did 50 / 185 patterns 17:27 did 60 / 185 patterns 17:28 did 70 / 185 patterns 17:28 did 80 / 185 patterns 17:28 did 90 / 185 patterns 17:28 did 100 / 185 patterns 17:28 did 110 / 185 patterns 17:29 did 120 / 185 patterns 17:29 did 130 / 185 patterns 17:29 did 140 / 185 patterns 17:29 did 150 / 185 patterns 17:29 did 160 / 185 patterns 17:30 did 170 / 185 patterns 17:30 did 180 / 185 patterns 17:30 did 185 / 185 patterns 17:30 Time used: 17:30 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=99, Nseq=12, Len=392 D_melanogaster_Reph-PA METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- D_sechellia_Reph-PA METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- D_simulans_Reph-PA METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- D_yakuba_Reph-PA METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- D_erecta_Reph-PA METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- D_takahashii_Reph-PA METSVAGQKKISPEMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- D_biarmipes_Reph-PA METSVAGQKPIAPEMMCHQQTSS-CAHLMYDQHSSEEELEVINGPSSQ-- D_suzukii_Reph-PA METSVAGQKPIAPEMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- D_eugracilis_Reph-PA METSVAGQKPIAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- D_ficusphila_Reph-PA METSVAGQKATAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- D_rhopaloa_Reph-PA METSVAGQKPIAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- D_elegans_Reph-PA METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQGG ********* :. ********* ************************ D_melanogaster_Reph-PA AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL D_sechellia_Reph-PA AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL D_simulans_Reph-PA AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL D_yakuba_Reph-PA AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL D_erecta_Reph-PA AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL D_takahashii_Reph-PA AGQHPGGTAATGSTCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL D_biarmipes_Reph-PA AGQHSGGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL D_suzukii_Reph-PA AGQHPGGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL D_eugracilis_Reph-PA AGQHPGGPTATVSSCASRISNRVCTSSLDTEAPYEERATTSNSKRSSSTL D_ficusphila_Reph-PA AGQHPGGTAAAGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL D_rhopaloa_Reph-PA AGQHPGGTTATGSSCVSRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL D_elegans_Reph-PA HGQHPGGTTATGSSCVSRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL ***.* .:*: *:*.****** *************************** D_melanogaster_Reph-PA MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS D_sechellia_Reph-PA MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS D_simulans_Reph-PA MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS D_yakuba_Reph-PA MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS D_erecta_Reph-PA MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS D_takahashii_Reph-PA MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS D_biarmipes_Reph-PA MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS D_suzukii_Reph-PA MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS D_eugracilis_Reph-PA MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS D_ficusphila_Reph-PA MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS D_rhopaloa_Reph-PA MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS D_elegans_Reph-PA MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS ************************************************** D_melanogaster_Reph-PA TTPLILSEARCGIENIKLCDNSVNEENGDNGG----GGGAANSSKCAKIG D_sechellia_Reph-PA TTPLILSEARCGIENIKLCDNSVNEENGDNGG----GGGVANSSKCAKIG D_simulans_Reph-PA TTPLILSEARCGIENIKLCDNSVNEENGDNGG----GGGVANSSKCAKIG D_yakuba_Reph-PA TTPLILSEARCGIENIKLCDNSVNEENGDNGGGVGGGGGVANSSKCAKIG D_erecta_Reph-PA TTPLILSEARCGIENIKLCDNSVNEENGDNGGGVG-GGGVANSSKCAKIG D_takahashii_Reph-PA TTPLILSEARCGIENIKLCDNSVNEENGDNGG--------GGSSKCAKIG D_biarmipes_Reph-PA TTPLILSEARCGIENIKLCDNSVNEENGDNGGG---GGGGGNGGKCAKIG D_suzukii_Reph-PA TTPLILSEARCGIENIKLCDNSVNEENGDNGG-------GGNGSKCAKIG D_eugracilis_Reph-PA TTPLILSEARCGIENIKLCDNSVNEENGDNGGGGG-CGGVANSSKCAKIG D_ficusphila_Reph-PA TTPLILSEARCGIENIKLCDNSVNEENGDNGG--------GGGSKCAKIG D_rhopaloa_Reph-PA TTPLILSEARCGIENIKLCDNSVNEENGDNGGG----GVAANSSKCAKIG D_elegans_Reph-PA TTPLILSEARCGIENIKLCDNSVNEENGDNGG------VAANSSKCAKIG ******************************** ....****** D_melanogaster_Reph-PA ALAGNASGTVAATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP D_sechellia_Reph-PA --AGNASGTGTATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP D_simulans_Reph-PA --AGNASGTGTATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP D_yakuba_Reph-PA --EGNASGTGVATGNGNGNGGNENEP--SVIKACSSSLKMSNSSHHIYQP D_erecta_Reph-PA --AGIASGTGAATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP D_takahashii_Reph-PA --------GGTITGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP D_biarmipes_Reph-PA --------AATGTGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP D_suzukii_Reph-PA --------VAGATGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP D_eugracilis_Reph-PA -----AGNNASGTGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP D_ficusphila_Reph-PA SAGAAGGATGAAGATGNG--GNENEP--SAIKACSSSLKMSNSSHHIYQP D_rhopaloa_Reph-PA --AGNTIGTGTGTGNGNG--ANENEPSASVIKACSSSLKMSNSSHHIYQP D_elegans_Reph-PA --AAN---AGGATSGGN---ENEPNASASVIKACSSSLKMSNSSHHIYQP . ** ** :. *.******************** D_melanogaster_Reph-PA QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS D_sechellia_Reph-PA QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS D_simulans_Reph-PA QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS D_yakuba_Reph-PA QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS D_erecta_Reph-PA QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAG D_takahashii_Reph-PA QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAT D_biarmipes_Reph-PA QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSSNAT D_suzukii_Reph-PA QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAT D_eugracilis_Reph-PA QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS D_ficusphila_Reph-PA QPKYSFPYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAG D_rhopaloa_Reph-PA QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS D_elegans_Reph-PA QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS ****** ***************************************.** D_melanogaster_Reph-PA G-AAGGATTISPSSASSS---SGTTTTHNAAN------SAGNAANVTAVA D_sechellia_Reph-PA G-AAGGATTISPSSASSS---SATTTTHNAAN------SAGNAANVTAVA D_simulans_Reph-PA G-AAGGATTISPSSASSS---SATTTTHNAAN------SAGNAANVTAVA D_yakuba_Reph-PA G------TAISPSSATSSSAATATTTTHNAANSN----SAGNAANVTAVA D_erecta_Reph-PA GGNAGGATTISPSSASSS---SATTTTHNAANSN----SAGNAANVTAVA D_takahashii_Reph-PA TISPPSSAATSSATTTTT---QNAANSAGSAGN------PGNAANVTAVA D_biarmipes_Reph-PA TTSPPSSASASASASAAA---TATTTTHNAAN-------------VTAVA D_suzukii_Reph-PA TISPPSSASASASASASA---ASTTTTHNAANS------AGNAANVTAVA D_eugracilis_Reph-PA G-SAASATTISPSSSSAA--AVSATTTHNSAN------SAGNAANVTAVA D_ficusphila_Reph-PA G----PPATISP-----------SSTTHNAANS------AGNAANVTAAA D_rhopaloa_Reph-PA GQPGGGATTISPSSSS----SSATTTTHNAANS------AGNAANVTAAA D_elegans_Reph-PA G-PSVGATTISPSSSSSLASSSATTTTHNAANSGGNAVNAGNAANVTAAA :: *. ::.: .:*. ***.* D_melanogaster_Reph-PA TQRLQRPHRPCLDFDKMQQVSLoooooo-------------- D_sechellia_Reph-PA TQRLQRPHRPCLDFDKMQQVSLoooooooo------------ D_simulans_Reph-PA TQRLQRPHRPCLDFDKMQQVSLoooooooo------------ D_yakuba_Reph-PA TQRLQRPHRPCLDFDKMQQVSLoo------------------ D_erecta_Reph-PA TQRLQRPHRPCLDFDKMQQVSLoo------------------ D_takahashii_Reph-PA TQRLQRPHRPCLDFDKMQQVSLoooooooooooooooo---- D_biarmipes_Reph-PA TQRLQRPHRPCLDFDKMQQVSLooooooooooooooooooo- D_suzukii_Reph-PA TQRLQRPHRPCLDFDKMQQVSLooooooooooooooo----- D_eugracilis_Reph-PA TQRLQRPHRPCLDFDKMQQVSLoooooo-------------- D_ficusphila_Reph-PA TQRLQRPHRPCLDFDKMQQVSLoooooooooooooooooooo D_rhopaloa_Reph-PA TQRLQRPHRPCLDFDKMQQVSLooooo--------------- D_elegans_Reph-PA TQRLQRPHRPCLDFDKMQQVSL-------------------- **********************
