--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Mon Dec 05 12:41:31 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/367/Reep1-PG/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2153.04 -2162.57 2 -2153.23 -2164.02 -------------------------------------- TOTAL -2153.13 -2163.54 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.363298 0.001699 0.282528 0.440339 0.359998 1347.72 1363.39 1.000 r(A<->C){all} 0.116209 0.000749 0.064635 0.168813 0.113978 875.24 964.77 1.000 r(A<->G){all} 0.251020 0.001768 0.172238 0.333771 0.249345 802.50 1018.88 1.000 r(A<->T){all} 0.125457 0.001396 0.058475 0.200894 0.122553 806.53 858.02 1.001 r(C<->G){all} 0.082257 0.000387 0.048748 0.123125 0.080879 882.14 1072.08 1.000 r(C<->T){all} 0.351604 0.002375 0.259605 0.445596 0.350490 807.02 868.24 1.000 r(G<->T){all} 0.073452 0.000589 0.029195 0.122947 0.071255 1046.75 1120.89 1.001 pi(A){all} 0.231370 0.000185 0.204037 0.256641 0.231128 1004.72 1135.56 1.000 pi(C){all} 0.290933 0.000216 0.263910 0.320248 0.290691 1105.09 1120.03 1.000 pi(G){all} 0.294326 0.000205 0.266290 0.321828 0.294243 950.83 1030.82 1.000 pi(T){all} 0.183370 0.000154 0.159241 0.208771 0.183356 1132.82 1164.72 1.000 alpha{1,2} 0.070323 0.002448 0.000105 0.158017 0.062174 1147.42 1161.71 1.001 alpha{3} 2.143051 0.614045 0.741540 3.603230 2.035914 1396.58 1415.10 1.000 pinvar{all} 0.197464 0.009161 0.000826 0.357295 0.196234 1004.40 1116.07 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2002.42933 Model 2: PositiveSelection -2002.104285 Model 0: one-ratio -2031.691327 Model 3: discrete -2002.104285 Model 7: beta -2003.607857 Model 8: beta&w>1 -2002.12617 Model 0 vs 1 58.52399400000013 Model 2 vs 1 0.6500900000000911 Model 8 vs 7 2.9633739999999307
>C1 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELYRGQDTMDSTENWLPRASSLSSIESYTETIYEPRTET KRLVIREVSEEAEFDDDPLGDAGAARLRDMPVRKAQPRRAASTAKAAGKR GQKHNDIEGARSSSSSSNVIRSRRKLREPTPDVDVENY >C2 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTDT RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKTQPRRAATTAKATDKR GQKQNDMKGAKSSSNTINVIRSRRKLREPTPDVDVETY >C3 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTET RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKAQPRRAASTAKAAGKR GQKQNDVEGAKSSSSTINVIRSRRKLREPTPDVDVETY >C4 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSANELSRDQDMMDSTDNWLPRASSLSSIESYTETIYEPRAET RRLVIREVSEEVEHEDEPLGDAGAARLRDLPVRKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSSSVIRSRRKLRDPTPDVDVENYoo >C5 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTTPSGD GRGLQNSHSANELSRGQDVMDSTDNWLPRASSLSSIESYAETIYEPRAET RRLIIREVREEVEQEDEPLGDAGAARLRDLPARKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSNVIRSRRKLRDPTPDVDVENYooo >C6 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGQ GRGLQNSHSADELYRGQDTMDSTDNWLPRASSLSSIDSYTENIYEPRAET RRLVIREVSEEVEQEDEPTGDAGAARLRDLPVRKAQPRRAAGTARTGGKR GQKNNDTEAAAGSSTNVIRSRRKLRDPTPDVDVENYoo CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=291 C1 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC C2 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC C3 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC C4 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC C5 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC C6 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC ************************************************** C1 IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE C2 IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE C3 IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE C4 IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE C5 IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE C6 IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE ************************************************** C1 QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH C2 QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH C3 QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH C4 QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH C5 QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTTPSGD C6 QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGQ *********************************************:***. C1 GRGLQNSHSADELYRGQDTMDSTENWLPRASSLSSIESYTETIYEPRTET C2 GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTDT C3 GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTET C4 GRGLQNSHSANELSRDQDMMDSTDNWLPRASSLSSIESYTETIYEPRAET C5 GRGLQNSHSANELSRGQDVMDSTDNWLPRASSLSSIESYAETIYEPRAET C6 GRGLQNSHSADELYRGQDTMDSTDNWLPRASSLSSIDSYTENIYEPRAET **********:** *.** ****:************:**:*.*****::* C1 KRLVIREVSEEAEFDDDPLGDAGAARLRDMPVRKAQPRRAASTAKAAGKR C2 RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKTQPRRAATTAKATDKR C3 RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKAQPRRAASTAKAAGKR C4 RRLVIREVSEEVEHEDEPLGDAGAARLRDLPVRKAQPRRAAGTARAAGKR C5 RRLIIREVREEVEQEDEPLGDAGAARLRDLPARKAQPRRAAGTARAAGKR C6 RRLVIREVSEEVEQEDEPTGDAGAARLRDLPVRKAQPRRAAGTARTGGKR :**:**** **.* :*:* *******:**:*.**:****** **:: .** C1 GQKHNDIEGARSSSSSSNVIRSRRKLREPTPDVDVENY--- C2 GQKQNDMKGAKSSSNTINVIRSRRKLREPTPDVDVETY--- C3 GQKQNDVEGAKSSSSTINVIRSRRKLREPTPDVDVETY--- C4 GQKNNDMEAAGSSSSS--VIRSRRKLRDPTPDVDVENYoo- C5 GQKNNDMEAAGSSSN---VIRSRRKLRDPTPDVDVENYooo C6 GQKNNDTEAAAGSSTN--VIRSRRKLRDPTPDVDVENYoo- ***:** :.* .**. *********:********.* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] Relaxation Summary: [9036]--->[9001] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/367/Reep1-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.349 Mb, Max= 30.709 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELYRGQDTMDSTENWLPRASSLSSIESYTETIYEPRTET KRLVIREVSEEAEFDDDPLGDAGAARLRDMPVRKAQPRRAASTAKAAGKR GQKHNDIEGARSSSSSSNVIRSRRKLREPTPDVDVENY--- >C2 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTDT RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKTQPRRAATTAKATDKR GQKQNDMKGAKSSSNTINVIRSRRKLREPTPDVDVETY--- >C3 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTET RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKAQPRRAASTAKAAGKR GQKQNDVEGAKSSSSTINVIRSRRKLREPTPDVDVETY--- >C4 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSANELSRDQDMMDSTDNWLPRASSLSSIESYTETIYEPRAET RRLVIREVSEEVEHEDEPLGDAGAARLRDLPVRKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSSS--VIRSRRKLRDPTPDVDVENYoo- >C5 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTTPSGD GRGLQNSHSANELSRGQDVMDSTDNWLPRASSLSSIESYAETIYEPRAET RRLIIREVREEVEQEDEPLGDAGAARLRDLPARKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSN---VIRSRRKLRDPTPDVDVENYooo >C6 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGQ GRGLQNSHSADELYRGQDTMDSTDNWLPRASSLSSIDSYTENIYEPRAET RRLVIREVSEEVEQEDEPTGDAGAARLRDLPVRKAQPRRAAGTARTGGKR GQKNNDTEAAAGSSTN--VIRSRRKLRDPTPDVDVENYoo- FORMAT of file /tmp/tmp8211482884039356379aln Not Supported[FATAL:T-COFFEE] >C1 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELYRGQDTMDSTENWLPRASSLSSIESYTETIYEPRTET KRLVIREVSEEAEFDDDPLGDAGAARLRDMPVRKAQPRRAASTAKAAGKR GQKHNDIEGARSSSSSSNVIRSRRKLREPTPDVDVENY--- >C2 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTDT RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKTQPRRAATTAKATDKR GQKQNDMKGAKSSSNTINVIRSRRKLREPTPDVDVETY--- >C3 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTET RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKAQPRRAASTAKAAGKR GQKQNDVEGAKSSSSTINVIRSRRKLREPTPDVDVETY--- >C4 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSANELSRDQDMMDSTDNWLPRASSLSSIESYTETIYEPRAET RRLVIREVSEEVEHEDEPLGDAGAARLRDLPVRKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSSS--VIRSRRKLRDPTPDVDVENYoo- >C5 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTTPSGD GRGLQNSHSANELSRGQDVMDSTDNWLPRASSLSSIESYAETIYEPRAET RRLIIREVREEVEQEDEPLGDAGAARLRDLPARKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSN---VIRSRRKLRDPTPDVDVENYooo >C6 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGQ GRGLQNSHSADELYRGQDTMDSTDNWLPRASSLSSIDSYTENIYEPRAET RRLVIREVSEEVEQEDEPTGDAGAARLRDLPVRKAQPRRAAGTARTGGKR GQKNNDTEAAAGSSTN--VIRSRRKLRDPTPDVDVENYoo- input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:291 S:98 BS:291 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 92.71 C1 C2 92.71 TOP 1 0 92.71 C2 C1 92.71 BOT 0 2 95.14 C1 C3 95.14 TOP 2 0 95.14 C3 C1 95.14 BOT 0 3 93.36 C1 C4 93.36 TOP 3 0 93.36 C4 C1 93.36 BOT 0 4 91.23 C1 C5 91.23 TOP 4 0 91.23 C5 C1 91.23 BOT 0 5 91.61 C1 C6 91.61 TOP 5 0 91.61 C6 C1 91.61 BOT 1 2 97.22 C2 C3 97.22 TOP 2 1 97.22 C3 C2 97.22 BOT 1 3 91.61 C2 C4 91.61 TOP 3 1 91.61 C4 C2 91.61 BOT 1 4 91.23 C2 C5 91.23 TOP 4 1 91.23 C5 C2 91.23 BOT 1 5 90.21 C2 C6 90.21 TOP 5 1 90.21 C6 C2 90.21 BOT 2 3 93.36 C3 C4 93.36 TOP 3 2 93.36 C4 C3 93.36 BOT 2 4 92.28 C3 C5 92.28 TOP 4 2 92.28 C5 C3 92.28 BOT 2 5 91.61 C3 C6 91.61 TOP 5 2 91.61 C6 C3 91.61 BOT 3 4 96.52 C4 C5 96.52 TOP 4 3 96.52 C5 C4 96.52 BOT 3 5 94.44 C4 C6 94.44 TOP 5 3 94.44 C6 C4 94.44 BOT 4 5 93.73 C5 C6 93.73 TOP 5 4 93.73 C6 C5 93.73 AVG 0 C1 * 92.81 AVG 1 C2 * 92.60 AVG 2 C3 * 93.92 AVG 3 C4 * 93.86 AVG 4 C5 * 93.00 AVG 5 C6 * 92.32 TOT TOT * 93.08 CLUSTAL W (1.83) multiple sequence alignment C1 ATGATCAGCAGCCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT C2 ATGATCAGCAGCCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT C3 ATGATCAGCAGCCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT C4 ATGATCAGCAGTCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT C5 ATGATCAGCAGTCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT C6 ATGATCAGCAGCCTGTTCTCGCGGCTTATCATATTGTTCTGCGGCACCCT *********** ***** ***********.******************** C1 GTACCCGGCATATGCCTCATACAAGGCCGTCAGGACCAAGGATGTCAAGG C2 GTACCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG C3 GTACCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG C4 GTATCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG C5 GTACCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG C6 GTACCCGGCCTACGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG *** *****.** *****.******************************* C1 AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACCTGC C2 AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACATGC C3 AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACATGC C4 AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACCTGC C5 AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTTACCTGC C6 AATATGTAAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACCTGC *******:*********************************** **.*** C1 ATAGAAACATTCACGGACATATTTATCTCCTGGCTACCGTTCTACTACGA C2 ATAGAAACATTCACGGACATATTCATCTCCTGGCTGCCGTTCTACTACGA C3 ATAGAAACATTCACGGACATATTCATCTCCTGGCTGCCGTTCTACTACGA C4 ATAGAAACATTCACGGACATATTCATTTCCTGGCTGCCGTTCTACTACGA C5 ATAGAAACATTCACGGATATATTCATCTCCTGGCTGCCGTTCTACTACGA C6 ATCGAAACATTCACGGACATCTTCATCTCCTGGCTGCCGTTCTACTACGA **.************** **.** ** ********.************** C1 GGTGAAGGTGGCCCTGGTGTTCTGGCTCCTCTCGCCGGCCACAAAGGGCA C2 GGTGAAGGTGGCCCTGGTGTTCTGGCTTCTCTCGCCGGCCACAAAGGGCA C3 GGTGAAGGTGGCCCTGGTGTTCTGGCTCCTCTCGCCGGCCACAAAGGGCA C4 GGTGAAGGTGGCCCTGGTGTTTTGGCTCCTCTCGCCGGCCACAAAGGGCA C5 GGTGAAGGTGGCCCTGGTGTTCTGGCTCCTCTCGCCGGCCACAAAGGGCA C6 GGTGAAGGTGGCCCTGGTCTTCTGGCTCCTCTCGCCGGCCACTAAGGGCA ****************** ** ***** **************:******* C1 GTTCGACTTTGTATCGCAAATTCGTGCATCCTATGTTGACGCGCCACGAA C2 GTTCGACTTTGTATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA C3 GTTCGACTTTATATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA C4 GTTCGACTTTGTATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA C5 GTTCGACTTTGTATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA C6 GTTCGACGCTGTATCGCAAGTTCGTGCACCCCATGTTGACGCGCCACGAA ******* *.