>D_melanogaster_Reph-PA ATGGAAACTAGTGTTGCTGGCCAAAAACCAATAGCTTCTGCAATGATGTG TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA GTTCCGAGGAGGAGTTGGAGGTGATCAACGGGCCGTCCTCGCAG------ GCGGGTCAGCATCCCGGA---ACGGCGGCCACGGGCTCATCGTGTGCCTC CCGGATCTCGAATCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGTTCTAGCTCCACGCTG ATGGTGGAGAACCGCAAGCGATCGCTGGCCCACAGCTCCGACGATGAGTT GCGCAACTCGCTGGAGCCGATATTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGTGACAACGGCGGT---- --------GGCGGTGGCGCGGCCAATAGCAGTAAGTGCGCCAAGATTGGC GCACTGGCAGGGAATGCCAGCGGAACTGTGGCCGCAACCGGAAACGGAAA CGGC------GGCAACGAGAATGAGCCG------AGTGTGATCAAGGCGT GCAGCAGCTCGCTAAAGATGAGCAACAGCAGCCACCACATTTACCAGCCG CAGCCGAAATATAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACTGGCCTGGATATGGAGGTGCGTTCGGTCAGTCCGCCGGCGAAAC TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCAGT GGT---GCAGCCGGGGGCGCCACAACAATATCACCATCGTCAGCATCATC ATCA---------TCAGGCACAACAACGACACACAATGCTGCCAAT---- --------------TCCGCCGGAAATGCCGCTAACGTCACCGCCGTCGCC ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >D_sechellia_Reph-PA ATGGAAACTAGTGTTGCTGGCCAAAAACCAATAGCTTCTGCAATGATGTG TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA GTTCCGAGGAGGAGTTGGAGGTGATCAACGGGCCGTCCTCGCAG------ GCGGGTCAGCATCCCGGA---ACGGCGGCCACAGGCTCATCGTGCGCCTC CCGGATCTCGAATCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGTTCTAGCTCCACGTTG ATGGTGGAGAACCGCAAGCGATCGCTGGCCCACAGCTCCGACGATGAGTT GCGCAACTCGCTGGAGCCGATATTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGTGACAACGGTGGT---- --------GGCGGTGGCGTGGCCAATAGCAGTAAGTGCGCCAAGATTGGT ------GCAGGTAATGCCAGCGGAACTGGGACCGCAACCGGAAACGGAAA CGGC------GGCAACGAGAATGAGCCG------AGTGTGATCAAGGCGT GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATTTACCAGCCG CAGCCGAAGTATAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACTGGCCTGGATATGGAGGTGCGTTCGGTCAGTCCGCCGGCGAAAC TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCAGT GGT---GCAGCCGGGGGCGCCACAACAATATCACCATCGTCAGCATCATC ATCG---------TCAGCCACAACAACGACACACAATGCTGCCAAT---- --------------TCCGCCGGAAATGCCGCTAACGTCACCGCCGTCGCC ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >D_simulans_Reph-PA ATGGAAACTAGTGTTGCTGGCCAAAAACCAATAGCTTCTGCAATGATGTG TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA GTTCCGAGGAGGAGTTGGAGGTGATCAACGGGCCGTCCTCGCAG------ GCGGGTCAGCATCCCGGA---ACGGCGGCCACAGGCTCATCGTGCGCCTC CCGGATCTCGAATCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGTTCTAGCTCCACGTTG ATGGTGGAGAACCGCAAGCGATCGCTGGCCCACAGCTCCGACGATGAGTT GCGCAACTCGCTGGAGCCGATATTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGTGACAACGGCGGT---- --------GGCGGTGGCGTGGCCAATAGCAGTAAGTGCGCCAAGATTGGT ------GCAGGTAATGCCAGCGGAACTGGGACCGCAACCGGAAACGGAAA CGGC------GGCAACGAGAATGAGCCG------AGTGTGATCAAGGCGT GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATTTACCAGCCG CAGCCGAAGTATAGTTTTCACTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACTGGCCTGGATATGGAGGTGCGTTCGGTCAGTCCGCCGGCGAAAC TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCAGT GGT---GCAGCCGGGGGCGCCACAACAATATCACCATCGTCAGCATCATC ATCA---------TCAGCCACAACAACGACACACAATGCTGCCAAT---- --------------TCCGCCGGAAATGCCGCTAACGTCACCGCCGTCGCC ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >D_yakuba_Reph-PA ATGGAAACTAGTGTTGCTGGCCAAAAACCAATAGCTTCTGCAATGATGTG TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA GTTCCGAGGAGGAGTTGGAGGTGATCAATGGGCCGTCCTCGCAG------ GCGGGTCAGCATCCCGGT---ACGGCGGCCACGGGCTCATCGTGTGCCTC CCGGATCTCGAATCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGTTCCAGCTCCACGCTG ATGGTGGAGAATCGCAAGCGATCGCTGGCCCACAGCTCCGACGATGAGTT GCGCAACTCGCTGGAGCCGATATTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGTGACAACGGCGGTGGCG TCGGAGGCGGCGGCGGCGTGGCCAATAGCAGTAAGTGCGCCAAGATTGGT ------GAAGGGAATGCCAGCGGAACGGGAGTGGCAACCGGCAACGGAAA CGGAAACGGTGGCAACGAGAATGAACCA------AGTGTGATCAAGGCGT GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATTTACCAGCCG CAGCCGAAGTATAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACTGGCCTGGATATGGAGGTGCGTTCGGTTAGTCCGCCGGCGAAAC TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCAGT GGT------------------ACAGCAATATCACCATCGTCAGCAACATC ATCATCAGCCGCCACAGCAACAACAACGACACACAATGCTGCCAATTCGA AT------------TCCGCCGGAAATGCCGCCAATGTCACCGCCGTCGCC ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >D_erecta_Reph-PA ATGGAAACTAGTGTTGCTGGCCAAAAACCAATAGCTTCTGCAATGATGTG TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA GTTCCGAGGAGGAGTTGGAGGTGATCAACGGGCCGTCCTCGCAG------ GCGGGTCAGCATCCTGGA---ACGGCGGCCACGGGCTCATCGTGTGCCTC CCGGATCTCGAATCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCGT ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGTTCCAGCTCCACGCTG ATGGTGGAGAATCGCAAGCGATCGCTGGCCCACAGCTCCGACGATGAGTT GCGCAACTCGCTGGAGCCGATATTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGTGACAACGGCGGTGGCG TCGGC---GGCGGCGGCGTGGCCAATAGCAGTAAGTGCGCCAAGATTGGC ------GCAGGGATTGCCAGCGGAACCGGAGCCGCAACCGGAAACGGAAA CGGT------GGCAACGAGAACGAGCCG------AGTGTGATCAAGGCGT GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATCTACCAGCCG CAGCCGAAGTATAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACTGGCCTGGATATGGAGGTGCGTTCGGTCAGTCCGCCGGCGAAAC TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCGGT GGTGGCAATGCCGGTGGCGCCACAACAATATCACCATCGTCAGCATCATC ATCA---------TCAGCCACAACAACGACACACAATGCTGCCAATTCCA AT------------TCCGCCGGAAATGCCGCCAATGTCACCGCCGTCGCC ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >D_takahashii_Reph-PA ATGGAAACTAGTGTTGCTGGCCAAAAGAAAATCTCTCCTGAAATGATGTG TCACCAGCAGACGTCGTCATCCTGTGCCCATCTCATGTACGACCAGCACA GTTCCGAGGAGGAGTTGGAGGTGATCAACGGCCCCTCCTCGCAG------ GCGGGCCAGCATCCCGGTGGAACGGCGGCCACAGGCTCCACGTGCGCCTC CCGAATCTCGAACCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACCACCTCGAACTCGAAGCGTTCCAGCTCCACGCTG ATGGTGGAGAACCGCAAGCGATCGCTGGCCCACAGCTCCGACGATGAGTT GCGCAACTCGCTGGAGCCGATCTTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGCGACAACGGCGGT---- --------------------GGCGGTAGCAGTAAGTGTGCTAAGATTGGA ------------------------GGCGGAACCATAACCGGAACCGGAAA CGGT------GGCAATGAGAACGAACCG------AGTGTGATCAAGGCGT GCAGCAGCTCGCTGAAGATGAGCAATAGCAGCCATCACATCTACCAGCCG CAGCCAAAGTATAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACCGGCTTGGACATGGAGGTGCGATCGGTGAGTCCGCCGGCGAAAC TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGCAACAATGCCACC ACAATATCACCACCATCATCAGCAGCCACATCATCAGCCACCACGACAAC GACA---------CAAAATGCTGCCAATTCCGCCGGAAGTGCCGGGAAT- -----------------CCGGGAAATGCCGCCAACGTCACCGCCGTCGCC ACACAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGCCTC---------------------------------- -------------------------- >D_biarmipes_Reph-PA ATGGAAACTAGTGTTGCTGGCCAAAAACCAATCGCTCCTGAAATGATGTG TCACCAGCAGACGTCCTCC---TGTGCCCATCTCATGTACGACCAGCACA GCTCCGAGGAGGAGCTGGAGGTGATCAACGGGCCGTCCTCGCAG------ GCGGGTCAGCACTCCGGCGGAACGGCGGCCACGGGCTCCTCGTGCGCCTC CCGAATCTCGAACCGCGGGTGCACTTCCTCGCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGCTCCAGCTCCACGCTG ATGGTGGAGAACCGCAAGCGGTCGCTGGCCCACAGCTCCGACGACGAGTT GCGCAACTCGCTGGAGCCGATCTTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCGTTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAACGGCGACAACGGCGGTGGC- --------GGTGGCGGCGGCGGCAACGGCGGCAAGTGTGCCAAGATTGGC ------------------------GCGGCCACCGGAACGGGAACCGGAAA CGGC------GGCAACGAGAACGAGCCG------AGTGTGATCAAGGCGT GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATCTACCAGCCG CAGCCGAAGTACAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACCGGACTGGACATGGAGGTGCGCTCGGTCAGTCCGCCGGCGAAAC TGTTCCACTGCGCCATCTCGCCCAGGCGGCGACCCAGCAGCAATGCCACC ACCACGTCGCCACCATCATCCGCATCCGCATCCGCATCTGCGTCAGCCGC CGCA---------ACAGCAACAACAACGACACACAACGCTGCCAAC---- -----------------------------------GTCACCGCCGTCGCC ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >D_suzukii_Reph-PA ATGGAAACTAGTGTTGCTGGCCAAAAACCAATCGCTCCTGAAATGATGTG TCACCAGCAGACGTCGTCATCCTGTGCCCATCTCATGTACGACCAGCACA GTTCCGAGGAGGAGTTGGAGGTGATCAATGGGCCGTCCTCGCAG------ GCGGGTCAGCATCCCGGCGGAACAGCGGCCACGGGCTCCTCGTGCGCCTC CCGGATCTCGAACCGCGGATGCACTTCCTCGCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGCTCCAGCTCCACGCTG ATGGTGGAGAACCGCAAGCGATCGCTGGCCCACAGCTCCGACGACGAGTT GCGCAACTCGCTGGAGCCGATCTTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGCGACAACGGCGGT---- -----------------GGCGGCAACGGCAGCAAGTGTGCCAAGATTGGT ------------------------GTGGCAGGCGCCACCGGAACCGGAAA CGGT------GGCAACGAGAACGAACCG------AGTGTGATCAAGGCGT GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCATCACATCTACCAGCCG CAGCCAAAGTACAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACCGGACTGGACATGGAGGTGCGATCGGTCAGTCCGCCGGCGAAAC TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGCAACAATGCCACA ACAATATCACCACCATCATCCGCATCTGCATCTGCATCTGCATCTGCATC AGCC---------GCCTCAACAACAACGACACACAATGCTGCCAATTCC- -----------------GCCGGAAATGCGGCCAACGTCACCGCCGTCGCC ACCCAGAGACTGCAGCGACCGCACCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >D_eugracilis_Reph-PA ATGGAAACTAGTGTTGCTGGCCAAAAACCAATCGCTCCTGCAATGATGTG TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA GTTCCGAAGAGGAGTTGGAGGTGATCAACGGGCCGTCCTCTCAG------ GCTGGTCAGCATCCCGGCGGACCGACGGCCACGGTCTCCTCGTGTGCCTC CCGGATCTCGAATCGCGTATGCACCTCCTCGCTGGACACGGAGGCGCCGT ACGAGGAGCGAGCCACCACTTCCAACTCGAAGCGTTCAAGCTCTACGCTG ATGGTGGAGAATCGCAAGCGATCGTTGGCCCATAGCTCCGATGATGAGTT GCGCAACTCATTGGAGCCGATCCTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGCGACAACGGCGGTGGCG GTGGC---TGTGGCGGGGTGGCCAATAGCAGCAAGTGTGCTAAGATTGGT ---------------GCGGGAAACAACGCCAGCGGTACCGGAACCGGAAA CGGA------GGCAACGAGAACGAGCCG------AGTGTGATTAAGGCGT GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATTTACCAGCCG CAGCCGAAGTATAGTTTTCATTACAACAGTTCGCGGAGCAGTCCGGCCAG CACCACCGGCTTGGACATGGAGGTGCGGTCGGTCAGTCCGCCGGCGAAAC TGTTCCACTGCGCCATATCGCCCCGGCGGCGACCCAGTAACAATGCCAGT GGT---TCAGCCGCGAGCGCCACAACAATATCACCATCATCATCATCAGC AGCA------GCAGTCTCAGCAACAACGACACACAATTCTGCCAAC---- --------------TCCGCCGGAAATGCCGCTAACGTCACCGCCGTCGCT ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >D_ficusphila_Reph-PA ATGGAAACTAGTGTTGCTGGCCAAAAAGCAACCGCTCCTGCAATGATGTG TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA GTTCCGAGGAGGAGTTGGAGGTGATCAACGGGCCGTCCTCGCAG------ GCGGGCCAGCATCCCGGCGGAACGGCGGCCGCGGGCTCCTCGTGCGCCTC GAGGATCTCGAACCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACAACCTCCAACTCGAAGCGGTCCAGCTCCACGCTG ATGGTGGAGAACCGCAAGCGGTCGCTGGCCCACAGCTCCGACGATGAGCT GCGCAACTCGCTGGAGCCCATTTTGACGCCCGTGAATTTCCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTGTCGGAGGCCCGCTGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGCGACAACGGCGGC---- --------------------GGCGGCGGCAGCAAGTGTGCTAAGATCGGA TCGGCAGGAGCAGCTGGCGGAGCAACTGGGGCAGCTGGGGCAACCGGAAA TGGC------GGCAACGAGAACGAGCCG------AGTGCAATCAAGGCGT GCAGCAGCTCGCTGAAGATGAGCAACAGCAGCCACCACATCTACCAGCCG CAGCCGAAGTACAGCTTCCCGTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACCGGGCTGGACATGGAGGTGCGGTCGGTCAGTCCGCCGGCGAAGC TGTTCCACTGCGCCATATCGCCCCGGCGGCGACCCAGCAACAATGCCGGC GGT------------CCGCCCGCAACAATATCGCCA-------------- -------------------TCGTCAACGACACACAACGCTGCCAACTCC- -----------------GCCGGAAATGCCGCCAACGTCACCGCCGCCGCC ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >D_rhopaloa_Reph-PA ATGGAAACTAGTGTTGCTGGCCAGAAACCAATCGCTCCTGCAATGATGTG TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA GTTCCGAGGAGGAGCTGGAGGTGATCAACGGGCCGTCCTCGCAG------ GCTGGTCAGCATCCCGGCGGAACGACGGCCACGGGCTCTTCGTGCGTCTC CCGGATTTCGAATCGCGGATGCACTTCCTCTCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACCACATCCAACTCGAAGCGCTCCAGCTCCACGCTG ATGGTGGAGAATCGCAAGCGATCGCTGGCTCACAGCTCCGACGATGAGTT GCGCAACTCGCTGGAGCCAATATTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGCGACAACGGCGGCGGT- -----------GGCGTGGCAGCCAATAGCAGTAAGTGTGCTAAGATTGGT ------GCAGGAAACACCATCGGAACGGGAACCGGAACCGGAAATGGCAA CGGT------GCCAATGAGAACGAGCCGAGCGCGAGTGTGATCAAGGCGT GCAGCAGCTCGCTAAAGATGAGCAACAGCAGCCACCACATTTACCAGCCG CAGCCGAAGTATAGTTTCCACTACAACAGCTCGCGGAGCAGTCCGGCCAG CACCACCGGCTTGGATATGGAGGTGCGATCGGTCAGTCCGCCGGCGAAAT TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCAGT GGTCAACCCGGCGGGGGCGCCACAACAATATCACCGTCATCGTCATCA-- ----------TCATCAGCCACAACAACGACACACAATGCTGCCAATTCC- -----------------GCCGGAAATGCCGCCAACGTCACCGCCGCCGCC ACCCAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGTCTC---------------------------------- -------------------------- >D_elegans_Reph-PA ATGGAAACTAGTGTTGCTGGCCAAAAACCAATAGCTTCTGCAATGATGTG TCACCAGCAGACGTCGTCATCCTGCGCCCATCTCATGTACGACCAGCACA GTTCGGAGGAGGAGCTGGAGGTGATCAATGGCCCGTCCTCGCAGGGTGGG CATGGTCAGCATCCCGGCGGAACGACGGCCACGGGCTCCTCGTGTGTCTC CCGGATCTCGAATCGCGGATGCACCTCCTCGCTGGACACGGAGGCGCCCT ACGAGGAGCGGGCCACCACCTCCAACTCGAAGCGGTCCAGCTCCACGCTG ATGGTGGAGAATCGCAAGCGTTCGCTGGCCCACAGCTCCGACGATGAGTT GCGCAACTCGCTGGAGCCAATATTGACGCCCGTGAATTTTCGCACATCGC CGCCATTGGAGGCATTCAAGCCAAATCGTAGCCATATGATGTTCCGCTCC ACAACGCCACTGATATTATCGGAGGCCCGATGTGGCATCGAAAATATTAA ATTATGTGATAATAGTGTAAACGAGGAGAATGGCGACAACGGTGGC---- --------------GTGGCGGCCAATAGCAGTAAGTGTGCTAAGATTGGT ------GCGGCCAAT---------GCTGGTGGTGCAACCAGTGGTGGCAA T---------GAAAATGAGCCCAACGCGAGCGCGAGTGTGATTAAGGCGT GCAGTAGCTCGCTAAAGATGAGCAACAGTAGCCATCACATATACCAGCCG CAGCCCAAATACAGTTTCCACTACAATAGCTCGCGCAGCAGTCCGGCCAG CACCACCGGTTTGGATATGGAGGTGAGATCGGTGAGTCCGCCGGCGAAAT TGTTCCACTGCGCCATATCGCCCAGGCGGCGACCCAGTAACAATGCCAGC GGT---CCATCCGTGGGCGCCACAACAATATCACCATCATCATCATCATC ATTGGCATCATCGTCAGCCACAACAACGACACACAATGCTGCCAATTCCG GGGGAAATGCCGTAAATGCCGGAAATGCCGCCAACGTCACCGCCGCCGCC ACACAGAGACTGCAGCGACCGCATCGGCCGTGTTTAGATTTTGATAAGAT GCAGCAGGTTAGCCTC---------------------------------- --------------------------