********.******** ** ****************** C1 CAGGAGATCGACGAGTACGTGAATCAGGCCAAAGAGCGCGGCTATTCGGC C2 CAGGAGATCGACGAGTACGTGAATCAGGCCAAAGAGCGGGGCTATTCGGC C3 CAGGAGATCGACGAGTACGTGAATCAGGCCAAAGAGCGGGGCTATTCGGC C4 CAGGAGATCGACGAGTACGTGAACCAGGCCAAAGAGCGGGGCTATTCGGC C5 CAGGAGATCGACGAGTACGTAAATCAGGCCAAAGAGCGGGGCTATTCGGC C6 CAGGAGATCGACGAGTACGTGAACCAGGCCAAGGAGCGGGGCTATTCGGC ********************.** ********.***** *********** C1 GGTCCTGCAGCTGGGCTCCAAGGGAGTAAACTATGCCACCAATGTCCTCA C2 GGTGCTGCAGCTGGGCTCCAAGGGAGTAAACTATGCCACCAATGTCCTCA C3 GGTGCTGCAGCTGGGCTCCAAGGGAGTAAACTATGCCACCAATGTCCTCA C4 GGTCCTGCAGCTGGGCTCCAAGGGAGTAAACTACGCCACCAATGTCCTCA C5 GGTCCTGCAGCTGGGTTCGAAGGGAGTAAACTATGCCACCAATGTCCTCA C6 GGTCCTGCAGCTGGGCTCCAAGGGAGTCAACTATGCCACCAATGTGCTCA *** *********** ** ********.***** *********** **** C1 TGCAGACGGCCATCAAGACCTACGCGCTGACTACGGCGCCATCTGGCCAT C2 TGCAGACGGCCATCAAGACCTACGCGCTGACCACGGCACCATCTGGCCAT C3 TGCAGACGGCCATCAAGACCTACGCGCTGACCACGGCACCATCTGGCCAT C4 TGCAGACGGCCATCAAGACCTATGCGCTGACCACGGCGCCATCTGGCCAT C5 TGCAGACGGCCATCAAGACCTATGCGCTGACCACAACGCCATCTGGCGAT C6 TGCAGACGGCCATCAAGACCTATGCGCTGACCACGGCTCCATCGGGCCAG ********************** ******** **..* ***** *** * C1 GGACGCGGCCTGCAAAACTCCCATTCGGCCGATGAGCTGTACAGGGGCCA C2 GGACGCGGCCTGCAGAACTCCCATTCGGCCGATGAGCTGTTCCGGGGCCA C3 GGACGCGGCCTGCAGAACTCCCATTCGGCCGATGAGCTGTTCCGGGGCCA C4 GGACGCGGCCTGCAGAACTCCCATTCCGCGAATGAGCTGTCCCGGGACCA C5 GGACGCGGCCTGCAAAACTCCCATTCGGCCAATGAGCTGTCCCGGGGTCA C6 GGACGTGGCCTGCAGAACTCCCATTCGGCGGACGAGCTGTACCGGGGCCA ***** ********.*********** ** .* ******* *.***. ** C1 GGATACGATGGACAGCACGGAAAACTGGCTGCCGCGAGCCAGTTCCTTGA C2 GGACACAATGGACAGCACGGACAATTGGCTGCCGCGGGCCAGTTCCTTGA C3 GGACACAATGGACAGCACGGACAATTGGCTGCCGCGGGCCAGTTCCTTGA C4 GGACATGATGGACAGCACGGACAACTGGCTGCCGAGGGCCAGTTCCCTGA C5 GGACGTGATGGACAGCACGGACAACTGGCTGCCGAGGGCCAGTTCCCTGA C6 GGACACGATGGACAGCACGGACAACTGGCTGCCGCGGGCCAGTTCCCTGA *** . .**************.** *********.*.********* *** C1 GCAGCATCGAGAGCTACACAGAGACGATCTACGAGCCGAGGACCGAGACC C2 GCAGCATCGAGAGCTACACGGAGACGATCTACGAGCCGAGGACCGACACC C3 GCAGCATCGAGAGCTACACGGAGACGATCTACGAGCCGAGGACCGAGACC C4 GCAGCATCGAGAGCTACACGGAGACGATCTACGAGCCGAGAGCCGAGACC C5 GCAGCATCGAGAGCTACGCGGAGACGATCTATGAGCCGAGGGCCGAGACC C6 GCAGCATCGACAGCTATACGGAGAACATCTACGAGCCGAGGGCCGAGACC ********** ***** .*.****. ***** ********..**** *** C1 AAGCGACTGGTTATTCGAGAGGTTAGCGAGGAGGCGGAGTTCGATGATGA C2 AGGCGACTGATTATTCGAGAGGTTAGCGAGGAAGCGGAGCTCGATGATGA C3 AGGCGACTGATTATTCGAGAGGTTAGCGAGGAGGCGGAGCTCGATGATGA C4 AGGCGACTGGTTATTCGGGAGGTCAGCGAGGAGGTGGAGCACGAAGATGA C5 AGGCGACTGATTATTCGAGAGGTTAGAGAGGAGGTGGAGCAGGAAGATGA C6 AGGCGCCTGGTCATCCGTGAGGTGTCCGAGGAGGTTGAGCAGGAAGATGA *.***.***.* ** ** ***** : .*****.* *** : **:***** C1 TCCCCTGGGCGATGCCGGAGCAGCCCGTCTCCGGGACATGCCCGTCCGGA C2 GCCCCTGGGCGATGCCGGAGCAGCCCGTATCCGGGACTTGCCCGTCCGGA C3 GCCCCTGGGCGATGCCGGGGCAGCCCGTATCCGGGACTTGCCCGTCCGGA C4 GCCCCTGGGCGATGCCGGAGCAGCACGTCTCCGAGACTTGCCTGTCCGGA C5 GCCCCTGGGCGATGCCGGAGCAGCACGTCTACGAGACTTGCCTGCTCGGA C6 GCCCACGGGTGATGCCGGAGCAGCCAGGCTGCGGGACCTGCCGGTCCGGA ***. *** ********.*****..* .* **.*** **** * **** C1 AGGCACAACCACGTCGGGCTGCTAGCACTGCCAAGGCTGCAGGCAAACGC C2 AGACACAACCACGTCGTGCTGCTACCACTGCCAAGGCTACAGACAAACGC C3 AGGCACAACCACGTCGTGCTGCCAGCACTGCCAAGGCTGCAGGCAAACGC C4 AGGCTCAGCCACGTCGTGCCGCAGGTACCGCCAGAGCTGCGGGCAAACGT C5 AGGCTCAACCACGTCGTGCTGCAGGCACCGCCAGAGCTGCAGGCAAGCGC C6 AGGCGCAGCCACGTCGCGCCGCAGGCACCGCCAGAACTGGAGGCAAACGT **.* **.******** ** ** . ** ****...**. .*.***.** C1 GGCCAGAAACACAACGATATTGAGGGCGCCAGGAGCTCCAGCAGCTCCAG C2 GGCCAGAAACAGAACGATATGAAGGGAGCCAAGAGCTCCAGCAACACCAT C3 GGCCAGAAACAGAACGATGTGGAGGGAGCCAAGAGCTCCAGCAGCACCAT C4 GGCCAGAAAAACAACGATATGGAGGCCGCCGGAAGCTCTAGCTCCAGT-- C5 GGCCAGAAAAACAACGATATGGAGGCCGCCGGCAGCTCCAGCAAT----- C6 GGCCAGAAAAACAACGATACAGAAGCCGCCGCCGGCAGCTCCACCAAT-- *********.* ******. .*.* .***. .**: : *: C1 CAATGTGATCCGCTCCCGCCGCAAGCTGCGCGAACCCACGCCCGATGTGG C2 CAATGTGATCCGCTCCCGCCGCAAGCTGCGCGAACCCACGCCCGATGTGG C3 CAATGTGATCCGCTCCCGCCGCAAGCTGCGCGAACCCACGCCCGATGTGG C4 ----GTGATCCGCTCCCGGCGCAAGCTGCGCGATCCCACACCCGATGTGG C5 ----GTGATCCGCTCCCGGCGCAAGTTGCGCGATCCCACGCCCGATGTGG C6 ----GTGATCCGGTCGCGCCGCAAGCTGCGCGATCCCACGCCCGATGTGG ******** ** ** ****** *******:*****.********** C1 ATGTGGAAAACTAC--------- C2 ATGTGGAAACCTAC--------- C3 ATGTGGAAACCTAC--------- C4 ATGTGGAAAACTAC--------- C5 ATGTGGAAAACTAC--------- C6 ACGTGGAGAACTAC--------- * *****.*.**** >C1 ATGATCAGCAGCCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTACCCGGCATATGCCTCATACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACCTGC ATAGAAACATTCACGGACATATTTATCTCCTGGCTACCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTCTGGCTCCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTGTATCGCAAATTCGTGCATCCTATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAATCAGGCCAAAGAGCGCGGCTATTCGGC GGTCCTGCAGCTGGGCTCCAAGGGAGTAAACTATGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTACGCGCTGACTACGGCGCCATCTGGCCAT GGACGCGGCCTGCAAAACTCCCATTCGGCCGATGAGCTGTACAGGGGCCA GGATACGATGGACAGCACGGAAAACTGGCTGCCGCGAGCCAGTTCCTTGA GCAGCATCGAGAGCTACACAGAGACGATCTACGAGCCGAGGACCGAGACC AAGCGACTGGTTATTCGAGAGGTTAGCGAGGAGGCGGAGTTCGATGATGA TCCCCTGGGCGATGCCGGAGCAGCCCGTCTCCGGGACATGCCCGTCCGGA AGGCACAACCACGTCGGGCTGCTAGCACTGCCAAGGCTGCAGGCAAACGC GGCCAGAAACACAACGATATTGAGGGCGCCAGGAGCTCCAGCAGCTCCAG CAATGTGATCCGCTCCCGCCGCAAGCTGCGCGAACCCACGCCCGATGTGG ATGTGGAAAACTAC--------- >C2 ATGATCAGCAGCCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTACCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACATGC ATAGAAACATTCACGGACATATTCATCTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTCTGGCTTCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTGTATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAATCAGGCCAAAGAGCGGGGCTATTCGGC GGTGCTGCAGCTGGGCTCCAAGGGAGTAAACTATGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTACGCGCTGACCACGGCACCATCTGGCCAT GGACGCGGCCTGCAGAACTCCCATTCGGCCGATGAGCTGTTCCGGGGCCA GGACACAATGGACAGCACGGACAATTGGCTGCCGCGGGCCAGTTCCTTGA GCAGCATCGAGAGCTACACGGAGACGATCTACGAGCCGAGGACCGACACC AGGCGACTGATTATTCGAGAGGTTAGCGAGGAAGCGGAGCTCGATGATGA GCCCCTGGGCGATGCCGGAGCAGCCCGTATCCGGGACTTGCCCGTCCGGA AGACACAACCACGTCGTGCTGCTACCACTGCCAAGGCTACAGACAAACGC GGCCAGAAACAGAACGATATGAAGGGAGCCAAGAGCTCCAGCAACACCAT CAATGTGATCCGCTCCCGCCGCAAGCTGCGCGAACCCACGCCCGATGTGG ATGTGGAAACCTAC--------- >C3 ATGATCAGCAGCCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTACCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACATGC ATAGAAACATTCACGGACATATTCATCTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTCTGGCTCCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTATATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAATCAGGCCAAAGAGCGGGGCTATTCGGC GGTGCTGCAGCTGGGCTCCAAGGGAGTAAACTATGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTACGCGCTGACCACGGCACCATCTGGCCAT GGACGCGGCCTGCAGAACTCCCATTCGGCCGATGAGCTGTTCCGGGGCCA GGACACAATGGACAGCACGGACAATTGGCTGCCGCGGGCCAGTTCCTTGA GCAGCATCGAGAGCTACACGGAGACGATCTACGAGCCGAGGACCGAGACC AGGCGACTGATTATTCGAGAGGTTAGCGAGGAGGCGGAGCTCGATGATGA GCCCCTGGGCGATGCCGGGGCAGCCCGTATCCGGGACTTGCCCGTCCGGA AGGCACAACCACGTCGTGCTGCCAGCACTGCCAAGGCTGCAGGCAAACGC GGCCAGAAACAGAACGATGTGGAGGGAGCCAAGAGCTCCAGCAGCACCAT CAATGTGATCCGCTCCCGCCGCAAGCTGCGCGAACCCACGCCCGATGTGG ATGTGGAAACCTAC--------- >C4 ATGATCAGCAGTCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTATCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACCTGC ATAGAAACATTCACGGACATATTCATTTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTTTGGCTCCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTGTATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAACCAGGCCAAAGAGCGGGGCTATTCGGC GGTCCTGCAGCTGGGCTCCAAGGGAGTAAACTACGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTATGCGCTGACCACGGCGCCATCTGGCCAT GGACGCGGCCTGCAGAACTCCCATTCCGCGAATGAGCTGTCCCGGGACCA GGACATGATGGACAGCACGGACAACTGGCTGCCGAGGGCCAGTTCCCTGA GCAGCATCGAGAGCTACACGGAGACGATCTACGAGCCGAGAGCCGAGACC AGGCGACTGGTTATTCGGGAGGTCAGCGAGGAGGTGGAGCACGAAGATGA GCCCCTGGGCGATGCCGGAGCAGCACGTCTCCGAGACTTGCCTGTCCGGA AGGCTCAGCCACGTCGTGCCGCAGGTACCGCCAGAGCTGCGGGCAAACGT GGCCAGAAAAACAACGATATGGAGGCCGCCGGAAGCTCTAGCTCCAGT-- ----GTGATCCGCTCCCGGCGCAAGCTGCGCGATCCCACACCCGATGTGG ATGTGGAAAACTAC--------- >C5 ATGATCAGCAGTCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTACCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTTACCTGC ATAGAAACATTCACGGATATATTCATCTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTCTGGCTCCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTGTATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTAAATCAGGCCAAAGAGCGGGGCTATTCGGC GGTCCTGCAGCTGGGTTCGAAGGGAGTAAACTATGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTATGCGCTGACCACAACGCCATCTGGCGAT GGACGCGGCCTGCAAAACTCCCATTCGGCCAATGAGCTGTCCCGGGGTCA GGACGTGATGGACAGCACGGACAACTGGCTGCCGAGGGCCAGTTCCCTGA GCAGCATCGAGAGCTACGCGGAGACGATCTATGAGCCGAGGGCCGAGACC AGGCGACTGATTATTCGAGAGGTTAGAGAGGAGGTGGAGCAGGAAGATGA GCCCCTGGGCGATGCCGGAGCAGCACGTCTACGAGACTTGCCTGCTCGGA AGGCTCAACCACGTCGTGCTGCAGGCACCGCCAGAGCTGCAGGCAAGCGC GGCCAGAAAAACAACGATATGGAGGCCGCCGGCAGCTCCAGCAAT----- ----GTGATCCGCTCCCGGCGCAAGTTGCGCGATCCCACGCCCGATGTGG ATGTGGAAAACTAC--------- >C6 ATGATCAGCAGCCTGTTCTCGCGGCTTATCATATTGTTCTGCGGCACCCT GTACCCGGCCTACGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTAAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACCTGC ATCGAAACATTCACGGACATCTTCATCTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTCTTCTGGCTCCTCTCGCCGGCCACTAAGGGCA GTTCGACGCTGTATCGCAAGTTCGTGCACCCCATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAACCAGGCCAAGGAGCGGGGCTATTCGGC GGTCCTGCAGCTGGGCTCCAAGGGAGTCAACTATGCCACCAATGTGCTCA TGCAGACGGCCATCAAGACCTATGCGCTGACCACGGCTCCATCGGGCCAG GGACGTGGCCTGCAGAACTCCCATTCGGCGGACGAGCTGTACCGGGGCCA GGACACGATGGACAGCACGGACAACTGGCTGCCGCGGGCCAGTTCCCTGA GCAGCATCGACAGCTATACGGAGAACATCTACGAGCCGAGGGCCGAGACC AGGCGCCTGGTCATCCGTGAGGTGTCCGAGGAGGTTGAGCAGGAAGATGA GCCCACGGGTGATGCCGGAGCAGCCAGGCTGCGGGACCTGCCGGTCCGGA AGGCGCAGCCACGTCGCGCCGCAGGCACCGCCAGAACTGGAGGCAAACGT GGCCAGAAAAACAACGATACAGAAGCCGCCGCCGGCAGCTCCACCAAT-- ----GTGATCCGGTCGCGCCGCAAGCTGCGCGATCCCACGCCCGATGTGG ACGTGGAGAACTAC--------- >C1 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELYRGQDTMDSTENWLPRASSLSSIESYTETIYEPRTET KRLVIREVSEEAEFDDDPLGDAGAARLRDMPVRKAQPRRAASTAKAAGKR GQKHNDIEGARSSSSSSNVIRSRRKLREPTPDVDVENY >C2 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTDT RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKTQPRRAATTAKATDKR GQKQNDMKGAKSSSNTINVIRSRRKLREPTPDVDVETY >C3 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTET RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKAQPRRAASTAKAAGKR GQKQNDVEGAKSSSSTINVIRSRRKLREPTPDVDVETY >C4 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSANELSRDQDMMDSTDNWLPRASSLSSIESYTETIYEPRAET RRLVIREVSEEVEHEDEPLGDAGAARLRDLPVRKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSSSooVIRSRRKLRDPTPDVDVENY >C5 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTTPSGD GRGLQNSHSANELSRGQDVMDSTDNWLPRASSLSSIESYAETIYEPRAET RRLIIREVREEVEQEDEPLGDAGAARLRDLPARKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSNoooVIRSRRKLRDPTPDVDVENY >C6 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGQ GRGLQNSHSADELYRGQDTMDSTDNWLPRASSLSSIDSYTENIYEPRAET RRLVIREVSEEVEQEDEPTGDAGAARLRDLPVRKAQPRRAAGTARTGGKR GQKNNDTEAAAGSSTNooVIRSRRKLRDPTPDVDVENY MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 