>D_melanogaster_Reph-PA METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG----GGGAANSSKCAKIG ALAGNASGTVAATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS G-AAGGATTISPSSASSS---SGTTTTHNAAN------SAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSL >D_sechellia_Reph-PA METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG----GGGVANSSKCAKIG --AGNASGTGTATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS G-AAGGATTISPSSASSS---SATTTTHNAAN------SAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSL >D_simulans_Reph-PA METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG----GGGVANSSKCAKIG --AGNASGTGTATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS G-AAGGATTISPSSASSS---SATTTTHNAAN------SAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSL >D_yakuba_Reph-PA METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGGVGGGGGVANSSKCAKIG --EGNASGTGVATGNGNGNGGNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS G------TAISPSSATSSSAATATTTTHNAANSN----SAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSL >D_erecta_Reph-PA METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPG-TAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGGVG-GGGVANSSKCAKIG --AGIASGTGAATGNGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAG GGNAGGATTISPSSASSS---SATTTTHNAANSN----SAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSL >D_takahashii_Reph-PA METSVAGQKKISPEMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPGGTAATGSTCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG--------GGSSKCAKIG --------GGTITGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAT TISPPSSAATSSATTTTT---QNAANSAGSAGN------PGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSL >D_biarmipes_Reph-PA METSVAGQKPIAPEMMCHQQTSS-CAHLMYDQHSSEEELEVINGPSSQ-- AGQHSGGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGG---GGGGGNGGKCAKIG --------AATGTGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSSNAT TTSPPSSASASASASAAA---TATTTTHNAAN-------------VTAVA TQRLQRPHRPCLDFDKMQQVSL >D_suzukii_Reph-PA METSVAGQKPIAPEMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPGGTAATGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG-------GGNGSKCAKIG --------VAGATGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAT TISPPSSASASASASASA---ASTTTTHNAANS------AGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSL >D_eugracilis_Reph-PA METSVAGQKPIAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPGGPTATVSSCASRISNRVCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGGGG-CGGVANSSKCAKIG -----AGNNASGTGTGNG--GNENEP--SVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS G-SAASATTISPSSSSAA--AVSATTTHNSAN------SAGNAANVTAVA TQRLQRPHRPCLDFDKMQQVSL >D_ficusphila_Reph-PA METSVAGQKATAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPGGTAAAGSSCASRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG--------GGGSKCAKIG SAGAAGGATGAAGATGNG--GNENEP--SAIKACSSSLKMSNSSHHIYQP QPKYSFPYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAG G----PPATISP-----------SSTTHNAANS------AGNAANVTAAA TQRLQRPHRPCLDFDKMQQVSL >D_rhopaloa_Reph-PA METSVAGQKPIAPAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQ-- AGQHPGGTTATGSSCVSRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGGG----GVAANSSKCAKIG --AGNTIGTGTGTGNGNG--ANENEPSASVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS GQPGGGATTISPSSSS----SSATTTTHNAANS------AGNAANVTAAA TQRLQRPHRPCLDFDKMQQVSL >D_elegans_Reph-PA METSVAGQKPIASAMMCHQQTSSSCAHLMYDQHSSEEELEVINGPSSQGG HGQHPGGTTATGSSCVSRISNRGCTSSLDTEAPYEERATTSNSKRSSSTL MVENRKRSLAHSSDDELRNSLEPILTPVNFRTSPPLEAFKPNRSHMMFRS TTPLILSEARCGIENIKLCDNSVNEENGDNGG------VAANSSKCAKIG --AAN---AGGATSGGN---ENEPNASASVIKACSSSLKMSNSSHHIYQP QPKYSFHYNSSRSSPASTTGLDMEVRSVSPPAKLFHCAISPRRRPSNNAS G-PSVGATTISPSSSSSLASSSATTTTHNAANSGGNAVNAGNAANVTAAA TQRLQRPHRPCLDFDKMQQVSL
#NEXUS [ID: 4893734343] begin taxa; dimensions ntax=12; taxlabels D_melanogaster_Reph-PA D_sechellia_Reph-PA D_simulans_Reph-PA D_yakuba_Reph-PA D_erecta_Reph-PA D_takahashii_Reph-PA D_biarmipes_Reph-PA D_suzukii_Reph-PA D_eugracilis_Reph-PA D_ficusphila_Reph-PA D_rhopaloa_Reph-PA D_elegans_Reph-PA ; end; begin trees; translate 1 D_melanogaster_Reph-PA, 2 D_sechellia_Reph-PA, 3 D_simulans_Reph-PA, 4 D_yakuba_Reph-PA, 5 D_erecta_Reph-PA, 6 D_takahashii_Reph-PA, 7 D_biarmipes_Reph-PA, 8 D_suzukii_Reph-PA, 9 D_eugracilis_Reph-PA, 10 D_ficusphila_Reph-PA, 11 D_rhopaloa_Reph-PA, 12 D_elegans_Reph-PA ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.008537973,(2:0.003254992,3:0.00200627)1.000:0.007117596,((4:0.02465409,5:0.01482446)0.550:0.003910862,((((6:0.1431303,(7:0.0578448,8:0.02376542)0.954:0.02173499)0.999:0.0379303,10:0.1244745)0.999:0.0406658,9:0.08351836)0.804:0.01625733,(11:0.02994167,12:0.0906972)1.000:0.03040041)1.000:0.02720273)0.998:0.00955537); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.008537973,(2:0.003254992,3:0.00200627):0.007117596,((4:0.02465409,5:0.01482446):0.003910862,((((6:0.1431303,(7:0.0578448,8:0.02376542):0.02173499):0.0379303,10:0.1244745):0.0406658,9:0.08351836):0.01625733,(11:0.02994167,12:0.0906972):0.03040041):0.02720273):0.00955537); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3791.39 -3806.54 2 -3791.75 -3806.00 -------------------------------------- TOTAL -3791.55 -3806.31 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/367/Reph-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.818261 0.005606 0.682099 0.973720 0.814690 1156.42 1264.12 1.000 r(A<->C){all} 0.112024 0.000315 0.078845 0.148238 0.111219 974.19 1082.30 1.001 r(A<->G){all} 0.194985 0.000641 0.147241 0.245500 0.194076 880.32 947.91 1.000 r(A<->T){all} 0.087840 0.000487 0.047650 0.130732 0.087114 1014.47 1023.26 1.001 r(C<->G){all} 0.074378 0.000209 0.047224 0.103341 0.073563 1009.64 1113.78 1.000 r(C<->T){all} 0.419273 0.001338 0.351006 0.494734 0.418343 792.34 969.14 1.000 r(G<->T){all} 0.111498 0.000526 0.067259 0.155817 0.109902 962.29 969.03 1.000 pi(A){all} 0.237498 0.000134 0.216282 0.261418 0.237468 881.48 1029.53 1.000 pi(C){all} 0.303736 0.000155 0.279112 0.327142 0.303797 694.05 765.33 1.000 pi(G){all} 0.290525 0.000161 0.265042 0.313314 0.290546 1017.49 1023.65 1.000 pi(T){all} 0.168241 0.000100 0.148884 0.187509 0.168005 961.69 1096.85 1.000 alpha{1,2} 0.259575 0.002964 0.158873 0.362656 0.253171 929.54 1049.12 1.000 alpha{3} 1.656767 0.372235 0.687642 2.916412 1.551977 1214.23 1241.71 1.000 pinvar{all} 0.415405 0.004302 0.285353 0.533822 0.423057 949.05 1005.51 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/367/Reph-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 12 ls = 317 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 2 2 3 2 2 2 | Ser TCT 2 2 2 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 5 4 4 5 5 6 TTC 4 4 3 4 4 4 | TCC 8 8 8 9 9 10 | TAC 4 4 4 4 4 4 | TGC 5 6 6 5 5 4 Leu TTA 3 3 3 3 3 3 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 4 5 5 4 4 5 | TCG 14 14 14 14 14 14 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 1 1 | His CAT 4 4 4 4 4 5 | Arg CGT 3 3 3 3 3 2 CTC 2 2 2 2 2 2 | CCC 5 5 5 5 3 6 | CAC 8 8 8 8 8 6 | CGC 5 5 5 5 5 5 CTA 1 0 0 0 0 0 | CCA 5 5 5 6 5 4 | Gln CAA 1 1 1 1 1 1 | CGA 4 4 4 4 4 6 CTG 8 8 8 9 9 8 | CCG 11 11 11 10 12 9 | CAG 11 11 11 11 11 11 | CGG 5 5 5 5 5 4 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 3 3 3 3 2 2 | Thr ACT 3 3 3 2 2 1 | Asn AAT 11 11 11 13 11 9 | Ser AGT 11 11 11 11 10 9 ATC 4 4 4 4 5 7 | ACC 7 8 8 7 8 10 | AAC 12 12 12 10 12 11 | AGC 12 12 12 12 12 14 ATA 5 5 5 5 5 3 | ACA 7 8 8 6 7 6 | Lys AAA 4 3 3 3 3 3 | Arg AGA 1 1 1 1 1 1 Met ATG 10 10 10 10 10 10 | ACG 8 7 7 9 8 7 | AAG 8 9 9 9 9 10 | AGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 2 2 2 3 2 2 | Ala GCT 3 3 3 3 3 3 | Asp GAT 5 5 5 5 5 4 | Gly GGT 4 6 5 6 5 3 GTC 3 3 3 2 3 2 | GCC 15 14 14 14 15 15 | GAC 4 4 4 4 4 5 | GGC 7 5 6 7 7 11 GTA 1 1 1 1 1 1 | GCA 3 3 3 4 3 2 | Glu GAA 2 2 2 3 2 4 | GGA 4 4 4 3 5 6 GTG 6 5 5 6 5 6 | GCG 5 5 5 5 5 5 | GAG 17 17 17 16 17 16 | GGG 1 2 2 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 2 2 3 1 2 2 | Ser TCT 0 2 3 0 2 1 | Tyr TAT 0 0 1 0 1 0 | Cys TGT 6 6 6 5 5 6 TTC 4 4 3 5 4 4 | TCC 15 10 8 9 9 9 | TAC 5 5 4 5 4 5 | TGC 4 4 4 5 5 4 Leu TTA 3 3 3 2 3 3 | TCA 0 1 4 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 3 4 6 4 5 5 | TCG 13 14 12 17 13 15 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 0 | His CAT 3 4 6 4 4 6 | Arg CGT 1 1 2 1 1 2 CTC 2 2 2 2 2 2 | CCC 4 5 4 6 5 7 | CAC 9 8 6 7 8 7 | CGC 7 6 5 6 6 6 CTA 0 0 0 0 1 1 | CCA 4 5 5 4 5 6 | Gln CAA 1 1 1 1 0 1 | CGA 4 5 5 2 5 3 CTG 10 9 7 10 7 7 | CCG 11 10 13 11 11 8 | CAG 11 11 11 11 12 11 | CGG 5 5 6 8 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 2 2 4 2 4 3 | Thr ACT 2 2 2 2 2 1 | Asn AAT 5 9 10 7 13 15 | Ser AGT 7 8 11 7 11 12 ATC 8 7 5 6 4 3 | ACC 10 8 8 8 7 7 | AAC 16 13 13 14 10 7 | AGC 14 13 13 14 12 12 ATA 1 2 3 3 4 6 | ACA 5 8 6 5 8 8 | Lys AAA 3 3 3 2 3 4 | Arg AGA 1 1 1 1 1 2 Met ATG 10 10 10 10 10 10 | ACG 9 7 8 7 10 9 | AAG 9 9 9 10 9 8 | AGG 1 1 0 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 2 2 2 2 2 2 | Ala GCT 3 3 5 5 6 5 | Asp GAT 3 3 5 4 5 5 | Gly GGT 2 3 5 1 3 8 GTC 3 3 4 2 3 2 | GCC 14 14 13 13 13 13 | GAC 6 6 4 5 4 4 | GGC 11 10 7 13 9 8 GTA 1 1 2 1 1 1 | GCA 3 5 3 7 2 3 | Glu GAA 3 4 3 2 2 3 | GGA 4 4 2 3 4 1 GTG 5 6 5 4 5 6 | GCG 7 5 3 6 3 4 | GAG 17 16 16 17 17 16 | GGG 2 1 1 4 1 0 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: D_melanogaster_Reph-PA position 1: T:0.17350 C:0.23028 A:0.33754 G:0.25868 position 2: T:0.18297 C:0.31230 A:0.29022 G:0.21451 position 3: T:0.18612 C:0.33123 A:0.13880 G:0.34385 Average T:0.18086 C:0.29127 A:0.25552 G:0.27234 #2: D_sechellia_Reph-PA position 1: T:0.17666 C:0.22713 A:0.34069 G:0.25552 position 2: T:0.17981 C:0.31230 A:0.29022 G:0.21767 position 3: T:0.18927 C:0.32808 A:0.13565 G:0.34700 Average T:0.18191 C:0.28917 A:0.25552 G:0.27340 #3: D_simulans_Reph-PA position 1: T:0.17666 C:0.22713 A:0.34069 G:0.25552 position 2: T:0.17981 C:0.31230 A:0.29022 G:0.21767 position 3: T:0.18927 C:0.32808 A:0.13565 G:0.34700 Average T:0.18191 C:0.28917 A:0.25552 G:0.27340 #4: D_yakuba_Reph-PA position 1: T:0.17350 C:0.23028 A:0.33438 G:0.26183 position 2: T:0.18297 C:0.30915 A:0.29022 G:0.21767 position 3: T:0.19558 C:0.32177 A:0.13565 G:0.34700 Average T:0.18402 C:0.28707 A:0.25342 G:0.27550 #5: D_erecta_Reph-PA position 1: T:0.17350 C:0.23028 A:0.33438 G:0.26183 position 2: T:0.17981 C:0.31230 A:0.29022 G:0.21767 position 3: T:0.17981 C:0.33438 A:0.13565 G:0.35016 Average T:0.17771 C:0.29232 A:0.25342 G:0.27655 #6: D_takahashii_Reph-PA position 1: T:0.17981 C:0.22082 A:0.32808 G:0.27129 position 2: T:0.17981 C:0.30599 A:0.28391 G:0.23028 position 3: T:0.16088 C:0.36593 A:0.13565 G:0.33754 Average T:0.17350 C:0.29758 A:0.24921 G:0.27971 #7: D_biarmipes_Reph-PA position 1: T:0.17350 C:0.23028 A:0.32492 G:0.27129 position 2: T:0.17666 C:0.31861 A:0.28707 G:0.21767 position 3: T:0.12303 C:0.41640 A:0.10410 G:0.35647 Average T:0.15773 C:0.32177 A:0.23870 G:0.28181 #8: D_suzukii_Reph-PA position 1: T:0.17350 C:0.23028 A:0.32492 G:0.27129 position 2: T:0.17981 C:0.31546 A:0.29022 G:0.21451 position 3: T:0.15142 C:0.37224 A:0.13565 G:0.34069 Average T:0.16824 C:0.30599 A:0.25026 G:0.27550 #9: D_eugracilis_Reph-PA position 1: T:0.17981 C:0.23344 A:0.33438 G:0.25237 position 2: T:0.18612 C:0.30915 A:0.29022 G:0.21451 position 3: T:0.20820 C:0.32492 A:0.12934 G:0.33754 Average T:0.19138 C:0.28917 A:0.25131 G:0.26814 #10: D_ficusphila_Reph-PA position 1: T:0.17350 C:0.23344 A:0.31230 G:0.28076 position 2: T:0.17035 C:0.32492 A:0.28076 G:0.22397 position 3: T:0.13249 C:0.37855 A:0.11041 G:0.37855 Average T:0.15878 C:0.31230 A:0.23449 G:0.29443 #11: D_rhopaloa_Reph-PA position 1: T:0.17350 C:0.23028 A:0.34385 G:0.25237 position 2: T:0.17981 C:0.31230 A:0.29022 G:0.21767 position 3: T:0.19558 C:0.33123 A:0.12934 G:0.34385 Average T:0.18297 C:0.29127 A:0.25447 G:0.27129 #12: D_elegans_Reph-PA position 1: T:0.17666 C:0.22713 A:0.34069 G:0.25552 position 2: T:0.17981 C:0.30915 A:0.29022 G:0.22082 position 3: T:0.21451 C:0.31546 A:0.13880 G:0.33123 Average T:0.19033 C:0.28391 A:0.25657 G:0.26919 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 25 | Ser S TCT 17 | Tyr Y TAT 8 | Cys C TGT 63 TTC 47 | TCC 112 | TAC 52 | TGC 57 Leu L TTA 35 | TCA 29 | *** * TAA 0 | *** * TGA 0 TTG 54 | TCG 168 | TAG 0 | Trp W TGG 0 ------------------------------------------------------------------------------ Leu L CTT 0 | Pro P CCT 7 | His H CAT 52 | Arg R CGT 25 CTC 24 | CCC 60 | CAC 91 | CGC 66 CTA 3 | CCA 59 | Gln Q CAA 11 | CGA 50 CTG 100 | CCG 128 | CAG 133 | CGG 63 ------------------------------------------------------------------------------ Ile I ATT 33 | Thr T ACT 25 | Asn N AAT 125 | Ser S AGT 119 ATC 61 | ACC 96 | AAC 142 | AGC 152 ATA 47 | ACA 82 | Lys K AAA 37 | Arg R AGA 13 Met M ATG 120 | ACG 96 | AAG 108 | AGG 11 ------------------------------------------------------------------------------ Val V GTT 25 | Ala A GCT 45 | Asp D GAT 54 | Gly G GGT 51 GTC 33 | GCC 167 | GAC 54 | GGC 101 GTA 13 | GCA 41 | Glu E GAA 32 | GGA 44 GTG 64 | GCG 58 | GAG 199 | GGG 17 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.17534 C:0.22923 A:0.33307 G:0.26236 position 2: T:0.17981 C:0.31283 A:0.28864 G:0.21872 position 3: T:0.17718 C:0.34569 A:0.13039 G:0.34674 Average T:0.17744 C:0.29592 A:0.25070 G:0.27594 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_Reph-PA D_sechellia_Reph-PA 0.0876 (0.0028 0.0316) D_simulans_Reph-PA 0.0876 (0.0028 0.0316)-1.0000 (0.0000 0.0089) D_yakuba_Reph-PA 0.0645 (0.0042 0.0644) 0.0639 (0.0044 0.0685) 0.0639 (0.0044 0.0685) D_erecta_Reph-PA 0.0610 (0.0028 0.0454) 0.0464 (0.0028 0.0596) 0.0464 (0.0028 0.0596) 0.0698 (0.0042 0.0595) D_takahashii_Reph-PA 