873 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1480941316 Setting output file names to "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 2054386250 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 3029658123 Seed = 2021197388 Swapseed = 1480941316 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 30 unique site patterns Division 2 has 26 unique site patterns Division 3 has 69 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2629.596910 -- -24.965149 Chain 2 -- -2653.257538 -- -24.965149 Chain 3 -- -2701.124327 -- -24.965149 Chain 4 -- -2625.086891 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2683.845871 -- -24.965149 Chain 2 -- -2653.651881 -- -24.965149 Chain 3 -- -2630.948913 -- -24.965149 Chain 4 -- -2660.057197 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2629.597] (-2653.258) (-2701.124) (-2625.087) * [-2683.846] (-2653.652) (-2630.949) (-2660.057) 500 -- (-2188.970) (-2201.101) [-2188.789] (-2200.766) * [-2191.632] (-2188.798) (-2199.999) (-2183.389) -- 0:00:00 1000 -- (-2186.295) (-2183.599) [-2178.665] (-2179.542) * [-2183.294] (-2186.241) (-2190.081) (-2183.248) -- 0:00:00 1500 -- (-2178.454) [-2180.916] (-2164.612) (-2185.715) * (-2173.447) [-2175.665] (-2179.739) (-2185.104) -- 0:00:00 2000 -- [-2156.657] (-2178.330) (-2168.402) (-2185.058) * (-2172.637) (-2166.930) [-2175.718] (-2172.673) -- 0:08:19 2500 -- [-2154.350] (-2171.680) (-2152.843) (-2177.562) * (-2165.873) (-2166.050) [-2157.656] (-2170.993) -- 0:06:39 3000 -- [-2152.336] (-2169.511) (-2157.271) (-2175.445) * (-2156.650) (-2165.258) [-2160.729] (-2160.246) -- 0:05:32 3500 -- (-2165.343) (-2161.279) [-2156.819] (-2157.951) * (-2161.332) (-2158.601) [-2160.051] (-2156.797) -- 0:04:44 4000 -- [-2153.450] (-2158.269) (-2157.778) (-2160.410) * [-2155.744] (-2166.759) (-2156.161) (-2154.199) -- 0:04:09 4500 -- [-2153.311] (-2156.451) (-2159.987) (-2160.487) * [-2159.641] (-2159.537) (-2155.101) (-2154.538) -- 0:03:41 5000 -- (-2158.465) (-2156.092) (-2159.256) [-2158.431] * (-2156.473) (-2157.297) (-2153.117) [-2159.499] -- 0:03:19 Average standard deviation of split frequencies: 0.039284 5500 -- [-2154.869] (-2162.675) (-2151.043) (-2160.578) * [-2158.464] (-2161.858) (-2159.117) (-2158.385) -- 0:06:01 6000 -- (-2156.467) (-2160.451) (-2153.424) [-2155.719] * (-2166.923) [-2156.527] (-2155.861) (-2160.588) -- 0:05:31 6500 -- (-2155.069) (-2155.852) (-2154.774) [-2153.908] * (-2159.035) (-2159.499) [-2155.105] (-2162.688) -- 0:05:05 7000 -- [-2153.113] (-2161.783) (-2162.768) (-2160.767) * (-2159.474) (-2157.508) (-2160.702) [-2158.694] -- 0:04:43 7500 -- [-2160.176] (-2163.324) (-2158.848) (-2156.228) * (-2154.221) (-2155.848) (-2160.755) [-2159.497] -- 0:04:24 8000 -- (-2160.247) (-2166.240) [-2158.192] (-2156.811) * (-2159.369) [-2158.487] (-2164.753) (-2158.236) -- 0:04:08 8500 -- [-2155.434] (-2161.413) (-2156.660) (-2160.851) * (-2160.660) [-2155.339] (-2158.948) (-2157.500) -- 0:03:53 9000 -- (-2158.310) (-2154.855) [-2152.767] (-2157.289) * (-2161.171) (-2157.599) (-2161.947) [-2155.438] -- 0:03:40 9500 -- (-2154.903) [-2156.276] (-2158.621) (-2161.345) * (-2167.087) (-2162.271) (-2156.218) [-2155.384] -- 0:05:12 10000 -- (-2156.517) (-2158.464) [-2159.892] (-2153.701) * (-2155.395) [-2155.896] (-2153.405) (-2163.163) -- 0:04:57 Average standard deviation of split frequencies: 0.011049 10500 -- (-2160.280) (-2154.934) (-2154.543) [-2164.606] * (-2157.475) (-2154.573) [-2157.001] (-2158.667) -- 0:04:42 11000 -- (-2150.883) (-2160.257) [-2160.249] (-2153.653) * (-2157.597) (-2158.695) [-2158.365] (-2153.921) -- 0:04:29 11500 -- [-2160.229] (-2155.518) (-2157.462) (-2155.709) * [-2158.220] (-2163.179) (-2157.124) (-2154.883) -- 0:04:17 12000 -- (-2154.397) [-2155.311] (-2161.702) (-2153.396) * [-2153.520] (-2156.300) (-2158.897) (-2156.271) -- 0:04:07 12500 -- (-2155.271) [-2158.144] (-2158.876) (-2151.456) * (-2161.461) (-2156.031) [-2160.461] (-2153.107) -- 0:03:57 13000 -- (-2162.160) (-2153.149) (-2158.450) [-2153.141] * (-2166.628) (-2161.093) (-2162.717) [-2162.060] -- 0:05:03 13500 -- (-2159.436) [-2156.071] (-2162.234) (-2152.640) * (-2168.760) (-2157.051) (-2156.085) [-2165.280] -- 0:04:52 14000 -- (-2160.618) (-2157.551) (-2158.599) [-2153.519] * (-2155.902) (-2155.559) (-2159.018) [-2156.691] -- 0:04:41 14500 -- [-2157.991] (-2161.350) (-2154.376) (-2154.388) * [-2156.576] (-2150.303) (-2157.135) (-2158.807) -- 0:04:31 15000 -- (-2162.127) (-2150.481) (-2158.976) [-2151.641] * (-2167.758) (-2155.192) [-2153.990] (-2159.948) -- 0:04:22 Average standard deviation of split frequencies: 0.007366 15500 -- (-2160.891) [-2151.890] (-2160.513) (-2152.318) * (-2160.717) [-2155.311] (-2154.600) (-2153.121) -- 0:04:14 16000 -- [-2159.363] (-2157.077) (-2158.093) (-2155.189) * (-2156.398) (-2155.734) [-2152.071] (-2155.853) -- 0:04:06 16500 -- (-2158.546) (-2156.707) (-2164.191) [-2158.247] * (-2157.744) (-2155.352) (-2157.958) [-2158.436] -- 0:03:58 17000 -- (-2159.845) (-2154.984) (-2158.790) [-2155.449] * (-2157.799) (-2157.603) (-2159.009) [-2154.988] -- 0:04:49 17500 -- [-2154.222] (-2157.883) (-2161.475) (-2156.784) * [-2152.426] (-2162.627) (-2152.898) (-2161.164) -- 0:04:40 18000 -- (-2155.887) [-2150.815] (-2160.643) (-2159.414) * (-2159.798) (-2166.123) (-2154.108) [-2156.447] -- 0:04:32 18500 -- (-2155.913) [-2156.126] (-2161.436) (-2158.820) * (-2155.415) (-2161.375) [-2150.596] (-2166.240) -- 0:04:25 19000 -- (-2152.691) [-2157.823] (-2153.698) (-2158.257) * (-2155.182) (-2159.523) [-2155.851] (-2162.738) -- 0:04:18 19500 -- (-2159.409) (-2153.386) (-2161.484) [-2159.815] * (-2158.283) (-2154.329) [-2153.649] (-2164.646) -- 0:04:11 20000 -- [-2157.735] (-2158.724) (-2155.366) (-2155.195) * (-2156.300) (-2159.941) [-2153.600] (-2160.925) -- 0:04:05 Average standard deviation of split frequencies: 0.028512 20500 -- [-2156.455] (-2161.496) (-2154.940) (-2157.064) * (-2160.216) (-2163.745) (-2157.043) [-2152.943] -- 0:04:46 21000 -- [-2159.749] (-2155.730) (-2160.216) (-2164.033) * (-2162.615) (-2152.793) [-2153.464] (-2156.264) -- 0:04:39 21500 -- (-2158.750) [-2154.812] (-2153.952) (-2162.228) * [-2157.838] (-2158.638) (-2159.443) (-2160.866) -- 0:04:33 22000 -- (-2158.442) [-2158.074] (-2156.956) (-2161.204) * [-2160.459] (-2160.225) (-2163.141) (-2159.723) -- 0:04:26 22500 -- (-2155.188) (-2154.337) (-2160.376) [-2157.032] * [-2156.799] (-2158.113) (-2155.094) (-2155.262) -- 0:04:20 23000 -- [-2157.703] (-2151.600) (-2159.704) (-2153.671) * (-2150.510) (-2157.028) (-2154.772) [-2157.075] -- 0:04:14 23500 -- (-2157.399) (-2161.218) [-2153.838] (-2159.599) * (-2158.170) (-2151.166) (-2164.419) [-2157.765] -- 0:04:09 24000 -- (-2154.676) [-2154.671] (-2157.274) (-2156.943) * (-2157.166) (-2158.968) (-2153.396) [-2157.450] -- 0:04:04 24500 -- (-2158.782) [-2160.882] (-2154.579) (-2157.913) * [-2163.019] (-2158.260) (-2151.822) (-2154.219) -- 0:04:38 25000 -- (-2150.098) (-2157.103) (-2160.097) [-2158.740] * (-2161.189) [-2159.274] (-2153.749) (-2161.616) -- 0:04:33 Average standard deviation of split frequencies: 0.004533 25500 -- (-2157.352) (-2159.838) [-2155.783] (-2161.907) * [-2152.772] (-2156.489) (-2168.159) (-2156.731) -- 0:04:27 26000 -- (-2158.088) (-2162.029) (-2157.381) [-2161.768] * (-2165.267) (-2162.379) [-2151.104] (-2154.411) -- 0:04:22 26500 -- (-2154.329) (-2158.000) [-2154.216] (-2159.391) * [-2153.090] (-2159.972) (-2152.862) (-2159.533) -- 0:04:17 27000 -- (-2164.840) [-2164.481] (-2150.583) (-2154.687) * (-2155.951) (-2156.030) [-2156.246] (-2151.992) -- 0:04:12 27500 -- (-2156.592) (-2152.086) (-2153.049) [-2155.420] * (-2153.555) [-2151.235] (-2156.509) (-2159.990) -- 0:04:07 28000 -- (-2158.259) (-2153.001) [-2152.311] (-2159.907) * (-2161.212) [-2152.366] (-2158.172) (-2157.571) -- 0:04:03 28500 -- [-2156.161] (-2159.168) (-2160.250) (-2152.944) * [-2158.890] (-2161.845) (-2156.467) (-2158.138) -- 0:04:32 29000 -- (-2161.599) [-2155.466] (-2167.555) (-2151.977) * [-2158.021] (-2158.814) (-2154.941) (-2154.658) -- 0:04:27 29500 -- (-2156.405) [-2162.180] (-2159.315) (-2153.771) * (-2164.514) (-2155.418) [-2154.997] (-2162.232) -- 0:04:23 30000 -- (-2162.821) (-2158.191) [-2155.995] (-2154.078) * (-2167.385) [-2155.175] (-2157.528) (-2159.743) -- 0:04:18 Average standard deviation of split frequencies: 0.003843 30500 -- (-2154.760) (-2163.812) [-2159.494] (-2153.551) * (-2161.849) (-2154.970) (-2155.011) [-2158.402] -- 0:04:14 31000 -- (-2155.880) [-2155.255] (-2153.840) (-2159.180) * (-2156.215) (-2161.289) (-2154.074) [-2151.025] -- 0:04:10 31500 -- (-2159.027) (-2161.582) [-2156.188] (-2155.245) * (-2160.810) (-2171.134) [-2153.337] (-2158.885) -- 0:04:05 32000 -- (-2164.379) [-2155.595] (-2154.542) (-2152.424) * (-2164.905) (-2156.934) (-2154.869) [-2158.204] -- 0:04:32 32500 -- (-2160.196) [-2155.596] (-2163.318) (-2153.735) * (-2157.151) [-2156.148] (-2154.056) (-2159.042) -- 0:04:27 33000 -- (-2164.308) (-2159.845) [-2154.430] (-2156.252) * [-2152.355] (-2157.655) (-2159.371) (-2158.959) -- 0:04:23 33500 -- (-2154.430) (-2157.579) (-2153.923) [-2154.342] * (-2159.453) (-2159.554) (-2154.553) [-2153.576] -- 0:04:19 34000 -- [-2155.627] (-2151.838) (-2160.213) (-2152.450) * (-2167.025) [-2158.188] (-2157.712) (-2157.539) -- 0:04:15 34500 -- (-2156.300) (-2156.802) (-2156.806) [-2157.146] * (-2155.420) (-2157.098) [-2157.960] (-2159.935) -- 0:04:11 35000 -- (-2156.497) (-2162.143) [-2154.735] (-2156.777) * (-2159.048) (-2154.053) [-2153.681] (-2161.864) -- 0:04:08 Average standard deviation of split frequencies: 0.016368 35500 -- (-2158.797) [-2155.338] (-2153.955) (-2156.591) * (-2152.091) (-2157.380) [-2154.940] (-2159.404) -- 0:04:04 36000 -- (-2155.153) (-2159.997) (-2160.042) [-2165.385] * (-2153.554) (-2158.487) [-2158.593] (-2161.920) -- 0:04:27 36500 -- [-2153.521] (-2162.426) (-2154.828) (-2151.842) * (-2155.197) (-2157.569) [-2164.196] (-2162.808) -- 0:04:23 37000 -- (-2157.268) (-2153.746) [-2161.615] (-2158.683) * (-2158.392) [-2152.701] (-2159.862) (-2155.136) -- 0:04:20 37500 -- [-2155.011] (-2159.147) (-2163.699) (-2164.215) * (-2159.870) [-2153.504] (-2156.697) (-2157.059) -- 0:04:16 38000 -- (-2161.528) [-2151.752] (-2156.700) (-2155.891) * [-2153.246] (-2156.691) (-2156.117) (-2157.194) -- 0:04:13 38500 -- (-2154.699) (-2156.652) (-2160.423) [-2154.439] * (-2154.512) [-2150.729] (-2156.193) (-2153.310) -- 0:04:09 39000 -- [-2155.876] (-2156.481) (-2167.062) (-2162.068) * [-2151.883] (-2154.285) (-2156.074) (-2158.554) -- 0:04:06 39500 -- (-2154.448) [-2156.055] (-2167.262) (-2160.656) * (-2160.109) (-2154.143) (-2152.379) [-2153.809] -- 0:04:27 40000 -- [-2153.684] (-2158.038) (-2163.062) (-2160.646) * (-2156.989) (-2168.382) (-2158.698) [-2155.352] -- 0:04:24 Average standard deviation of split frequencies: 0.020286 40500 -- [-2153.013] (-2153.234) (-2154.807) (-2156.875) * [-2156.043] (-2160.885) (-2155.722) (-2160.663) -- 0:04:20 41000 -- (-2150.978) (-2154.528) [-2158.172] (-2159.071) * (-2154.896) (-2161.065) [-2156.202] (-2163.514) -- 0:04:17 41500 -- [-2154.890] (-2153.167) (-2155.465) (-2153.730) * (-2162.354) (-2157.800) (-2164.534) [-2156.749] -- 0:04:14 42000 -- [-2152.316] (-2150.753) (-2156.828) (-2155.427) * [-2164.473] (-2155.001) (-2156.047) (-2161.343) -- 0:04:10 42500 -- [-2154.704] (-2157.342) (-2157.475) (-2159.812) * (-2164.636) (-2161.619) [-2158.050] (-2158.941) -- 0:04:07 43000 -- [-2156.780] (-2163.459) (-2155.345) (-2160.333) * (-2153.640) (-2153.343) (-2162.413) [-2161.376] -- 0:04:04 43500 -- (-2153.751) [-2153.683] (-2152.652) (-2161.080) * (-2154.472) [-2155.941] (-2163.855) (-2158.890) -- 0:04:23 44000 -- (-2162.059) (-2153.514) [-2154.762] (-2162.443) * [-2154.095] (-2157.909) (-2157.446) (-2161.940) -- 0:04:20 44500 -- (-2153.804) [-2152.606] (-2157.383) (-2166.719) * (-2157.212) (-2166.467) (-2157.858) [-2158.060] -- 0:04:17 45000 -- (-2158.959) [-2155.309] (-2158.874) (-2171.322) * (-2156.085) [-2154.824] (-2157.768) (-2157.692) -- 0:04:14 Average standard deviation of split frequencies: 0.010248 45500 -- [-2154.091] (-2161.209) (-2160.829) (-2168.049) * (-2155.509) (-2156.101) (-2167.732) [-2159.244] -- 0:04:11 46000 -- [-2167.372] (-2156.250) (-2158.563) (-2173.527) * (-2162.166) [-2157.264] (-2156.772) (-2155.933) -- 0:04:08 46500 -- (-2153.185) [-2153.196] (-2162.550) (-2169.910) * (-2163.615) (-2155.693) [-2152.224] (-2153.154) -- 0:04:06 47000 -- (-2153.420) (-2154.637) [-2159.118] (-2166.509) * (-2154.817) (-2161.553) [-2158.030] (-2155.694) -- 0:04:23 47500 -- (-2156.832) [-2155.320] (-2160.018) (-2168.929) * (-2159.448) (-2161.136) [-2152.387] (-2156.730) -- 0:04:20 48000 -- (-2154.284) (-2154.877) [-2157.437] (-2160.234) * (-2154.302) (-2162.431) (-2156.638) [-2155.610] -- 0:04:17 48500 -- (-2154.212) [-2157.015] (-2159.328) (-2165.010) * (-2156.859) (-2162.012) [-2170.856] (-2157.957) -- 0:04:15 49000 -- (-2153.672) (-2155.170) [-2166.294] (-2163.115) * [-2152.148] (-2159.728) (-2166.162) (-2153.293) -- 0:04:12 49500 -- [-2156.634] (-2160.064) (-2156.468) (-2166.299) * (-2155.509) (-2155.835) (-2158.263) [-2154.506] -- 0:04:09 50000 -- (-2153.473) (-2152.575) [-2155.156] (-2162.217) * [-2152.230] (-2155.666) (-2156.882) (-2158.996) -- 0:04:06 Average standard deviation of split frequencies: 0.006978 50500 -- (-2153.807) [-2153.442] (-2160.158) (-2163.380) * (-2163.729) [-2157.954] (-2154.269) (-2162.180) -- 0:04:23 51000 -- (-2156.832) (-2156.746) [-2157.579] (-2163.117) * [-2157.616] (-2156.529) (-2163.733) (-2156.773) -- 0:04:20 51500 -- (-2160.417) [-2151.820] (-2162.921) (-2162.320) * (-2154.462) (-2152.759) (-2166.229) [-2150.528] -- 0:04:17 52000 -- (-2156.410) (-2157.413) [-2163.634] (-2158.849) * [-2155.217] (-2154.168) (-2155.585) (-2160.865) -- 0:04:15 52500 -- (-2156.812) [-2157.311] (-2161.116) (-2160.200) * (-2163.776) (-2157.885) [-2159.331] (-2163.993) -- 0:04:12 53000 -- (-2154.934) (-2156.503) [-2161.924] (-2157.592) * [-2156.911] (-2155.042) (-2158.974) (-2163.532) -- 0:04:10 53500 -- (-2156.296) (-2157.028) [-2154.984] (-2152.522) * (-2155.288) [-2156.849] (-2157.420) (-2165.509) -- 0:04:07 54000 -- (-2158.435) (-2161.112) [-2152.500] (-2153.212) * (-2155.307) (-2163.262) [-2159.972] (-2157.337) -- 0:04:05 54500 -- (-2153.455) (-2167.164) [-2152.706] (-2167.989) * (-2155.164) [-2155.100] (-2157.876) (-2153.474) -- 0:04:20 55000 -- (-2157.703) (-2154.053) [-2158.921] (-2153.464) * (-2158.045) (-2154.948) (-2150.596) [-2158.032] -- 0:04:17 Average standard deviation of split frequencies: 0.012627 55500 -- (-2163.824) [-2156.105] (-2153.662) (-2155.155) * [-2153.831] (-2157.992) (-2155.649) (-2155.821) -- 0:04:15 56000 -- (-2161.930) [-2156.519] (-2156.707) (-2157.964) * [-2155.941] (-2160.910) (-2155.713) (-2153.306) -- 0:04:12 56500 -- (-2156.747) [-2158.296] (-2151.923) (-2160.376) * (-2155.439) (-2157.925) [-2153.323] (-2161.095) -- 0:04:10 57000 -- (-2155.820) (-2154.632) (-2157.414) [-2157.977] * [-2154.709] (-2156.005) (-2154.629) (-2152.114) -- 0:04:08 57500 -- (-2159.625) [-2152.217] (-2150.846) (-2157.149) * (-2160.299) (-2157.061) [-2163.584] (-2157.900) -- 0:04:05 58000 -- [-2156.722] (-2158.631) (-2157.999) (-2151.216) * [-2151.562] (-2159.676) (-2159.504) (-2153.376) -- 0:04:03 58500 -- [-2154.819] (-2158.083) (-2154.057) (-2153.214) * (-2151.227) [-2165.705] (-2160.658) (-2151.773) -- 0:04:17 59000 -- (-2156.734) [-2157.806] (-2153.398) (-2155.672) * [-2159.660] (-2155.828) (-2153.193) (-2161.765) -- 0:04:15 59500 -- (-2159.602) [-2160.713] (-2159.001) (-2157.040) * [-2154.060] (-2160.317) (-2154.810) (-2155.749) -- 0:04:12 60000 -- (-2161.706) (-2156.178) (-2153.319) [-2156.645] * (-2158.015) (-2154.662) [-2154.636] (-2158.919) -- 0:04:10 Average standard deviation of split frequencies: 0.021369 60500 -- (-2152.086) [-2157.348] (-2152.794) (-2162.229) * [-2153.133] (-2158.622) (-2162.749) (-2160.345) -- 0:04:08 61000 -- (-2153.867) [-2160.036] (-2158.684) (-2177.801) * (-2155.994) (-2158.999) [-2155.097] (-2156.989) -- 0:04:06 61500 -- (-2155.860) [-2151.797] (-2161.013) (-2166.165) * (-2161.930) (-2156.403) [-2161.850] (-2159.799) -- 0:04:04 62000 -- [-2154.958] (-2157.091) (-2159.526) (-2165.561) * [-2155.407] (-2160.444) (-2153.621) (-2156.767) -- 0:04:17 62500 -- (-2152.800) [-2152.064] (-2154.561) (-2156.266) * [-2154.216] (-2161.137) (-2158.341) (-2154.809) -- 0:04:15 63000 -- (-2153.379) [-2152.550] (-2154.410) (-2157.843) * (-2157.813) (-2163.094) (-2153.101) [-2151.356] -- 0:04:12 63500 -- (-2155.561) [-2159.044] (-2158.522) (-2156.893) * (-2160.686) [-2157.866] (-2158.448) (-2150.885) -- 0:04:10 64000 -- (-2155.379) (-2155.535) (-2168.177) [-2154.215] * [-2155.959] (-2161.438) (-2151.644) (-2155.369) -- 0:04:08 64500 -- [-2157.270] (-2154.862) (-2158.813) (-2158.069) * (-2166.265) (-2155.848) [-2155.192] (-2157.857) -- 0:04:06 65000 -- (-2158.230) [-2155.700] (-2158.848) (-2163.860) * (-2169.902) (-2158.989) [-2155.636] (-2153.355) -- 0:04:04 Average standard deviation of split frequencies: 0.028570 65500 -- [-2155.039] (-2153.709) (-2157.890) (-2158.056) * (-2164.490) (-2157.327) [-2152.483] (-2156.607) -- 0:04:02 66000 -- (-2163.424) (-2160.369) (-2161.791) [-2156.415] * (-2168.649) (-2155.441) (-2156.961) [-2151.442] -- 0:04:14 66500 -- [-2154.132] (-2155.226) (-2156.366) (-2156.418) * (-2154.743) (-2162.697) (-2160.313) [-2156.455] -- 0:04:12 67000 -- (-2161.032) [-2159.133] (-2163.676) (-2163.906) * (-2158.150) (-2162.018) (-2159.015) [-2156.131] -- 0:04:10 67500 -- (-2157.045) [-2156.935] (-2159.300) (-2157.080) * (-2156.328) (-2162.729) [-2160.097] (-2157.973) -- 0:04:08 68000 -- (-2153.933) (-2158.639) [-2160.336] (-2151.057) * [-2160.131] (-2160.145) (-2156.098) (-2158.236) -- 0:04:06 68500 -- (-2155.124) [-2155.323] (-2158.990) (-2159.941) * (-2157.102) (-2158.579) [-2156.722] (-2162.000) -- 0:04:04 69000 -- (-2164.050) [-2154.321] (-2161.087) (-2154.957) * [-2155.644] (-2161.826) (-2155.223) (-2171.458) -- 0:04:02 69500 -- (-2154.758) [-2153.857] (-2156.019) (-2163.506) * (-2154.645) (-2156.132) [-2156.196] (-2162.552) -- 0:04:00 70000 -- (-2161.579) (-2154.302) [-2150.768] (-2164.687) * (-2162.174) (-2162.565) [-2151.395] (-2160.052) -- 0:04:12 Average standard deviation of split frequencies: 0.023348 70500 -- [-2151.893] (-2158.048) (-2152.467) (-2162.816) * (-2153.809) (-2158.826) [-2154.047] (-2156.105) -- 0:04:10 71000 -- (-2155.580) (-2159.639) [-2162.510] (-2153.575) * (-2163.644) (-2164.585) (-2160.596) [-2150.275] -- 0:04:08 71500 -- (-2156.250) (-2155.668) (-2157.814) [-2157.498] * (-2151.320) (-2161.968) (-2153.327) [-2152.947] -- 0:04:06 72000 -- (-2153.884) (-2152.855) (-2152.822) [-2151.249] * (-2153.077) (-2159.552) [-2153.779] (-2160.946) -- 0:04:04 72500 -- [-2156.256] (-2156.513) (-2159.697) (-2151.501) * (-2152.575) (-2161.461) [-2152.252] (-2158.523) -- 0:04:03 73000 -- (-2157.765) [-2160.990] (-2161.110) (-2155.070) * (-2160.118) [-2160.100] (-2155.373) (-2166.150) -- 0:04:01 73500 -- (-2157.434) [-2153.360] (-2156.655) (-2155.519) * [-2156.039] (-2160.644) (-2157.152) (-2160.195) -- 0:04:12 74000 -- [-2156.641] (-2157.313) (-2155.008) (-2162.542) * (-2163.947) (-2165.245) [-2156.566] (-2158.930) -- 0:04:10 74500 -- (-2160.043) (-2153.981) (-2155.260) [-2155.929] * (-2156.745) (-2158.133) (-2154.508) [-2157.261] -- 0:04:08 75000 -- (-2160.950) [-2156.215] (-2158.283) (-2159.281) * [-2153.844] (-2160.601) (-2163.338) (-2152.844) -- 0:04:06 Average standard deviation of split frequencies: 0.018608 75500 -- (-2165.289) [-2162.229] (-2156.174) (-2156.295) * (-2161.334) [-2159.137] (-2157.600) (-2156.707) -- 0:04:04 76000 -- (-2157.035) (-2159.787) [-2152.711] (-2159.137) * (-2166.072) (-2157.010) [-2162.382] (-2152.405) -- 0:04:03 76500 -- (-2155.931) [-2158.475] (-2159.593) (-2163.398) * [-2152.715] (-2162.252) (-2157.822) (-2160.663) -- 0:04:01 77000 -- (-2152.244) (-2156.047) [-2156.095] (-2154.717) * (-2152.046) (-2159.229) [-2157.993] (-2152.070) -- 0:03:59 77500 -- [-2155.512] (-2155.636) (-2161.263) (-2156.927) * (-2161.914) (-2154.445) [-2158.946] (-2160.043) -- 0:04:09 78000 -- (-2164.322) (-2159.980) (-2160.677) [-2161.936] * (-2160.260) [-2155.883] (-2155.993) (-2161.925) -- 0:04:08 78500 -- [-2159.849] (-2160.111) (-2163.929) (-2165.168) * (-2159.303) [-2154.212] (-2158.717) (-2152.892) -- 0:04:06 79000 -- (-2153.809) [-2166.763] (-2156.699) (-2156.851) * (-2155.201) (-2157.421) (-2163.097) [-2157.241] -- 0:04:04 79500 -- [-2152.691] (-2161.270) (-2162.280) (-2166.538) * (-2158.409) (-2155.132) (-2156.391) [-2153.816] -- 0:04:03 80000 -- [-2157.156] (-2162.082) (-2171.140) (-2163.735) * (-2166.565) (-2163.084) [-2155.324] (-2154.699) -- 0:04:01 Average standard deviation of split frequencies: 0.005844 80500 -- (-2162.260) [-2154.667] (-2158.661) (-2160.325) * (-2160.694) (-2154.368) [-2154.485] (-2153.241) -- 0:03:59 81000 -- (-2162.322) [-2159.811] (-2155.506) (-2161.367) * (-2155.086) (-2160.882) [-2154.344] (-2155.590) -- 0:04:09 81500 -- (-2163.044) (-2164.996) (-2157.040) [-2161.446] * (-2152.723) (-2158.308) [-2156.288] (-2154.229) -- 0:04:07 82000 -- [-2156.962] (-2170.309) (-2157.433) (-2158.783) * [-2153.078] (-2160.093) (-2159.252) (-2158.132) -- 0:04:06 82500 -- (-2157.345) (-2167.927) [-2160.346] (-2159.354) * (-2155.107) (-2155.316) [-2153.274] (-2156.953) -- 0:04:04 83000 -- [-2154.801] (-2167.002) (-2160.520) (-2159.389) * (-2155.825) (-2159.959) [-2154.825] (-2156.984) -- 0:04:03 83500 -- (-2157.945) [-2156.529] (-2160.030) (-2162.666) * (-2153.175) [-2158.080] (-2160.870) (-2154.077) -- 0:04:01 84000 -- (-2168.528) (-2159.787) (-2161.184) [-2155.412] * (-2158.093) (-2150.779) [-2151.364] (-2160.479) -- 0:03:59 84500 -- (-2152.136) (-2162.127) (-2157.591) [-2159.014] * [-2151.542] (-2154.179) (-2157.798) (-2164.418) -- 0:03:58 85000 -- (-2157.302) (-2156.370) (-2158.019) [-2154.462] * (-2149.705) (-2156.353) [-2152.970] (-2162.176) -- 0:04:07 Average standard deviation of split frequencies: 0.010963 85500 -- (-2158.903) (-2166.801) (-2152.261) [-2151.894] * (-2156.540) (-2156.842) [-2155.212] (-2158.678) -- 0:04:06 86000 -- [-2152.470] (-2156.158) (-2165.281) (-2154.727) * (-2165.143) [-2152.969] (-2172.191) (-2162.015) -- 0:04:04 86500 -- (-2158.195) (-2161.079) [-2159.921] (-2156.786) * (-2151.965) (-2150.684) [-2155.531] (-2159.137) -- 0:04:02 87000 -- [-2154.696] (-2160.014) (-2163.306) (-2160.625) * (-2158.137) [-2154.608] (-2154.080) (-2170.243) -- 0:04:01 87500 -- (-2157.049) (-2153.950) [-2158.057] (-2161.021) * (-2159.013) (-2165.737) [-2152.455] (-2171.165) -- 0:03:59 88000 -- (-2152.590) [-2157.767] (-2154.023) (-2155.136) * (-2165.108) (-2157.689) (-2157.162) [-2155.946] -- 0:03:58 