0.2308 (0.0530 0.2295) 0.2293 (0.0500 0.2180) 0.2293 (0.0500 0.2180) 0.2345 (0.0520 0.2217) 0.2578 (0.0530 0.2056) D_biarmipes_Reph-PA 0.1231 (0.0282 0.2290) 0.1136 (0.0267 0.2353) 0.1136 (0.0267 0.2353) 0.1184 (0.0299 0.2522) 0.1367 (0.0296 0.2168) 0.1919 (0.0440 0.2290) D_suzukii_Reph-PA 0.1322 (0.0251 0.1897) 0.1437 (0.0265 0.1843) 0.1437 (0.0265 0.1843) 0.1428 (0.0248 0.1739) 0.1493 (0.0260 0.1744) 0.2466 (0.0425 0.1722) 0.0731 (0.0098 0.1335) D_eugracilis_Reph-PA 0.0876 (0.0182 0.2074) 0.0784 (0.0167 0.2136) 0.0829 (0.0167 0.2019) 0.0984 (0.0210 0.2133) 0.1064 (0.0196 0.1841) 0.1919 (0.0547 0.2849) 0.1151 (0.0332 0.2885) 0.1281 (0.0315 0.2460) D_ficusphila_Reph-PA 0.1149 (0.0292 0.2539) 0.1147 (0.0292 0.2543) 0.1147 (0.0292 0.2543) 0.1074 (0.0306 0.2853) 0.1039 (0.0263 0.2534) 0.2160 (0.0586 0.2714) 0.1934 (0.0421 0.2176) 0.1758 (0.0387 0.2199) 0.1402 (0.0398 0.2838) D_rhopaloa_Reph-PA 0.0687 (0.0111 0.1619) 0.0496 (0.0083 0.1677) 0.0496 (0.0083 0.1677) 0.0766 (0.0128 0.1666) 0.0713 (0.0111 0.1562) 0.2215 (0.0547 0.2469) 0.1168 (0.0296 0.2535) 0.1582 (0.0320 0.2023) 0.0785 (0.0174 0.2223) 0.1098 (0.0321 0.2919) D_elegans_Reph-PA 0.1228 (0.0274 0.2229) 0.1134 (0.0274 0.2414) 0.1079 (0.0274 0.2537) 0.1180 (0.0267 0.2259) 0.1168 (0.0274 0.2344) 0.2699 (0.0731 0.2710) 0.1477 (0.0507 0.3433) 0.1570 (0.0428 0.2729) 0.1094 (0.0353 0.3224) 0.1466 (0.0486 0.3311) 0.1285 (0.0238 0.1853) Model 0: one-ratio TREE # 1: (1, (2, 3), ((4, 5), ((((6, (7, 8)), 10), 9), (11, 12)))); MP score: 273 check convergence.. lnL(ntime: 21 np: 23): -2883.084352 +0.000000 13..1 13..14 14..2 14..3 13..15 15..16 16..4 16..5 15..17 17..18 18..19 19..20 20..6 20..21 21..7 21..8 19..10 18..9 17..22 22..11 22..12 0.013030 0.013115 0.003214 0.003238 0.011998 0.000004 0.033388 0.020758 0.034654 0.014201 0.034014 0.044990 0.175117 0.041839 0.086779 0.034176 0.170544 0.123715 0.045332 0.043788 0.149906 2.586999 0.127382 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.09780 (1: 0.013030, (2: 0.003214, 3: 0.003238): 0.013115, ((4: 0.033388, 5: 0.020758): 0.000004, ((((6: 0.175117, (7: 0.086779, 8: 0.034176): 0.041839): 0.044990, 10: 0.170544): 0.034014, 9: 0.123715): 0.014201, (11: 0.043788, 12: 0.149906): 0.045332): 0.034654): 0.011998); (D_melanogaster_Reph-PA: 0.013030, (D_sechellia_Reph-PA: 0.003214, D_simulans_Reph-PA: 0.003238): 0.013115, ((D_yakuba_Reph-PA: 0.033388, D_erecta_Reph-PA: 0.020758): 0.000004, ((((D_takahashii_Reph-PA: 0.175117, (D_biarmipes_Reph-PA: 0.086779, D_suzukii_Reph-PA: 0.034176): 0.041839): 0.044990, D_ficusphila_Reph-PA: 0.170544): 0.034014, D_eugracilis_Reph-PA: 0.123715): 0.014201, (D_rhopaloa_Reph-PA: 0.043788, D_elegans_Reph-PA: 0.149906): 0.045332): 0.034654): 0.011998); Detailed output identifying parameters kappa (ts/tv) = 2.58700 omega (dN/dS) = 0.12738 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 13..1 0.013 721.3 229.7 0.1274 0.0016 0.0128 1.2 3.0 13..14 0.013 721.3 229.7 0.1274 0.0016 0.0129 1.2 3.0 14..2 0.003 721.3 229.7 0.1274 0.0004 0.0032 0.3 0.7 14..3 0.003 721.3 229.7 0.1274 0.0004 0.0032 0.3 0.7 13..15 0.012 721.3 229.7 0.1274 0.0015 0.0118 1.1 2.7 15..16 0.000 721.3 229.7 0.1274 0.0000 0.0000 0.0 0.0 16..4 0.033 721.3 229.7 0.1274 0.0042 0.0329 3.0 7.6 16..5 0.021 721.3 229.7 0.1274 0.0026 0.0205 1.9 4.7 15..17 0.035 721.3 229.7 0.1274 0.0044 0.0342 3.1 7.8 17..18 0.014 721.3 229.7 0.1274 0.0018 0.0140 1.3 3.2 18..19 0.034 721.3 229.7 0.1274 0.0043 0.0335 3.1 7.7 19..20 0.045 721.3 229.7 0.1274 0.0056 0.0443 4.1 10.2 20..6 0.175 721.3 229.7 0.1274 0.0220 0.1726 15.9 39.7 20..21 0.042 721.3 229.7 0.1274 0.0053 0.0412 3.8 9.5 21..7 0.087 721.3 229.7 0.1274 0.0109 0.0855 7.9 19.7 21..8 0.034 721.3 229.7 0.1274 0.0043 0.0337 3.1 7.7 19..10 0.171 721.3 229.7 0.1274 0.0214 0.1681 15.4 38.6 18..9 0.124 721.3 229.7 0.1274 0.0155 0.1219 11.2 28.0 17..22 0.045 721.3 229.7 0.1274 0.0057 0.0447 4.1 10.3 22..11 0.044 721.3 229.7 0.1274 0.0055 0.0432 4.0 9.9 22..12 0.150 721.3 229.7 0.1274 0.0188 0.1478 13.6 33.9 tree length for dN: 0.1378 tree length for dS: 1.0820 Time used: 0:28 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, (2, 3), ((4, 5), ((((6, (7, 8)), 10), 9), (11, 12)))); MP score: 273 check convergence.. lnL(ntime: 21 np: 24): -2803.552013 +0.000000 13..1 13..14 14..2 14..3 13..15 15..16 16..4 16..5 15..17 17..18 18..19 19..20 20..6 20..21 21..7 21..8 19..10 18..9 17..22 22..11 22..12 0.013614 0.013623 0.003348 0.003373 0.012188 0.000004 0.034778 0.022069 0.036858 0.013175 0.036420 0.046816 0.188914 0.045922 0.092743 0.033650 0.184890 0.133102 0.046980 0.047184 0.161290 2.536628 0.861511 0.011547 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.17094 (1: 0.013614, (2: 0.003348, 3: 0.003373): 0.013623, ((4: 0.034778, 5: 0.022069): 0.000004, ((((6: 0.188914, (7: 0.092743, 8: 0.033650): 0.045922): 0.046816, 10: 0.184890): 0.036420, 9: 0.133102): 0.013175, (11: 0.047184, 12: 0.161290): 0.046980): 0.036858): 0.012188); (D_melanogaster_Reph-PA: 0.013614, (D_sechellia_Reph-PA: 0.003348, D_simulans_Reph-PA: 0.003373): 0.013623, ((D_yakuba_Reph-PA: 0.034778, D_erecta_Reph-PA: 0.022069): 0.000004, ((((D_takahashii_Reph-PA: 0.188914, (D_biarmipes_Reph-PA: 0.092743, D_suzukii_Reph-PA: 0.033650): 0.045922): 0.046816, D_ficusphila_Reph-PA: 0.184890): 0.036420, D_eugracilis_Reph-PA: 0.133102): 0.013175, (D_rhopaloa_Reph-PA: 0.047184, D_elegans_Reph-PA: 0.161290): 0.046980): 0.036858): 0.012188); Detailed output identifying parameters kappa (ts/tv) = 2.53663 dN/dS (w) for site classes (K=2) p: 0.86151 0.13849 w: 0.01155 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 13..1 0.014 721.7 229.3 0.1484 0.0019 0.0128 1.4 2.9 13..14 0.014 721.7 229.3 0.1484 0.0019 0.0128 1.4 2.9 14..2 0.003 721.7 229.3 0.1484 0.0005 0.0032 0.3 0.7 14..3 0.003 721.7 229.3 0.1484 0.0005 0.0032 0.3 0.7 13..15 0.012 721.7 229.3 0.1484 0.0017 0.0115 1.2 2.6 15..16 0.000 721.7 229.3 0.1484 0.0000 0.0000 0.0 0.0 16..4 0.035 721.7 229.3 0.1484 0.0049 0.0328 3.5 7.5 16..5 0.022 721.7 229.3 0.1484 0.0031 0.0208 2.2 4.8 15..17 0.037 721.7 229.3 0.1484 0.0052 0.0347 3.7 8.0 17..18 0.013 721.7 229.3 0.1484 0.0018 0.0124 1.3 2.8 18..19 0.036 721.7 229.3 0.1484 0.0051 0.0343 3.7 7.9 19..20 0.047 721.7 229.3 0.1484 0.0065 0.0441 4.7 10.1 20..6 0.189 721.7 229.3 0.1484 0.0264 0.1780 19.1 40.8 20..21 0.046 721.7 229.3 0.1484 0.0064 0.0433 4.6 9.9 21..7 0.093 721.7 229.3 0.1484 0.0130 0.0874 9.4 20.0 21..8 0.034 721.7 229.3 0.1484 0.0047 0.0317 3.4 7.3 19..10 0.185 721.7 229.3 0.1484 0.0259 0.1742 18.7 39.9 18..9 0.133 721.7 229.3 0.1484 0.0186 0.1254 13.4 28.8 17..22 0.047 721.7 229.3 0.1484 0.0066 0.0443 4.7 10.2 22..11 0.047 721.7 229.3 0.1484 0.0066 0.0445 4.8 10.2 22..12 0.161 721.7 229.3 0.1484 0.0226 0.1520 16.3 34.8 Time used: 1:17 Model 2: PositiveSelection (3 categories) TREE # 1: (1, (2, 3), ((4, 5), ((((6, (7, 8)), 10), 9), (11, 12)))); MP score: 273 check convergence.. lnL(ntime: 21 np: 26): -2798.277173 +0.000000 13..1 13..14 14..2 14..3 13..15 15..16 16..4 16..5 15..17 17..18 