88500 -- (-2158.052) (-2158.348) [-2154.222] (-2159.516) * (-2154.777) (-2154.215) (-2157.481) [-2155.445] -- 0:04:07 89000 -- (-2155.455) (-2151.697) [-2155.026] (-2164.111) * (-2150.506) [-2153.773] (-2166.130) (-2153.412) -- 0:04:05 89500 -- (-2160.637) [-2157.726] (-2158.977) (-2169.838) * (-2155.524) (-2157.886) (-2159.478) [-2150.912] -- 0:04:04 90000 -- [-2151.881] (-2163.702) (-2156.545) (-2164.291) * (-2161.970) (-2155.303) [-2154.853] (-2154.705) -- 0:04:02 Average standard deviation of split frequencies: 0.010399 90500 -- (-2154.335) (-2157.732) [-2167.723] (-2156.733) * [-2157.651] (-2160.065) (-2159.147) (-2158.300) -- 0:04:01 91000 -- (-2153.352) (-2163.670) (-2163.477) [-2154.922] * [-2153.596] (-2159.788) (-2159.901) (-2156.230) -- 0:03:59 91500 -- (-2153.077) (-2160.081) (-2160.237) [-2155.885] * [-2154.067] (-2167.669) (-2155.676) (-2159.460) -- 0:03:58 92000 -- [-2150.879] (-2160.441) (-2156.413) (-2165.036) * [-2151.261] (-2160.812) (-2157.098) (-2153.733) -- 0:03:56 92500 -- (-2153.444) [-2154.457] (-2160.673) (-2157.382) * (-2158.148) (-2153.604) [-2154.619] (-2154.493) -- 0:04:05 93000 -- [-2152.181] (-2157.675) (-2157.165) (-2158.933) * (-2153.036) (-2159.096) (-2154.709) [-2156.981] -- 0:04:03 93500 -- (-2154.965) [-2160.993] (-2152.957) (-2159.821) * (-2152.104) (-2155.294) [-2156.920] (-2159.729) -- 0:04:02 94000 -- (-2164.069) (-2168.881) [-2157.586] (-2156.662) * (-2152.366) (-2159.990) (-2157.403) [-2156.263] -- 0:04:00 94500 -- [-2157.348] (-2163.774) (-2156.276) (-2156.063) * (-2154.013) [-2157.022] (-2153.389) (-2151.584) -- 0:03:59 95000 -- [-2160.436] (-2156.894) (-2155.967) (-2161.147) * [-2151.292] (-2160.313) (-2156.093) (-2151.523) -- 0:03:58 Average standard deviation of split frequencies: 0.011049 95500 -- (-2158.282) (-2170.596) (-2159.964) [-2156.936] * (-2161.328) (-2158.086) (-2154.097) [-2151.679] -- 0:03:56 96000 -- (-2157.712) (-2173.456) [-2159.702] (-2160.619) * (-2156.727) [-2161.162] (-2156.862) (-2161.576) -- 0:04:04 96500 -- (-2163.773) (-2161.484) [-2154.231] (-2155.766) * (-2160.504) (-2155.484) (-2152.657) [-2154.862] -- 0:04:03 97000 -- (-2155.867) (-2160.542) [-2157.935] (-2160.227) * (-2161.409) (-2153.266) (-2161.113) [-2158.727] -- 0:04:02 97500 -- (-2163.457) (-2152.570) (-2160.894) [-2157.179] * (-2161.666) (-2162.855) [-2153.753] (-2158.631) -- 0:04:00 98000 -- (-2156.377) (-2160.616) [-2160.409] (-2158.652) * (-2156.901) (-2153.206) (-2161.849) [-2165.982] -- 0:03:59 98500 -- (-2166.205) (-2157.916) [-2156.976] (-2157.022) * (-2160.526) (-2151.171) (-2156.886) [-2149.649] -- 0:03:57 99000 -- (-2154.709) [-2159.764] (-2173.075) (-2153.973) * (-2159.073) (-2152.432) [-2156.036] (-2156.210) -- 0:03:56 99500 -- (-2161.263) [-2159.848] (-2160.763) (-2152.948) * (-2157.359) (-2158.442) [-2159.101] (-2161.205) -- 0:03:55 100000 -- (-2160.067) (-2161.402) (-2164.742) [-2155.069] * (-2157.180) [-2155.982] (-2158.561) (-2162.392) -- 0:04:03 Average standard deviation of split frequencies: 0.021073 100500 -- (-2156.596) [-2155.787] (-2160.514) (-2154.388) * [-2158.443] (-2158.088) (-2163.057) (-2165.371) -- 0:04:01 101000 -- (-2156.703) [-2155.950] (-2159.339) (-2165.860) * [-2156.521] (-2158.166) (-2162.276) (-2161.371) -- 0:04:00 101500 -- [-2163.961] (-2159.372) (-2158.369) (-2158.196) * [-2152.733] (-2159.340) (-2160.119) (-2157.096) -- 0:03:59 102000 -- (-2160.065) (-2157.780) [-2160.819] (-2161.758) * (-2157.696) (-2162.841) (-2156.578) [-2159.640] -- 0:03:57 102500 -- (-2159.420) (-2151.754) [-2151.771] (-2166.845) * [-2150.305] (-2161.245) (-2157.546) (-2161.878) -- 0:03:56 103000 -- (-2159.176) (-2156.993) [-2151.575] (-2163.654) * (-2156.032) (-2154.932) (-2154.676) [-2158.211] -- 0:03:55 103500 -- (-2153.266) (-2158.380) (-2156.237) [-2154.887] * (-2152.846) (-2155.278) [-2153.912] (-2153.521) -- 0:04:02 104000 -- (-2156.988) [-2159.089] (-2157.957) (-2156.682) * (-2153.493) (-2157.605) [-2163.907] (-2154.680) -- 0:04:01 104500 -- (-2158.793) [-2154.243] (-2159.315) (-2153.965) * [-2152.912] (-2161.760) (-2157.107) (-2155.141) -- 0:03:59 105000 -- (-2156.685) [-2151.285] (-2160.337) (-2155.398) * [-2154.435] (-2154.838) (-2156.015) (-2150.968) -- 0:03:58 Average standard deviation of split frequencies: 0.017789 105500 -- (-2161.063) [-2153.638] (-2157.762) (-2154.346) * (-2154.461) (-2160.206) (-2156.205) [-2157.754] -- 0:03:57 106000 -- (-2158.713) (-2154.915) (-2161.283) [-2151.181] * (-2159.690) (-2157.925) (-2161.468) [-2160.737] -- 0:03:56 106500 -- (-2158.053) [-2155.215] (-2154.784) (-2155.784) * [-2155.735] (-2153.451) (-2160.918) (-2164.102) -- 0:03:54 107000 -- (-2157.894) [-2157.258] (-2156.982) (-2157.420) * [-2161.086] (-2160.289) (-2168.020) (-2165.053) -- 0:03:53 107500 -- (-2159.487) (-2159.852) (-2158.810) [-2160.270] * (-2158.965) (-2160.098) (-2156.564) [-2155.297] -- 0:04:00 108000 -- (-2162.485) (-2163.328) (-2160.503) [-2156.000] * [-2156.440] (-2156.132) (-2156.257) (-2155.105) -- 0:03:59 108500 -- (-2154.321) [-2163.680] (-2164.100) (-2163.767) * [-2156.233] (-2158.681) (-2159.345) (-2155.859) -- 0:03:58 109000 -- (-2155.248) (-2168.357) (-2166.384) [-2160.553] * (-2150.524) (-2156.762) (-2158.890) [-2154.933] -- 0:03:57 109500 -- (-2154.154) (-2162.798) (-2168.067) [-2161.559] * [-2150.932] (-2160.060) (-2155.968) (-2158.789) -- 0:03:55 110000 -- [-2157.691] (-2164.423) (-2164.887) (-2156.452) * [-2155.018] (-2160.102) (-2155.348) (-2160.814) -- 0:03:54 Average standard deviation of split frequencies: 0.021298 110500 -- [-2161.596] (-2163.482) (-2155.454) (-2153.592) * (-2153.663) (-2158.267) [-2158.141] (-2165.313) -- 0:03:53 111000 -- [-2154.851] (-2159.139) (-2156.502) (-2154.411) * (-2160.420) (-2163.535) (-2156.748) [-2154.968] -- 0:03:52 111500 -- (-2153.858) (-2158.213) (-2161.680) [-2154.419] * (-2163.324) [-2157.227] (-2162.972) (-2158.984) -- 0:03:59 112000 -- (-2153.104) (-2156.194) [-2154.781] (-2159.274) * (-2159.628) (-2164.573) (-2162.320) [-2156.279] -- 0:03:57 112500 -- (-2152.949) (-2161.316) (-2157.547) [-2154.139] * (-2162.220) [-2154.752] (-2164.227) (-2156.685) -- 0:03:56 113000 -- (-2158.023) (-2155.221) [-2157.883] (-2160.361) * [-2160.734] (-2157.740) (-2175.355) (-2152.862) -- 0:03:55 113500 -- (-2157.453) (-2152.409) [-2159.850] (-2156.027) * (-2154.466) [-2155.198] (-2161.636) (-2151.853) -- 0:03:54 114000 -- (-2164.824) [-2149.218] (-2159.536) (-2155.336) * [-2157.651] (-2155.930) (-2165.585) (-2157.493) -- 0:03:53 114500 -- (-2158.803) (-2159.977) [-2165.500] (-2154.182) * (-2153.901) [-2156.124] (-2161.855) (-2155.669) -- 0:03:52 115000 -- (-2161.314) [-2153.479] (-2161.508) (-2154.288) * (-2162.273) [-2156.404] (-2164.927) (-2155.353) -- 0:03:58 Average standard deviation of split frequencies: 0.017271 115500 -- (-2160.195) (-2162.380) (-2156.936) [-2158.030] * [-2158.987] (-2159.070) (-2160.237) (-2156.265) -- 0:03:57 116000 -- (-2159.450) (-2160.016) [-2155.429] (-2154.624) * [-2165.215] (-2159.362) (-2155.693) (-2157.689) -- 0:03:56 116500 -- (-2157.487) [-2154.141] (-2157.769) (-2155.471) * (-2154.038) (-2156.947) [-2155.055] (-2155.759) -- 0:03:55 117000 -- (-2155.450) (-2160.895) (-2156.263) [-2156.834] * [-2160.249] (-2157.689) (-2157.670) (-2155.479) -- 0:03:53 117500 -- (-2158.584) (-2162.110) [-2162.596] (-2162.499) * (-2158.239) (-2161.654) (-2161.542) [-2151.214] -- 0:03:52 118000 -- (-2149.177) (-2155.041) [-2156.446] (-2172.028) * (-2160.529) (-2156.135) [-2159.643] (-2161.063) -- 0:03:51 118500 -- (-2154.493) [-2157.627] (-2160.508) (-2164.348) * [-2158.661] (-2160.747) (-2156.282) (-2162.040) -- 0:03:58 119000 -- [-2151.463] (-2157.634) (-2156.787) (-2154.774) * (-2158.452) (-2158.580) [-2162.877] (-2155.553) -- 0:03:56 119500 -- [-2152.492] (-2167.845) (-2165.648) (-2153.856) * (-2162.017) (-2162.691) [-2152.524] (-2152.840) -- 0:03:55 120000 -- (-2156.332) (-2154.439) (-2159.007) [-2153.403] * (-2154.998) (-2165.944) (-2159.401) [-2155.804] -- 0:03:54 Average standard deviation of split frequencies: 0.009767 120500 -- (-2159.750) [-2160.362] (-2157.257) (-2164.091) * [-2164.376] (-2160.254) (-2151.961) (-2159.542) -- 0:03:53 121000 -- (-2162.676) [-2158.739] (-2157.740) (-2157.566) * [-2153.085] (-2157.837) (-2156.610) (-2162.703) -- 0:03:52 121500 -- (-2161.327) (-2162.030) (-2155.995) [-2151.870] * (-2159.029) [-2154.492] (-2155.634) (-2161.515) -- 0:03:51 122000 -- (-2156.928) (-2164.170) [-2157.645] (-2156.628) * (-2159.995) (-2156.015) [-2157.567] (-2163.998) -- 0:03:57 122500 -- [-2162.249] (-2160.321) (-2153.024) (-2155.709) * (-2158.331) [-2150.924] (-2157.082) (-2163.487) -- 0:03:56 123000 -- [-2155.452] (-2162.148) (-2154.925) (-2156.733) * [-2154.779] (-2154.146) (-2161.770) (-2152.182) -- 0:03:55 123500 -- (-2157.027) [-2158.248] (-2153.801) (-2158.970) * (-2156.976) (-2157.239) (-2163.577) [-2157.170] -- 0:03:54 124000 -- (-2156.163) (-2162.346) [-2156.642] (-2157.892) * [-2161.718] (-2153.976) (-2159.353) (-2163.761) -- 0:03:53 124500 -- (-2162.226) [-2157.611] (-2159.733) (-2158.738) * (-2164.284) (-2152.932) (-2155.037) [-2161.120] -- 0:03:52 125000 -- [-2157.103] (-2168.464) (-2159.747) (-2156.625) * (-2156.769) (-2156.161) (-2162.725) [-2159.091] -- 0:03:51 Average standard deviation of split frequencies: 0.007483 125500 -- [-2156.684] (-2162.536) (-2157.987) (-2168.068) * (-2159.827) (-2158.073) (-2153.552) [-2157.741] -- 0:03:56 126000 -- [-2159.474] (-2157.845) (-2159.407) (-2164.249) * (-2158.591) (-2154.864) (-2157.243) [-2157.352] -- 0:03:55 126500 -- (-2156.938) [-2157.978] (-2158.840) (-2172.587) * (-2154.823) (-2153.079) [-2154.550] (-2154.434) -- 0:03:54 127000 -- (-2155.301) [-2153.871] (-2158.466) (-2162.275) * (-2161.476) (-2154.629) (-2159.810) [-2156.983] -- 0:03:53 127500 -- (-2154.650) [-2155.458] (-2157.706) (-2160.498) * [-2155.692] (-2156.707) (-2155.226) (-2156.302) -- 0:03:52 128000 -- [-2161.243] (-2160.077) (-2153.305) (-2167.814) * (-2152.678) [-2163.810] (-2156.644) (-2152.651) -- 0:03:51 128500 -- [-2156.027] (-2158.785) (-2152.274) (-2162.247) * (-2153.379) (-2157.553) (-2159.884) [-2156.070] -- 0:03:50 129000 -- (-2152.060) (-2160.430) [-2151.458] (-2156.673) * (-2157.035) (-2155.670) [-2160.157] (-2160.912) -- 0:03:49 129500 -- (-2151.999) (-2159.452) (-2158.340) [-2161.837] * (-2161.939) (-2157.385) (-2159.652) [-2155.948] -- 0:03:55 130000 -- (-2158.113) (-2157.740) [-2153.109] (-2160.175) * (-2160.642) [-2155.895] (-2158.575) (-2166.466) -- 0:03:54 Average standard deviation of split frequencies: 0.012627 130500 -- (-2161.684) [-2154.353] (-2166.946) (-2168.007) * (-2161.338) (-2154.839) [-2156.695] (-2153.703) -- 0:03:53 131000 -- (-2157.968) [-2157.287] (-2163.929) (-2158.271) * (-2160.917) (-2152.688) [-2164.958] (-2151.628) -- 0:03:52 131500 -- (-2162.483) (-2159.943) [-2153.236] (-2162.585) * [-2159.826] (-2155.959) (-2156.598) (-2156.535) -- 0:03:51 132000 -- [-2160.958] (-2154.939) (-2154.634) (-2153.568) * (-2159.120) [-2156.723] (-2154.189) (-2161.658) -- 0:03:50 132500 -- (-2162.023) (-2151.597) (-2156.302) [-2153.820] * (-2158.262) [-2163.187] (-2157.278) (-2156.795) -- 0:03:49 133000 -- (-2163.419) [-2154.034] (-2156.452) (-2158.892) * (-2160.321) [-2158.694] (-2157.943) (-2155.987) -- 0:03:54 133500 -- (-2160.052) [-2151.198] (-2162.134) (-2153.015) * (-2156.276) (-2156.600) [-2157.555] (-2154.937) -- 0:03:53 