18..19 19..20 20..6 20..21 21..7 21..8 19..10 18..9 17..22 22..11 22..12 0.014189 0.013599 0.003421 0.003445 0.012280 0.000004 0.035671 0.023140 0.039681 0.014372 0.039072 0.049492 0.199503 0.050872 0.100135 0.031436 0.200012 0.138240 0.050681 0.046775 0.171931 2.595616 0.860912 0.129421 0.012197 6.432194 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.23795 (1: 0.014189, (2: 0.003421, 3: 0.003445): 0.013599, ((4: 0.035671, 5: 0.023140): 0.000004, ((((6: 0.199503, (7: 0.100135, 8: 0.031436): 0.050872): 0.049492, 10: 0.200012): 0.039072, 9: 0.138240): 0.014372, (11: 0.046775, 12: 0.171931): 0.050681): 0.039681): 0.012280); (D_melanogaster_Reph-PA: 0.014189, (D_sechellia_Reph-PA: 0.003421, D_simulans_Reph-PA: 0.003445): 0.013599, ((D_yakuba_Reph-PA: 0.035671, D_erecta_Reph-PA: 0.023140): 0.000004, ((((D_takahashii_Reph-PA: 0.199503, (D_biarmipes_Reph-PA: 0.100135, D_suzukii_Reph-PA: 0.031436): 0.050872): 0.049492, D_ficusphila_Reph-PA: 0.200012): 0.039072, D_eugracilis_Reph-PA: 0.138240): 0.014372, (D_rhopaloa_Reph-PA: 0.046775, D_elegans_Reph-PA: 0.171931): 0.050681): 0.039681): 0.012280); Detailed output identifying parameters kappa (ts/tv) = 2.59562 dN/dS (w) for site classes (K=3) p: 0.86091 0.12942 0.00967 w: 0.01220 1.00000 6.43219 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 13..1 0.014 721.2 229.8 0.2021 0.0024 0.0120 1.7 2.8 13..14 0.014 721.2 229.8 0.2021 0.0023 0.0115 1.7 2.6 14..2 0.003 721.2 229.8 0.2021 0.0006 0.0029 0.4 0.7 14..3 0.003 721.2 229.8 0.2021 0.0006 0.0029 0.4 0.7 13..15 0.012 721.2 229.8 0.2021 0.0021 0.0104 1.5 2.4 15..16 0.000 721.2 229.8 0.2021 0.0000 0.0000 0.0 0.0 16..4 0.036 721.2 229.8 0.2021 0.0061 0.0301 4.4 6.9 16..5 0.023 721.2 229.8 0.2021 0.0039 0.0195 2.8 4.5 15..17 0.040 721.2 229.8 0.2021 0.0068 0.0335 4.9 7.7 17..18 0.014 721.2 229.8 0.2021 0.0025 0.0121 1.8 2.8 18..19 0.039 721.2 229.8 0.2021 0.0067 0.0330 4.8 7.6 19..20 0.049 721.2 229.8 0.2021 0.0084 0.0418 6.1 9.6 20..6 0.200 721.2 229.8 0.2021 0.0340 0.1684 24.5 38.7 20..21 0.051 721.2 229.8 0.2021 0.0087 0.0429 6.3 9.9 21..7 0.100 721.2 229.8 0.2021 0.0171 0.0845 12.3 19.4 21..8 0.031 721.2 229.8 0.2021 0.0054 0.0265 3.9 6.1 19..10 0.200 721.2 229.8 0.2021 0.0341 0.1688 24.6 38.8 18..9 0.138 721.2 229.8 0.2021 0.0236 0.1167 17.0 26.8 17..22 0.051 721.2 229.8 0.2021 0.0086 0.0428 6.2 9.8 22..11 0.047 721.2 229.8 0.2021 0.0080 0.0395 5.8 9.1 22..12 0.172 721.2 229.8 0.2021 0.0293 0.1451 21.2 33.4 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reph-PA) Pr(w>1) post mean +- SE for w 189 T 0.615 4.341 191 A 0.995** 6.407 192 A 0.866 5.706 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reph-PA) Pr(w>1) post mean +- SE for w 10 P 0.712 2.514 +- 1.458 189 T 0.884 3.113 +- 1.722 190 V 0.597 2.181 +- 1.319 191 A 0.990** 3.405 +- 1.706 192 A 0.941 3.298 +- 1.744 194 G 0.558 2.050 +- 1.244 278 T 0.513 1.926 +- 1.114 282 T 0.603 2.165 +- 1.254 288 A 0.525 1.944 +- 1.104 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.084 0.479 0.214 0.089 0.049 0.031 0.020 0.014 0.011 0.009 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.298 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.280 0.420 sum of density on p0-p1 = 1.000000 Time used: 3:03 Model 3: discrete (3 categories) TREE # 1: (1, (2, 3), ((4, 5), ((((6, (7, 8)), 10), 9), (11, 12)))); MP score: 273 check convergence.. lnL(ntime: 21 np: 27): -2797.804133 +0.000000 13..1 13..14 14..2 14..3 13..15 15..16 16..4 16..5 15..17 17..18 18..19 19..20 20..6 20..21 21..7 21..8 19..10 18..9 17..22 22..11 22..12 0.014127 0.013798 0.003438 0.003462 0.012131 0.000004 0.035606 0.023251 0.038700 0.014404 0.038254 0.048440 0.197527 0.050277 0.098882 0.032088 0.195358 0.138107 0.050098 0.046815 0.168827 2.571979 0.813961 0.169056 0.000001 0.666256 4.309657 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.22359 (1: 0.014127, (2: 0.003438, 3: 0.003462): 0.013798, ((4: 0.035606, 5: 0.023251): 0.000004, ((((6: 0.197527, (7: 0.098882, 8: 0.032088): 0.050277): 0.048440, 10: 0.195358): 0.038254, 9: 0.138107): 0.014404, (11: 0.046815, 12: 0.168827): 0.050098): 0.038700): 0.012131); (D_melanogaster_Reph-PA: 0.014127, (D_sechellia_Reph-PA: 0.003438, D_simulans_Reph-PA: 0.003462): 0.013798, ((D_yakuba_Reph-PA: 0.035606, D_erecta_Reph-PA: 0.023251): 0.000004, ((((D_takahashii_Reph-PA: 0.197527, (D_biarmipes_Reph-PA: 0.098882, D_suzukii_Reph-PA: 0.032088): 0.050277): 0.048440, D_ficusphila_Reph-PA: 0.195358): 0.038254, D_eugracilis_Reph-PA: 0.138107): 0.014404, (D_rhopaloa_Reph-PA: 0.046815, D_elegans_Reph-PA: 0.168827): 0.050098): 0.038700): 0.012131); Detailed output identifying parameters kappa (ts/tv) = 2.57198 dN/dS (w) for site classes (K=3) p: 0.81396 0.16906 0.01698 w: 0.00000 0.66626 4.30966 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 13..1 0.014 721.4 229.6 0.1858 0.0023 0.0123 1.7 2.8 13..14 0.014 721.4 229.6 0.1858 0.0022 0.0120 1.6 2.8 14..2 0.003 721.4 229.6 0.1858 0.0006 0.0030 0.4 0.7 14..3 0.003 721.4 229.6 0.1858 0.0006 0.0030 0.4 0.7 13..15 0.012 721.4 229.6 0.1858 0.0020 0.0106 1.4 2.4 15..16 0.000 721.4 229.6 0.1858 0.0000 0.0000 0.0 0.0 16..4 0.036 721.4 229.6 0.1858 0.0058 0.0310 4.2 7.1 16..5 0.023 721.4 229.6 0.1858 0.0038 0.0203 2.7 4.7 15..17 0.039 721.4 229.6 0.1858 0.0063 0.0337 4.5 7.7 17..18 0.014 721.4 229.6 0.1858 0.0023 0.0126 1.7 2.9 18..19 0.038 721.4 229.6 0.1858 0.0062 0.0333 4.5 7.7 19..20 0.048 721.4 229.6 0.1858 0.0078 0.0422 5.7 9.7 20..6 0.198 721.4 229.6 0.1858 0.0320 0.1722 23.1 39.5 20..21 0.050 721.4 229.6 0.1858 0.0081 0.0438 5.9 10.1 21..7 0.099 721.4 229.6 0.1858 0.0160 0.0862 11.6 19.8 21..8 0.032 721.4 229.6 0.1858 0.0052 0.0280 3.7 6.4 19..10 0.195 721.4 229.6 0.1858 0.0316 0.1703 22.8 39.1 18..9 0.138 721.4 229.6 0.1858 0.0224 0.1204 16.1 27.6 17..22 0.050 721.4 229.6 0.1858 0.0081 0.0437 5.9 10.0 22..11 0.047 721.4 229.6 0.1858 0.0076 0.0408 5.5 9.4 22..12 0.169 721.4 229.6 0.1858 0.0273 0.1472 19.7 33.8 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reph-PA) Pr(w>1) post mean +- SE for w 10 P 0.554 2.683 189 T 0.897 3.933 191 A 1.000** 4.308 192 A 0.969* 4.196 Time used: 5:43 Model 7: beta (10 categories) TREE # 1: (1, (2, 3), ((4, 5), ((((6, (7, 8)), 10), 9), (11, 12)))); MP score: 273 lnL(ntime: 21 np: 24): -2803.569758 +0.000000 13..1 13..14 14..2 14..3 13..15 15..16 16..4 16..5 15..17 17..18 18..19 19..20 20..6 20..21 21..7 21..8 19..10 18..9 17..22 22..11 22..12 0.013463 0.013476 0.003308 0.003337 0.012073 0.000004 0.034375 0.021820 0.036377 0.013067 0.035919 0.046266 0.186583 0.045455 0.091682 0.033365 0.182773 0.131594 0.046809 0.046227 0.159108 2.505564 0.015613 0.095493 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.15708 (1: 0.013463, (2: 0.003308, 3: 0.003337): 0.013476, ((4: 0.034375, 5: 0.021820): 0.000004, ((((6: 0.186583, (7: 0.091682, 8: 0.033365): 0.045455): 0.046266, 10: 0.182773): 0.035919, 9: 0.131594): 0.013067, (11: 0.046227, 12: 0.159108): 0.046809): 0.036377): 0.012073); (D_melanogaster_Reph-PA: 0.013463, (D_sechellia_Reph-PA: 