134000 -- (-2158.037) [-2153.185] (-2158.066) (-2164.695) * (-2160.342) [-2154.800] (-2161.028) (-2159.144) -- 0:03:52 134500 -- (-2153.981) (-2158.325) (-2153.901) [-2156.121] * [-2152.641] (-2152.545) (-2152.978) (-2153.842) -- 0:03:51 135000 -- (-2165.260) (-2161.083) [-2157.174] (-2157.831) * (-2153.763) (-2155.631) (-2157.444) [-2153.619] -- 0:03:50 Average standard deviation of split frequencies: 0.019064 135500 -- (-2162.316) (-2156.508) [-2152.771] (-2158.964) * (-2152.064) (-2160.704) (-2162.786) [-2150.576] -- 0:03:49 136000 -- (-2159.908) (-2157.472) (-2155.572) [-2155.229] * (-2156.640) (-2155.825) (-2161.315) [-2154.540] -- 0:03:48 136500 -- (-2160.225) (-2151.108) (-2159.982) [-2157.945] * (-2155.251) (-2157.071) (-2164.476) [-2161.492] -- 0:03:54 137000 -- (-2158.299) (-2153.317) [-2158.142] (-2162.964) * (-2157.790) (-2158.808) (-2155.549) [-2156.854] -- 0:03:53 137500 -- [-2164.648] (-2154.310) (-2160.630) (-2166.226) * (-2158.028) [-2152.993] (-2160.126) (-2156.070) -- 0:03:52 138000 -- (-2159.810) (-2155.850) (-2159.410) [-2155.828] * (-2158.014) (-2156.838) [-2163.845] (-2161.929) -- 0:03:51 138500 -- [-2156.298] (-2154.712) (-2159.373) (-2155.058) * (-2161.112) (-2167.562) [-2157.950] (-2163.400) -- 0:03:50 139000 -- (-2165.285) (-2161.983) (-2155.213) [-2154.965] * (-2153.052) (-2157.555) [-2155.223] (-2157.894) -- 0:03:49 139500 -- (-2161.342) (-2162.856) (-2161.842) [-2158.524] * (-2152.859) [-2155.437] (-2161.160) (-2159.302) -- 0:03:48 140000 -- (-2162.880) (-2153.785) [-2158.921] (-2156.177) * (-2156.015) (-2158.153) [-2158.773] (-2163.335) -- 0:03:47 Average standard deviation of split frequencies: 0.022621 140500 -- (-2167.125) (-2152.998) [-2158.877] (-2152.937) * (-2161.393) [-2159.774] (-2158.277) (-2161.387) -- 0:03:52 141000 -- (-2157.126) [-2153.794] (-2158.568) (-2165.770) * (-2160.568) (-2157.127) [-2152.316] (-2166.128) -- 0:03:51 141500 -- (-2158.182) (-2157.735) [-2165.799] (-2166.768) * (-2164.131) (-2158.322) [-2155.209] (-2163.813) -- 0:03:50 142000 -- (-2158.945) [-2155.322] (-2158.900) (-2167.459) * (-2160.024) (-2162.113) (-2157.351) [-2167.657] -- 0:03:49 142500 -- (-2154.260) (-2157.732) [-2155.701] (-2158.542) * (-2155.993) (-2157.418) [-2165.685] (-2159.339) -- 0:03:48 143000 -- (-2156.637) (-2167.005) (-2154.383) [-2162.543] * (-2167.100) (-2153.882) [-2161.146] (-2156.486) -- 0:03:47 143500 -- (-2160.055) (-2162.879) [-2155.347] (-2156.647) * [-2157.051] (-2158.993) (-2159.070) (-2161.424) -- 0:03:46 144000 -- (-2160.144) (-2158.773) [-2159.959] (-2156.740) * [-2158.018] (-2158.329) (-2151.591) (-2156.502) -- 0:03:51 144500 -- (-2158.554) (-2167.607) (-2152.961) [-2161.840] * (-2160.645) [-2154.409] (-2154.147) (-2155.575) -- 0:03:50 145000 -- [-2155.989] (-2157.528) (-2155.520) (-2152.071) * (-2161.283) (-2152.185) [-2153.099] (-2158.703) -- 0:03:49 Average standard deviation of split frequencies: 0.020987 145500 -- [-2153.585] (-2164.528) (-2156.756) (-2159.773) * (-2163.688) (-2160.886) [-2159.758] (-2158.799) -- 0:03:49 146000 -- (-2162.189) (-2155.680) [-2154.768] (-2159.251) * (-2158.685) [-2157.982] (-2164.817) (-2159.215) -- 0:03:48 146500 -- (-2154.859) [-2155.915] (-2153.521) (-2167.352) * (-2158.391) [-2154.549] (-2157.745) (-2164.462) -- 0:03:47 147000 -- (-2156.256) (-2159.379) (-2160.280) [-2157.726] * [-2156.302] (-2156.941) (-2168.195) (-2165.590) -- 0:03:46 147500 -- (-2158.429) (-2158.070) [-2159.728] (-2163.642) * [-2158.872] (-2161.241) (-2158.943) (-2159.531) -- 0:03:45 148000 -- (-2160.305) [-2159.413] (-2157.101) (-2155.500) * (-2157.895) [-2151.404] (-2156.700) (-2150.723) -- 0:03:50 148500 -- (-2157.981) (-2155.525) [-2154.608] (-2158.582) * (-2160.512) (-2157.842) (-2158.073) [-2155.399] -- 0:03:49 149000 -- (-2161.629) (-2161.571) (-2156.724) [-2154.991] * (-2160.097) (-2154.614) [-2157.594] (-2155.881) -- 0:03:48 149500 -- (-2155.101) [-2160.460] (-2160.037) (-2155.714) * [-2156.144] (-2156.091) (-2157.737) (-2151.089) -- 0:03:47 150000 -- (-2152.184) (-2160.345) [-2162.395] (-2160.580) * (-2168.722) (-2151.796) (-2151.451) [-2155.531] -- 0:03:46 Average standard deviation of split frequencies: 0.018773 150500 -- [-2160.257] (-2154.829) (-2162.975) (-2160.470) * (-2161.931) (-2149.140) [-2154.375] (-2156.397) -- 0:03:45 151000 -- (-2165.270) [-2154.328] (-2155.642) (-2156.318) * (-2154.443) (-2151.703) [-2154.361] (-2159.521) -- 0:03:44 151500 -- (-2162.253) (-2162.529) (-2160.177) [-2154.220] * (-2163.782) (-2158.057) [-2153.920] (-2159.498) -- 0:03:44 152000 -- (-2161.382) (-2164.077) (-2159.573) [-2154.697] * (-2151.781) (-2164.569) (-2161.571) [-2159.945] -- 0:03:48 152500 -- [-2164.591] (-2161.132) (-2153.190) (-2151.987) * (-2154.782) [-2161.639] (-2157.282) (-2157.959) -- 0:03:47 153000 -- (-2160.593) (-2158.075) [-2155.492] (-2159.023) * (-2158.785) (-2153.694) [-2159.199] (-2160.135) -- 0:03:46 153500 -- (-2155.174) (-2167.309) [-2156.347] (-2153.711) * (-2154.674) [-2158.133] (-2155.138) (-2155.026) -- 0:03:46 154000 -- [-2157.721] (-2160.298) (-2163.936) (-2162.015) * (-2156.321) (-2161.232) [-2155.690] (-2157.480) -- 0:03:45 154500 -- (-2163.951) (-2154.429) (-2158.820) [-2155.280] * (-2160.030) (-2160.902) (-2154.637) [-2159.369] -- 0:03:44 155000 -- [-2155.884] (-2152.392) (-2156.415) (-2155.233) * (-2156.207) (-2164.212) (-2160.249) [-2153.843] -- 0:03:43 Average standard deviation of split frequencies: 0.022664 155500 -- (-2160.013) [-2157.061] (-2157.854) (-2155.297) * [-2157.362] (-2158.220) (-2158.571) (-2159.650) -- 0:03:48 156000 -- [-2154.288] (-2160.123) (-2160.341) (-2155.789) * [-2157.936] (-2160.407) (-2169.094) (-2155.724) -- 0:03:47 156500 -- (-2160.283) [-2154.729] (-2159.919) (-2158.361) * [-2155.368] (-2155.769) (-2162.923) (-2150.137) -- 0:03:46 157000 -- (-2153.768) [-2155.041] (-2159.417) (-2150.217) * (-2164.114) [-2158.557] (-2160.103) (-2157.858) -- 0:03:45 157500 -- [-2154.239] (-2159.697) (-2157.548) (-2158.950) * (-2160.814) [-2157.255] (-2163.259) (-2156.190) -- 0:03:44 158000 -- (-2160.173) [-2153.709] (-2156.944) (-2152.590) * (-2162.566) (-2162.017) [-2158.582] (-2150.319) -- 0:03:43 158500 -- (-2157.862) [-2153.381] (-2154.071) (-2154.196) * (-2159.516) (-2153.496) (-2157.041) [-2154.151] -- 0:03:42 159000 -- (-2157.972) (-2166.536) (-2156.995) [-2156.180] * (-2158.453) (-2155.447) [-2156.910] (-2159.858) -- 0:03:42 159500 -- (-2160.120) (-2157.935) [-2156.750] (-2164.179) * [-2157.723] (-2163.814) (-2157.872) (-2162.760) -- 0:03:46 160000 -- (-2159.660) [-2161.685] (-2159.006) (-2154.559) * [-2153.254] (-2157.528) (-2161.920) (-2161.349) -- 0:03:45 Average standard deviation of split frequencies: 0.022739 160500 -- [-2155.758] (-2152.670) (-2161.073) (-2166.958) * (-2156.736) (-2153.021) [-2157.250] (-2160.468) -- 0:03:44 161000 -- (-2157.468) [-2154.322] (-2155.731) (-2160.048) * [-2151.762] (-2160.234) (-2158.407) (-2161.507) -- 0:03:44 161500 -- (-2157.345) [-2152.563] (-2156.241) (-2162.176) * (-2159.317) (-2166.059) (-2153.610) [-2154.925] -- 0:03:43 162000 -- (-2156.511) (-2158.899) (-2164.856) [-2161.426] * (-2159.131) (-2159.529) (-2160.180) [-2155.094] -- 0:03:42 162500 -- [-2151.901] (-2160.061) (-2154.961) (-2167.773) * (-2163.434) (-2150.032) (-2157.627) [-2157.816] -- 0:03:41 163000 -- (-2158.635) [-2158.045] (-2160.988) (-2163.130) * (-2162.928) (-2154.111) (-2155.677) [-2156.753] -- 0:03:45 163500 -- (-2155.296) (-2164.378) [-2159.780] (-2163.235) * [-2152.999] (-2159.837) (-2155.521) (-2150.195) -- 0:03:45 164000 -- (-2159.018) [-2157.004] (-2157.027) (-2159.130) * (-2159.067) (-2162.236) [-2156.862] (-2153.127) -- 0:03:44 164500 -- [-2153.848] (-2162.166) (-2161.232) (-2157.318) * [-2155.351] (-2158.577) (-2160.476) (-2162.371) -- 0:03:43 165000 -- (-2154.190) (-2159.287) [-2154.565] (-2165.378) * (-2161.565) (-2152.027) (-2162.954) [-2161.991] -- 0:03:42 Average standard deviation of split frequencies: 0.024138 165500 -- [-2157.656] (-2162.488) (-2158.200) (-2158.100) * (-2158.433) (-2151.263) [-2158.312] (-2151.269) -- 0:03:41 166000 -- [-2159.697] (-2157.402) (-2156.980) (-2160.583) * [-2155.268] (-2155.926) (-2160.095) (-2155.927) -- 0:03:41 166500 -- (-2158.673) (-2163.742) (-2160.023) [-2155.771] * (-2167.498) (-2158.113) (-2162.740) [-2153.467] -- 0:03:40 167000 -- (-2159.720) (-2164.379) (-2157.196) [-2155.863] * (-2154.409) (-2155.401) (-2160.520) [-2150.816] -- 0:03:44 167500 -- (-2153.013) (-2170.953) (-2163.035) [-2152.789] * (-2158.192) [-2153.387] (-2157.303) (-2160.383) -- 0:03:43 168000 -- (-2154.925) (-2168.693) [-2151.484] (-2156.454) * [-2153.963] (-2158.137) (-2160.412) (-2159.139) -- 0:03:42 168500 -- (-2154.183) (-2166.238) (-2160.250) [-2162.581] * (-2157.777) [-2160.635] (-2154.316) (-2158.280) -- 0:03:42 169000 -- (-2156.580) (-2159.800) (-2157.336) [-2157.657] * (-2179.447) (-2154.697) [-2157.394] (-2161.952) -- 0:03:41 169500 -- [-2154.519] (-2158.680) (-2157.342) (-2155.244) * (-2167.444) (-2157.452) [-2154.349] (-2162.635) -- 0:03:40 170000 -- [-2156.354] (-2164.300) (-2166.384) (-2154.911) * (-2158.550) (-2160.596) [-2158.489] (-2155.687) -- 0:03:39 Average standard deviation of split frequencies: 0.020716 170500 -- (-2161.350) (-2165.129) (-2157.510) [-2155.931] * (-2162.998) (-2158.366) [-2154.640] (-2153.350) -- 0:03:38 171000 -- (-2164.772) (-2160.679) (-2156.736) [-2155.558] * (-2161.206) (-2157.802) [-2156.208] (-2157.750) -- 0:03:43 171500 -- (-2170.841) [-2148.530] (-2156.376) (-2155.492) * (-2156.607) (-2159.115) [-2165.050] (-2158.305) -- 0:03:42 172000 -- (-2160.610) (-2153.725) (-2163.428) [-2157.977] * [-2159.068] (-2154.436) (-2159.992) (-2156.553) -- 0:03:41 172500 -- (-2157.454) [-2159.970] (-2154.343) (-2158.419) * [-2157.434] (-2159.542) (-2155.936) (-2164.249) -- 0:03:40 173000 -- (-2150.850) [-2154.648] (-2156.727) (-2154.586) * [-2158.517] (-2158.344) (-2161.775) (-2158.540) -- 0:03:39 173500 -- (-2152.585) (-2158.487) (-2157.896) [-2153.207] * (-2156.611) (-2157.595) [-2161.274] (-2156.243) -- 0:03:39 174000 -- (-2158.933) (-2163.976) (-2156.199) [-2156.290] * (-2152.723) (-2157.974) (-2156.663) [-2153.650] -- 0:03:38 174500 -- (-2155.083) (-2157.185) (-2154.121) [-2155.479] * [-2156.017] (-2156.671) (-2152.935) (-2150.971) -- 0:03:42 175000 -- (-2160.150) (-2152.839) (-2156.842) [-2152.966] * (-2155.132) [-2154.050] (-2154.941) (-2154.145) -- 0:03:41 Average standard deviation of split frequencies: 0.016740 175500 -- (-2162.485) (-2154.071) (-2153.694) [-2153.012] * (-2158.746) [-2150.297] (-2153.859) (-2153.365) -- 0:03:40 176000 -- (-2154.719) (-2156.511) [-2156.711] (-2152.467) * (-2156.986) (-2153.514) [-2154.243] (-2155.630) -- 0:03:40 176500 -- (-2166.907) [-2156.287] (-2158.287) (-2158.144) * (-2158.398) (-2170.522) [-2151.372] (-2156.937) -- 0:03:39 177000 -- [-2158.076] (-2158.832) (-2160.993) (-2155.202) * (-2156.239) (-2169.032) (-2160.417) [-2155.441] -- 0:03:38 177500 -- (-2159.892) [-2156.731] (-2163.281) (-2159.297) * (-2154.639) (-2166.929) [-2159.178] (-2154.035) -- 0:03:37 178000 -- [-2157.179] (-2155.513) (-2163.703) (-2159.532) * (-2158.994) [-2162.232] (-2165.087) (-2163.308) -- 0:03:37 178500 -- (-2162.528) [-2152.770] (-2158.890) (-2164.045) * (-2155.752) (-2161.970) [-2161.151] (-2163.326) -- 0:03:40 179000 -- [-2156.193] (-2153.435) (-2157.319) (-2156.700) * (-2151.369) [-2156.433] (-2159.843) (-2156.351) -- 0:03:40 179500 -- (-2164.172) (-2156.708) (-2157.745) [-2156.522] * (-2155.989) (-2158.139) [-2150.920] (-2162.459) -- 0:03:39 180000 -- (-2156.453) [-2157.745] (-2160.354) (-2156.209) * [-2163.757] (-2152.893) (-2157.192) (-2162.166) -- 0:03:38 Average standard deviation of split frequencies: 0.009785 180500 -- (-2156.953) [-2153.387] (-2154.201) (-2151.033) * [-2159.617] (-2175.665) (-2153.291) (-2152.457) -- 0:03:37 181000 -- (-2161.023) (-2159.332) [-2156.306] (-2154.680) * [-2150.373] (-2163.036) (-2157.262) (-2159.618) -- 0:03:37 181500 -- (-2161.365) [-2153.158] (-2155.956) (-2154.860) * (-2156.307) (-2158.737) [-2154.873] (-2159.919) -- 0:03:36 182000 -- [-2157.883] (-2158.723) (-2158.564) (-2156.796) * (-2155.641) (-2157.865) (-2161.536) [-2156.601] -- 0:03:40 182500 -- [-2156.154] (-2156.624) (-2159.274) (-2156.607) * (-2157.155) [-2157.654] (-2158.267) (-2156.716) -- 0:03:39 183000 -- (-2156.663) [-2153.122] (-2158.279) (-2156.788) * (-2156.775) [-2155.681] (-2158.000) (-2161.966) -- 0:03:38 183500 -- (-2153.667) (-2160.436) (-2156.647) [-2157.534] * (-2157.192) [-2157.174] (-2154.442) (-2161.566) -- 0:03:38 184000 -- (-2157.139) (-2157.467) (-2157.316) [-2158.078] * (-2155.109) (-2156.328) [-2153.255] (-2154.602) -- 0:03:37 184500 -- (-2153.852) [-2158.569] (-2154.420) (-2153.462) * (-2154.481) (-2154.785) [-2157.904] (-2162.473) -- 0:03:36 185000 -- (-2157.226) [-2153.143] (-2155.207) (-2157.010) * [-2153.061] (-2154.325) (-2166.586) (-2155.082) -- 0:03:35 Average standard deviation of split frequencies: 0.013306 185500 -- (-2158.339) (-2158.737) (-2152.692) [-2151.464] * [-2157.244] (-2156.010) (-2165.457) (-2162.377) -- 0:03:35 186000 -- (-2162.590) (-2164.515) [-2150.546] (-2163.932) * [-2154.116] (-2155.298) (-2169.279) (-2165.216) -- 0:03:38 186500 -- (-2159.070) [-2155.505] (-2156.773) (-2164.618) * (-2159.467) (-2159.456) [-2155.357] (-2160.706) -- 0:03:38 187000 -- (-2164.037) (-2156.727) (-2159.125) [-2161.074] * (-2160.993) (-2172.295) (-2156.880) [-2158.393] -- 0:03:37 187500 -- [-2157.762] (-2158.463) (-2160.556) (-2157.869) * (-2160.775) (-2159.397) [-2156.870] (-2161.685) -- 0:03:36 188000 -- [-2158.406] (-2165.940) (-2152.260) (-2157.139) * [-2157.076] (-2170.270) (-2156.429) (-2157.094) -- 0:03:35 188500 -- (-2153.017) (-2155.700) (-2155.860) [-2155.670] * (-2155.281) (-2155.884) [-2152.956] (-2158.356) -- 0:03:35 189000 -- [-2158.561] (-2153.111) (-2155.260) (-2158.251) * [-2158.169] (-2156.799) (-2151.944) (-2166.277) -- 0:03:34 189500 -- (-2160.874) (-2160.341) (-2158.107) [-2161.177] * (-2159.918) (-2156.119) [-2159.014] (-2157.223) -- 0:03:38 190000 -- (-2159.612) [-2153.469] (-2155.178) (-2154.108) * (-2158.761) (-2159.113) (-2161.774) [-2155.583] -- 0:03:37 Average standard deviation of split frequencies: 0.010508 190500 -- (-2156.930) [-2154.598] (-2158.121) (-2156.789) * (-2159.356) (-2152.869) [-2156.497] (-2157.355) -- 0:03:36 191000 -- [-2159.420] (-2152.664) (-2154.749) (-2155.564) * (-2154.993) [-2158.962] (-2153.509) (-2171.812) -- 0:03:36 191500 -- (-2161.215) [-2155.017] (-2155.836) (-2155.003) * [-2160.016] (-2157.931) (-2158.059) (-2162.769) -- 0:03:35 192000 -- [-2154.964] (-2161.821) (-2154.232) (-2157.191) * (-2159.200) (-2152.098) [-2156.888] (-2161.292) -- 0:03:34 192500 -- (-2156.939) [-2160.550] (-2154.250) (-2154.661) * (-2151.390) [-2151.730] (-2160.102) (-2161.487) -- 0:03:33 193000 -- (-2158.956) [-2156.327] (-2160.871) (-2153.948) * (-2155.609) (-2161.029) [-2157.385] (-2159.757) -- 0:03:33 193500 -- [-2157.959] (-2160.532) (-2156.865) (-2158.738) * (-2153.716) (-2157.022) [-2158.560] (-2162.321) -- 0:03:36 194000 -- [-2153.815] (-2154.250) (-2153.527) (-2161.473) * (-2161.298) [-2158.041] (-2158.393) (-2163.626) -- 0:03:36 194500 -- (-2157.556) [-2160.288] (-2156.366) (-2153.446) * (-2159.798) [-2156.397] (-2159.972) (-2158.406) -- 0:03:35 195000 -- (-2160.058) (-2158.381) (-2158.861) [-2151.237] * (-2160.494) (-2159.398) (-2153.529) [-2151.797] -- 0:03:34 Average standard deviation of split frequencies: 0.008418 195500 -- (-2156.656) (-2162.280) (-2162.126) [-2152.081] * (-2154.368) (-2161.817) [-2154.159] (-2151.479) -- 0:03:33 196000 -- (-2153.210) (-2159.174) (-2164.170) [-2154.726] * (-2152.039) (-2169.034) (-2155.037) [-2153.296] -- 0:03:33 196500 -- (-2155.474) [-2153.116] (-2155.718) (-2161.639) * (-2157.685) (-2173.333) (-2160.515) [-2156.186] -- 0:03:36 197000 -- (-2161.615) (-2158.219) (-2157.818) [-2158.988] * [-2155.950] (-2160.581) (-2155.373) (-2159.764) -- 0:03:36 197500 -- [-2157.749] (-2160.980) (-2160.604) (-2160.026) * (-2160.529) (-2156.685) [-2149.671] (-2158.720) -- 0:03:35 198000 -- (-2167.420) (-2165.113) [-2156.715] (-2165.291) * (-2160.224) (-2158.398) [-2153.923] (-2160.356) -- 0:03:34 198500 -- (-2154.790) [-2163.655] (-2159.316) (-2161.440) * (-2157.442) [-2153.098] (-2152.778) (-2162.183) -- 0:03:34 199000 -- (-2153.178) (-2154.698) (-2157.183) [-2160.065] * (-2162.226) [-2159.263] (-2161.488) (-2157.958) -- 0:03:33 199500 -- (-2158.600) (-2156.072) (-2154.397) [-2162.161] * (-2156.182) [-2152.008] (-2154.241) (-2162.498) -- 0:03:32 200000 -- (-2160.974) (-2160.871) [-2156.863] (-2161.027) * (-2154.081) (-2153.879) [-2157.983] (-2158.928) -- 0:03:36 Average standard deviation of split frequencies: 0.009397 200500 -- (-2153.336) (-2160.582) [-2161.465] (-2163.222) * [-2157.503] (-2158.761) (-2163.165) (-2166.049) -- 0:03:35 201000 -- (-2154.703) [-2156.785] (-2156.491) (-2159.945) * (-2159.992) (-2164.658) (-2156.529) [-2158.014] -- 0:03:34 201500 -- [-2155.433] (-2163.738) (-2163.013) (-2157.255) * (-2160.531) (-2159.512) [-2161.139] (-2158.297) -- 0:03:33 202000 -- (-2156.365) (-2159.579) [-2154.366] (-2159.602) * (-2160.378) (-2165.308) [-2156.248] (-2168.773) -- 0:03:33 202500 -- (-2161.096) (-2156.602) (-2162.241) [-2153.235] * (-2160.772) (-2170.563) (-2160.638) [-2154.048] -- 0:03:32 203000 -- (-2156.645) [-2154.547] (-2157.511) (-2166.607) * [-2155.219] (-2162.002) (-2153.733) (-2173.706) -- 0:03:32 203500 -- (-2161.107) (-2153.973) [-2158.255] (-2167.171) * (-2157.578) [-2163.605] (-2160.288) (-2160.556) -- 0:03:31 204000 -- (-2157.332) [-2155.425] (-2163.466) (-2158.698) * [-2150.906] (-2156.332) (-2159.068) (-2167.671) -- 0:03:34 204500 -- (-2163.054) [-2154.679] (-2162.471) (-2160.828) * [-2154.345] (-2153.696) (-2157.299) (-2160.332) -- 0:03:33 205000 -- (-2162.461) (-2155.754) [-2153.223] (-2154.518) * (-2155.040) [-2155.773] (-2159.932) (-2155.168) -- 0:03:33 Average standard deviation of split frequencies: 0.013158 205500 -- (-2155.114) (-2156.377) (-2157.825) [-2156.513] * [-2153.510] (-2154.806) (-2154.358) (-2152.999) -- 0:03:32 206000 -- (-2156.365) (-2161.839) (-2153.819) [-2155.789] * (-2155.404) (-2162.485) [-2159.893] (-2159.789) -- 0:03:31 206500 -- (-2159.259) [-2154.503] (-2153.811) (-2160.680) * (-2161.161) [-2152.909] (-2158.457) (-2154.516) -- 0:03:31 207000 -- [-2157.688] (-2172.454) (-2154.020) (-2159.764) * (-2154.569) (-2159.683) (-2156.718) [-2158.534] -- 0:03:30 207500 -- (-2154.804) (-2155.523) (-2156.447) [-2155.903] * (-2161.659) [-2153.134] (-2155.886) (-2158.893) -- 0:03:33 208000 -- (-2151.184) (-2157.366) [-2154.975] (-2159.146) * [-2157.517] (-2158.766) (-2161.918) (-2154.405) -- 0:03:33 208500 -- (-2163.236) (-2155.480) (-2156.756) [-2157.630] * (-2156.694) (-2160.176) (-2160.774) [-2158.143] -- 0:03:32 209000 -- (-2158.713) [-2150.792] (-2160.327) (-2155.879) * (-2156.070) (-2156.192) [-2165.680] (-2156.341) -- 0:03:31 209500 -- (-2154.489) [-2151.945] (-2155.679) (-2162.808) * (-2158.250) (-2157.882) (-2159.809) [-2154.737] -- 0:03:31 210000 -- (-2160.547) (-2153.180) [-2153.485] (-2159.983) * (-2157.838) (-2157.178) (-2157.565) [-2155.288] -- 0:03:30 Average standard deviation of split frequencies: 0.011748 210500 -- [-2154.668] (-2161.435) (-2157.412) (-2162.375) * (-2157.978) (-2152.613) [-2151.439] (-2164.068) -- 0:03:30 211000 -- (-2157.017) [-2156.298] (-2154.771) (-2157.102) * (-2162.160) (-2151.428) [-2156.189] (-2161.012) -- 0:03:29 211500 -- (-2154.142) (-2156.669) (-2158.341) [-2149.196] * (-2155.403) (-2153.886) (-2156.311) [-2163.089] -- 0:03:32 212000 -- (-2157.121) (-2154.964) (-2157.899) [-2155.635] * [-2153.728] (-2154.041) (-2157.463) (-2158.529) -- 0:03:31 212500 -- [-2158.135] (-2153.435) (-2151.347) (-2154.471) * (-2153.706) [-2152.587] (-2160.748) (-2159.998) -- 0:03:31 213000 -- [-2160.817] (-2158.444) (-2159.114) (-2156.931) * (-2169.227) (-2154.410) (-2162.508) [-2157.859] -- 0:03:30 213500 -- (-2159.743) [-2157.298] (-2159.284) (-2154.709) * (-2165.872) (-2162.490) (-2158.898) [-2161.500] -- 0:03:29 214000 -- (-2154.013) [-2158.224] (-2156.639) (-2164.232) * (-2155.479) (-2167.212) (-2153.356) [-2155.349] -- 0:03:29 214500 -- (-2162.186) (-2163.125) [-2154.000] (-2157.538) * (-2155.260) (-2162.796) [-2161.874] (-2156.649) -- 0:03:28 215000 -- (-2154.734) (-2154.975) (-2160.513) [-2152.871] * (-2163.992) [-2154.668] (-2154.652) (-2160.415) -- 0:03:28 Average standard deviation of split frequencies: 0.010912 215500 -- (-2153.776) (-2157.131) (-2159.423) [-2153.214] * (-2154.462) (-2154.337) [-2161.487] (-2159.725) -- 0:03:31 216000 -- (-2159.093) (-2164.058) [-2152.406] (-2152.537) * (-2165.675) (-2162.129) [-2156.018] (-2154.931) -- 0:03:30 216500 -- [-2156.618] (-2161.882) (-2158.997) (-2155.009) * (-2152.483) (-2161.204) [-2154.172] (-2154.387) -- 0:03:29 217000 -- (-2159.825) (-2159.171) [-2158.531] (-2163.245) * [-2158.582] (-2158.838) (-2156.475) (-2156.630) -- 0:03:29 217500 -- (-2156.089) (-2160.297) [-2160.495] (-2156.667) * (-2161.808) [-2153.756] (-2161.606) (-2156.257) -- 0:03:28 218000 -- (-2160.414) (-2156.414) (-2157.530) [-2156.145] * (-2154.236) (-2155.189) [-2154.637] (-2153.963) -- 0:03:28 218500 -- (-2162.490) [-2157.810] (-2158.988) (-2156.528) * (-2158.034) [-2152.874] (-2166.308) (-2157.263) -- 0:03:27 219000 -- (-2158.120) (-2156.184) (-2161.318) [-2154.836] * (-2161.966) (-2158.364) (-2158.536) [-2158.136] -- 0:03:30 219500 -- (-2159.293) (-2153.198) (-2162.804) [-2155.783] * (-2152.512) [-2162.477] (-2162.097) (-2157.864) -- 0:03:29 220000 -- [-2150.083] (-2160.741) (-2155.233) (-2153.660) * (-2157.115) (-2154.596) [-2156.800] (-2166.591) -- 0:03:29 Average standard deviation of split frequencies: 0.008545 220500 -- [-2153.174] (-2159.424) (-2158.647) (-2165.050) * (-2158.785) (-2153.724) [-2157.276] (-2159.957) -- 0:03:28 221000 -- [-2155.072] (-2155.871) (-2156.539) (-2159.354) * [-2154.766] (-2155.295) (-2153.895) (-2162.013) -- 0:03:27 221500 -- (-2161.429) [-2162.664] (-2154.542) (-2152.256) * (-2153.405) (-2153.746) [-2150.106] (-2157.405) -- 0:03:27 222000 -- (-2157.934) (-2162.646) (-2158.194) [-2156.531] * (-2157.224) (-2155.427) [-2158.856] (-2151.622) -- 0:03:26 222500 -- [-2154.224] (-2156.092) (-2158.502) (-2156.627) * (-2159.797) (-2157.084) (-2164.504) [-2154.342] -- 0:03:29 223000 -- (-2157.430) (-2159.092) (-2155.775) [-2152.388] * [-2158.257] (-2159.486) (-2159.971) (-2158.962) -- 0:03:29 223500 -- (-2157.342) [-2162.648] (-2156.422) (-2159.826) * (-2162.191) (-2164.868) (-2157.890) [-2162.457] -- 0:03:28 224000 -- [-2157.695] (-2160.429) (-2152.106) (-2154.025) * [-2159.691] (-2159.355) (-2155.482) (-2152.755) -- 0:03:27 224500 -- [-2157.987] (-2158.044) (-2160.378) (-2158.869) * (-2155.398) [-2156.818] (-2156.808) (-2164.333) -- 