0.003308, D_simulans_Reph-PA: 0.003337): 0.013476, ((D_yakuba_Reph-PA: 0.034375, D_erecta_Reph-PA: 0.021820): 0.000004, ((((D_takahashii_Reph-PA: 0.186583, (D_biarmipes_Reph-PA: 0.091682, D_suzukii_Reph-PA: 0.033365): 0.045455): 0.046266, D_ficusphila_Reph-PA: 0.182773): 0.035919, D_eugracilis_Reph-PA: 0.131594): 0.013067, (D_rhopaloa_Reph-PA: 0.046227, D_elegans_Reph-PA: 0.159108): 0.046809): 0.036377): 0.012073); Detailed output identifying parameters kappa (ts/tv) = 2.50556 Parameters in M7 (beta): p = 0.01561 q = 0.09549 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00014 0.30748 0.99998 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 13..1 0.013 722.0 229.0 0.1308 0.0017 0.0132 1.2 3.0 13..14 0.013 722.0 229.0 0.1308 0.0017 0.0132 1.2 3.0 14..2 0.003 722.0 229.0 0.1308 0.0004 0.0032 0.3 0.7 14..3 0.003 722.0 229.0 0.1308 0.0004 0.0033 0.3 0.7 13..15 0.012 722.0 229.0 0.1308 0.0015 0.0118 1.1 2.7 15..16 0.000 722.0 229.0 0.1308 0.0000 0.0000 0.0 0.0 16..4 0.034 722.0 229.0 0.1308 0.0044 0.0337 3.2 7.7 16..5 0.022 722.0 229.0 0.1308 0.0028 0.0214 2.0 4.9 15..17 0.036 722.0 229.0 0.1308 0.0047 0.0357 3.4 8.2 17..18 0.013 722.0 229.0 0.1308 0.0017 0.0128 1.2 2.9 18..19 0.036 722.0 229.0 0.1308 0.0046 0.0352 3.3 8.1 19..20 0.046 722.0 229.0 0.1308 0.0059 0.0454 4.3 10.4 20..6 0.187 722.0 229.0 0.1308 0.0239 0.1829 17.3 41.9 20..21 0.045 722.0 229.0 0.1308 0.0058 0.0446 4.2 10.2 21..7 0.092 722.0 229.0 0.1308 0.0118 0.0899 8.5 20.6 21..8 0.033 722.0 229.0 0.1308 0.0043 0.0327 3.1 7.5 19..10 0.183 722.0 229.0 0.1308 0.0234 0.1792 16.9 41.0 18..9 0.132 722.0 229.0 0.1308 0.0169 0.1290 12.2 29.5 17..22 0.047 722.0 229.0 0.1308 0.0060 0.0459 4.3 10.5 22..11 0.046 722.0 229.0 0.1308 0.0059 0.0453 4.3 10.4 22..12 0.159 722.0 229.0 0.1308 0.0204 0.1560 14.7 35.7 Time used: 9:56 Model 8: beta&w>1 (11 categories) TREE # 1: (1, (2, 3), ((4, 5), ((((6, (7, 8)), 10), 9), (11, 12)))); MP score: 273 check convergence.. lnL(ntime: 21 np: 26): -2797.774649 +0.000000 13..1 13..14 14..2 14..3 13..15 15..16 16..4 16..5 15..17 17..18 18..19 19..20 20..6 20..21 21..7 21..8 19..10 18..9 17..22 22..11 22..12 0.014213 0.013740 0.003442 0.003466 0.012274 0.000004 0.035771 0.023268 0.039396 0.014355 0.038906 0.049177 0.199348 0.050963 0.100061 0.031743 0.198765 0.138794 0.050839 0.046763 0.171131 2.575324 0.988600 0.015513 0.094517 5.502976 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.23642 (1: 0.014213, (2: 0.003442, 3: 0.003466): 0.013740, ((4: 0.035771, 5: 0.023268): 0.000004, ((((6: 0.199348, (7: 0.100061, 8: 0.031743): 0.050963): 0.049177, 10: 0.198765): 0.038906, 9: 0.138794): 0.014355, (11: 0.046763, 12: 0.171131): 0.050839): 0.039396): 0.012274); (D_melanogaster_Reph-PA: 0.014213, (D_sechellia_Reph-PA: 0.003442, D_simulans_Reph-PA: 0.003466): 0.013740, ((D_yakuba_Reph-PA: 0.035771, D_erecta_Reph-PA: 0.023268): 0.000004, ((((D_takahashii_Reph-PA: 0.199348, (D_biarmipes_Reph-PA: 0.100061, D_suzukii_Reph-PA: 0.031743): 0.050963): 0.049177, D_ficusphila_Reph-PA: 0.198765): 0.038906, D_eugracilis_Reph-PA: 0.138794): 0.014355, (D_rhopaloa_Reph-PA: 0.046763, D_elegans_Reph-PA: 0.171131): 0.050839): 0.039396): 0.012274); Detailed output identifying parameters kappa (ts/tv) = 2.57532 Parameters in M8 (beta&w>1): p0 = 0.98860 p = 0.01551 q = 0.09452 (p1 = 0.01140) w = 5.50298 dN/dS (w) for site classes (K=11) p: 0.09886 0.09886 0.09886 0.09886 0.09886 0.09886 0.09886 0.09886 0.09886 0.09886 0.01140 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00014 0.31451 0.99998 5.50298 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 13..1 0.014 721.4 229.6 0.1927 0.0024 0.0122 1.7 2.8 13..14 0.014 721.4 229.6 0.1927 0.0023 0.0118 1.6 2.7 14..2 0.003 721.4 229.6 0.1927 0.0006 0.0030 0.4 0.7 14..3 0.003 721.4 229.6 0.1927 0.0006 0.0030 0.4 0.7 13..15 0.012 721.4 229.6 0.1927 0.0020 0.0106 1.5 2.4 15..16 0.000 721.4 229.6 0.1927 0.0000 0.0000 0.0 0.0 16..4 0.036 721.4 229.6 0.1927 0.0059 0.0308 4.3 7.1 16..5 0.023 721.4 229.6 0.1927 0.0039 0.0200 2.8 4.6 15..17 0.039 721.4 229.6 0.1927 0.0065 0.0339 4.7 7.8 17..18 0.014 721.4 229.6 0.1927 0.0024 0.0123 1.7 2.8 18..19 0.039 721.4 229.6 0.1927 0.0064 0.0335 4.7 7.7 19..20 0.049 721.4 229.6 0.1927 0.0081 0.0423 5.9 9.7 20..6 0.199 721.4 229.6 0.1927 0.0330 0.1714 23.8 39.4 20..21 0.051 721.4 229.6 0.1927 0.0084 0.0438 6.1 10.1 21..7 0.100 721.4 229.6 0.1927 0.0166 0.0860 12.0 19.8 21..8 0.032 721.4 229.6 0.1927 0.0053 0.0273 3.8 6.3 19..10 0.199 721.4 229.6 0.1927 0.0329 0.1709 23.8 39.2 18..9 0.139 721.4 229.6 0.1927 0.0230 0.1194 16.6 27.4 17..22 0.051 721.4 229.6 0.1927 0.0084 0.0437 6.1 10.0 22..11 0.047 721.4 229.6 0.1927 0.0077 0.0402 5.6 9.2 22..12 0.171 721.4 229.6 0.1927 0.0284 0.1472 20.5 33.8 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reph-PA) Pr(w>1) post mean +- SE for w 189 T 0.700 4.152 191 A 0.996** 5.484 192 A 0.896 5.032 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reph-PA) Pr(w>1) post mean +- SE for w 10 P 0.917 2.470 +- 0.751 13 S 0.512 1.539 +- 1.125 180 N 0.759 2.115 +- 0.928 189 T 0.981* 2.599 +- 0.587 190 V 0.854 2.333 +- 0.863 191 A 0.999** 2.631 +- 0.535 192 A 0.991** 2.617 +- 0.560 194 G 0.787 2.177 +- 0.984 275 S 0.536 1.626 +- 1.060 276 G 0.574 1.686 +- 1.129 278 T 0.799 2.209 +- 0.930 281 P 0.655 1.874 +- 1.102 282 T 0.865 2.356 +- 0.843 283 T 0.537 1.597 +- 1.129 288 A 0.815 2.243 +- 0.908 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.001 0.017 0.067 0.142 0.214 0.266 0.294 ws: 0.061 0.765 0.156 0.015 0.002 0.000 0.000 0.000 0.000 0.000 Time used: 17:30
Model 1: NearlyNeutral -2803.552013 Model 2: PositiveSelection -2798.277173 Model 0: one-ratio -2883.084352 Model 3: discrete -2797.804133 Model 7: beta -2803.569758 Model 8: beta&w>1 -2797.774649 Model 0 vs 1 159.06467799999973 Model 2 vs 1 10.54968000000008 Additional information for M1 vs M2: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reph-PA) Pr(w>1) post mean +- SE for w 189 T 0.615 4.341 191 A 0.995** 6.407 192 A 0.866 5.706 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reph-PA) Pr(w>1) post mean +- SE for w 10 P 0.712 2.514 +- 1.458 189 T 0.884 3.113 +- 1.722 190 V 0.597 2.181 +- 1.319 191 A 0.990** 3.405 +- 1.706 192 A 0.941 3.298 +- 1.744 194 G 0.558 2.050 +- 1.244 278 T 0.513 1.926 +- 1.114 282 T 0.603 2.165 +- 1.254 288 A 0.525 1.944 +- 1.104 Model 8 vs 7 11.590218000000277 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reph-PA) Pr(w>1) post mean +- SE for w 189 T 0.700 4.152 191 A 0.996** 5.484 192 A 0.896 5.032 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reph-PA) Pr(w>1) post mean +- SE for w 10 P 0.917 2.470 +- 0.751 13 S 0.512 1.539 +- 1.125 180 N 0.759 2.115 +- 0.928 189 T 0.981* 2.599 +- 0.587 190 V 0.854 2.333 +- 0.863 191 A 0.999** 2.631 +- 0.535 192 A 0.991** 2.617 +- 0.560 194 G 0.787 2.177 +- 0.984 275 S 0.536 1.626 +- 1.060 276 G 0.574 1.686 +- 1.129 278 T 0.799 2.209 +- 0.930 281 P 0.655 1.874 +- 1.102 282 T 0.865 2.356 +- 0.843 283 T 0.537 1.597 +- 1.129 288 A 0.815 2.243 +- 0.908