0:03:27 225000 -- (-2158.969) (-2156.818) [-2163.365] (-2160.085) * (-2155.911) [-2152.723] (-2158.733) (-2153.032) -- 0:03:26 Average standard deviation of split frequencies: 0.005215 225500 -- [-2156.002] (-2156.450) (-2165.909) (-2154.208) * (-2156.923) (-2160.042) (-2162.338) [-2153.839] -- 0:03:26 226000 -- (-2153.310) (-2159.729) (-2163.018) [-2164.587] * [-2153.701] (-2158.754) (-2165.388) (-2154.706) -- 0:03:25 226500 -- (-2163.500) (-2154.219) (-2166.233) [-2159.661] * [-2157.059] (-2157.119) (-2162.818) (-2153.199) -- 0:03:28 227000 -- (-2163.253) (-2160.789) (-2163.004) [-2158.160] * [-2157.450] (-2159.695) (-2159.874) (-2157.446) -- 0:03:27 227500 -- (-2156.660) [-2153.094] (-2160.085) (-2162.446) * (-2156.078) (-2156.370) (-2159.078) [-2154.367] -- 0:03:27 228000 -- (-2155.476) [-2160.882] (-2165.777) (-2170.605) * (-2164.357) (-2154.447) [-2156.441] (-2156.641) -- 0:03:26 228500 -- [-2156.028] (-2160.158) (-2157.367) (-2157.470) * (-2156.385) (-2157.689) (-2157.696) [-2156.865] -- 0:03:25 229000 -- (-2163.218) (-2157.187) [-2154.960] (-2157.370) * [-2162.143] (-2153.897) (-2160.807) (-2162.800) -- 0:03:25 229500 -- (-2157.553) [-2150.337] (-2152.986) (-2162.154) * (-2153.336) (-2160.190) [-2159.492] (-2153.290) -- 0:03:24 230000 -- (-2156.406) (-2152.344) [-2156.955] (-2162.646) * [-2155.545] (-2155.660) (-2158.451) (-2159.269) -- 0:03:24 Average standard deviation of split frequencies: 0.005109 230500 -- (-2157.543) (-2167.246) [-2151.692] (-2159.186) * (-2164.321) (-2157.479) (-2161.856) [-2153.139] -- 0:03:26 231000 -- [-2162.123] (-2158.306) (-2157.982) (-2174.791) * (-2157.455) [-2154.717] (-2156.029) (-2157.420) -- 0:03:26 231500 -- (-2159.473) (-2159.440) (-2157.677) [-2154.419] * (-2157.552) [-2157.040] (-2163.789) (-2158.421) -- 0:03:25 232000 -- [-2155.692] (-2158.767) (-2154.526) (-2153.326) * (-2160.612) (-2160.884) [-2157.477] (-2160.865) -- 0:03:25 232500 -- [-2156.692] (-2158.100) (-2155.779) (-2155.836) * [-2157.849] (-2156.546) (-2157.584) (-2159.232) -- 0:03:24 233000 -- (-2159.942) (-2155.195) (-2161.176) [-2155.240] * (-2157.910) [-2160.444] (-2158.191) (-2160.109) -- 0:03:24 233500 -- (-2156.501) (-2156.208) (-2158.856) [-2155.197] * (-2157.665) (-2156.488) (-2154.630) [-2154.684] -- 0:03:23 234000 -- (-2156.802) (-2152.062) [-2153.305] (-2151.977) * [-2155.521] (-2162.809) (-2160.256) (-2152.119) -- 0:03:26 234500 -- (-2155.795) (-2155.510) [-2157.862] (-2151.605) * [-2157.110] (-2158.454) (-2160.851) (-2162.759) -- 0:03:25 235000 -- (-2152.593) (-2152.386) (-2159.511) [-2152.817] * (-2158.510) (-2154.653) (-2163.872) [-2157.603] -- 0:03:25 Average standard deviation of split frequencies: 0.004994 235500 -- (-2157.833) (-2158.947) (-2163.784) [-2154.845] * (-2152.545) (-2161.362) [-2167.262] (-2158.475) -- 0:03:24 236000 -- (-2155.202) [-2156.670] (-2161.073) (-2160.892) * (-2154.785) (-2156.839) (-2159.955) [-2159.931] -- 0:03:23 236500 -- [-2154.706] (-2159.875) (-2155.448) (-2163.292) * (-2158.753) [-2157.433] (-2163.553) (-2160.245) -- 0:03:23 237000 -- [-2153.173] (-2160.421) (-2164.104) (-2152.436) * (-2157.621) (-2164.263) (-2158.535) [-2160.601] -- 0:03:22 237500 -- [-2153.920] (-2151.215) (-2160.155) (-2157.154) * (-2152.672) [-2151.725] (-2159.435) (-2156.210) -- 0:03:25 238000 -- (-2163.466) [-2157.319] (-2153.487) (-2154.455) * (-2157.885) (-2162.904) (-2151.885) [-2150.745] -- 0:03:24 238500 -- (-2156.125) (-2158.465) [-2153.626] (-2160.967) * (-2154.541) [-2157.747] (-2160.336) (-2159.523) -- 0:03:24 239000 -- (-2153.236) (-2159.640) (-2159.127) [-2155.493] * (-2165.942) (-2158.479) [-2157.966] (-2160.567) -- 0:03:23 239500 -- (-2160.988) (-2155.670) (-2156.118) [-2154.495] * (-2158.725) (-2157.487) [-2163.120] (-2157.505) -- 0:03:23 240000 -- (-2152.819) (-2157.777) (-2159.946) [-2163.424] * (-2151.953) (-2162.564) (-2165.184) [-2161.258] -- 0:03:22 Average standard deviation of split frequencies: 0.004897 240500 -- [-2151.989] (-2151.432) (-2161.917) (-2156.412) * (-2156.682) (-2163.574) [-2162.605] (-2160.116) -- 0:03:22 241000 -- (-2158.961) (-2160.963) (-2156.346) [-2157.391] * (-2156.889) [-2155.745] (-2158.585) (-2161.695) -- 0:03:21 241500 -- (-2155.095) [-2152.087] (-2156.035) (-2159.388) * (-2158.877) (-2166.535) [-2158.035] (-2164.394) -- 0:03:24 242000 -- (-2164.223) (-2152.409) [-2153.263] (-2159.082) * [-2154.634] (-2163.129) (-2155.956) (-2156.256) -- 0:03:23 242500 -- [-2156.907] (-2155.779) (-2159.247) (-2155.479) * [-2153.292] (-2159.207) (-2158.794) (-2160.148) -- 0:03:23 243000 -- (-2153.485) (-2157.565) (-2159.643) [-2157.370] * (-2152.039) (-2157.132) (-2161.328) [-2159.930] -- 0:03:22 243500 -- (-2161.393) (-2157.652) (-2167.254) [-2154.132] * [-2155.211] (-2156.156) (-2154.708) (-2162.185) -- 0:03:21 244000 -- (-2165.368) (-2154.878) (-2165.041) [-2152.222] * (-2149.297) (-2155.115) (-2156.937) [-2160.380] -- 0:03:21 244500 -- (-2156.456) (-2165.957) (-2159.132) [-2151.493] * (-2158.517) (-2156.495) [-2160.304] (-2162.027) -- 0:03:20 245000 -- (-2158.125) (-2156.643) [-2156.329] (-2163.866) * [-2156.229] (-2161.367) (-2165.333) (-2162.671) -- 0:03:20 Average standard deviation of split frequencies: 0.004791 245500 -- (-2153.506) (-2162.937) (-2160.355) [-2156.902] * (-2156.060) [-2155.597] (-2163.531) (-2157.871) -- 0:03:22 246000 -- (-2167.981) (-2158.286) (-2160.328) [-2156.014] * (-2157.166) [-2153.932] (-2162.825) (-2156.577) -- 0:03:22 246500 -- (-2164.637) [-2159.288] (-2164.957) (-2156.522) * (-2159.353) (-2155.318) (-2155.741) [-2158.731] -- 0:03:21 247000 -- (-2159.482) (-2159.598) [-2158.151] (-2154.752) * (-2153.526) (-2162.609) [-2154.912] (-2156.920) -- 0:03:21 247500 -- (-2157.742) (-2160.097) [-2160.367] (-2158.202) * [-2153.982] (-2159.593) (-2153.159) (-2162.147) -- 0:03:20 248000 -- (-2156.618) [-2165.421] (-2158.507) (-2155.719) * (-2153.280) [-2163.716] (-2160.474) (-2161.866) -- 0:03:20 248500 -- (-2161.788) (-2164.057) [-2158.904] (-2154.006) * (-2154.179) (-2156.939) [-2159.837] (-2161.344) -- 0:03:19 249000 -- (-2160.824) (-2163.933) (-2159.582) [-2159.428] * [-2154.362] (-2163.546) (-2153.584) (-2161.550) -- 0:03:22 249500 -- (-2163.499) (-2166.583) (-2160.096) [-2153.985] * (-2155.673) (-2158.574) [-2160.380] (-2160.933) -- 0:03:21 250000 -- (-2160.746) (-2158.079) (-2164.307) [-2156.805] * (-2154.054) [-2159.654] (-2158.592) (-2161.655) -- 0:03:21 Average standard deviation of split frequencies: 0.004231 250500 -- (-2159.674) (-2161.036) (-2159.954) [-2155.279] * (-2158.191) [-2161.047] (-2159.054) (-2159.669) -- 0:03:20 251000 -- [-2156.526] (-2154.818) (-2155.712) (-2153.459) * (-2158.287) (-2156.938) (-2160.526) [-2154.421] -- 0:03:19 251500 -- (-2155.798) (-2166.386) [-2162.717] (-2154.751) * (-2163.793) (-2154.061) [-2160.519] (-2160.596) -- 0:03:19 252000 -- (-2157.216) (-2165.714) [-2151.175] (-2158.984) * (-2163.259) (-2155.756) (-2162.109) [-2154.920] -- 0:03:18 252500 -- (-2165.016) (-2155.181) (-2155.859) [-2162.795] * (-2158.966) [-2159.676] (-2157.088) (-2157.573) -- 0:03:18 253000 -- (-2163.340) [-2160.411] (-2155.099) (-2155.860) * (-2160.695) [-2159.591] (-2159.534) (-2156.130) -- 0:03:20 253500 -- (-2160.430) [-2152.501] (-2158.127) (-2171.921) * (-2158.623) [-2155.411] (-2164.996) (-2159.989) -- 0:03:20 254000 -- (-2163.507) (-2151.930) (-2166.957) [-2155.598] * (-2157.782) (-2162.932) [-2155.414] (-2157.682) -- 0:03:19 254500 -- (-2161.239) [-2156.157] (-2157.837) (-2158.064) * [-2157.856] (-2156.541) (-2151.440) (-2156.233) -- 0:03:19 255000 -- [-2151.706] (-2162.308) (-2155.649) (-2156.871) * (-2160.695) (-2154.888) [-2158.968] (-2155.123) -- 0:03:18 Average standard deviation of split frequencies: 0.004604 255500 -- (-2156.117) [-2152.249] (-2158.353) (-2168.344) * (-2152.764) (-2156.603) [-2156.302] (-2157.731) -- 0:03:18 256000 -- (-2156.123) [-2159.008] (-2159.414) (-2158.435) * (-2163.635) (-2150.126) [-2156.603] (-2158.484) -- 0:03:17 256500 -- (-2163.207) [-2160.564] (-2161.532) (-2152.263) * [-2158.630] (-2157.786) (-2157.097) (-2155.359) -- 0:03:20 257000 -- (-2162.478) [-2152.819] (-2163.451) (-2153.329) * (-2157.378) (-2157.540) (-2157.136) [-2158.379] -- 0:03:19 257500 -- (-2161.334) (-2154.571) (-2159.673) [-2158.618] * (-2158.049) (-2152.783) [-2153.006] (-2158.941) -- 0:03:18 258000 -- (-2158.689) (-2153.407) [-2156.486] (-2154.700) * (-2161.447) (-2161.242) (-2157.012) [-2149.871] -- 0:03:18 258500 -- (-2156.140) (-2158.003) [-2158.250] (-2150.324) * (-2160.354) (-2152.754) (-2154.044) [-2156.532] -- 0:03:17 259000 -- (-2157.023) (-2164.779) [-2154.351] (-2154.783) * [-2155.174] (-2153.528) (-2160.611) (-2152.447) -- 0:03:17 259500 -- (-2151.462) [-2157.485] (-2164.341) (-2154.514) * (-2162.431) [-2161.153] (-2159.683) (-2161.899) -- 0:03:16 260000 -- (-2155.842) [-2161.127] (-2159.418) (-2150.316) * (-2158.386) (-2160.946) [-2156.299] (-2161.277) -- 0:03:16 Average standard deviation of split frequencies: 0.005425 260500 -- (-2154.431) (-2156.503) (-2161.533) [-2153.220] * (-2164.029) (-2166.027) [-2158.889] (-2154.602) -- 0:03:18 261000 -- (-2161.589) [-2156.789] (-2159.314) (-2155.776) * (-2166.340) (-2168.863) [-2153.598] (-2159.357) -- 0:03:18 261500 -- [-2153.663] (-2157.991) (-2154.450) (-2154.278) * [-2161.390] (-2158.560) (-2153.722) (-2161.571) -- 0:03:17 262000 -- (-2157.793) (-2161.931) [-2160.912] (-2155.083) * [-2158.086] (-2158.175) (-2158.768) (-2159.758) -- 0:03:17 262500 -- (-2160.807) [-2154.922] (-2156.792) (-2156.837) * [-2159.165] (-2159.083) (-2152.067) (-2159.677) -- 0:03:16 263000 -- (-2156.917) (-2152.011) [-2157.063] (-2150.515) * (-2171.614) (-2158.072) [-2152.341] (-2156.344) -- 0:03:16 263500 -- (-2153.946) (-2164.858) [-2155.344] (-2151.381) * (-2164.024) (-2160.213) (-2151.435) [-2155.490] -- 0:03:15 264000 -- [-2153.273] (-2160.963) (-2158.187) (-2153.785) * (-2159.277) (-2159.705) [-2159.154] (-2155.925) -- 0:03:17 264500 -- [-2150.886] (-2163.893) (-2151.234) (-2157.538) * (-2158.351) (-2163.782) (-2152.468) [-2158.548] -- 0:03:17 265000 -- (-2161.546) (-2158.253) [-2154.875] (-2150.997) * (-2154.361) (-2154.437) [-2154.709] (-2156.003) -- 0:03:16 Average standard deviation of split frequencies: 0.006646 265500 -- [-2151.714] (-2159.976) (-2156.133) (-2155.628) * (-2156.031) (-2156.450) [-2149.267] (-2156.560) -- 0:03:16 266000 -- (-2161.409) (-2162.204) (-2155.917) [-2151.464] * [-2155.928] (-2154.784) (-2154.363) (-2154.264) -- 0:03:15 266500 -- (-2160.353) (-2161.114) (-2160.245) [-2153.027] * (-2157.454) [-2156.291] (-2156.583) (-2164.045) -- 0:03:15 267000 -- (-2173.587) (-2158.370) (-2161.165) [-2155.820] * [-2153.043] (-2164.131) (-2166.838) (-2163.625) -- 0:03:14 267500 -- (-2159.849) (-2159.282) [-2160.050] (-2157.401) * [-2153.606] (-2157.715) (-2161.277) (-2152.122) -- 0:03:14 268000 -- (-2156.381) (-2170.381) (-2161.463) [-2158.499] * (-2156.731) [-2157.741] (-2155.016) (-2158.827) -- 0:03:16 268500 -- (-2156.813) (-2171.903) [-2158.845] (-2156.692) * (-2151.309) (-2152.381) [-2157.187] (-2155.901) -- 0:03:16 269000 -- (-2154.928) (-2158.512) (-2159.992) [-2158.496] * (-2158.054) [-2153.411] (-2162.138) (-2161.480) -- 0:03:15 269500 -- (-2159.164) [-2160.101] (-2163.554) (-2158.309) * (-2162.968) [-2158.223] (-2156.030) (-2170.274) -- 0:03:15 270000 -- (-2155.952) (-2165.659) (-2161.147) [-2150.461] * [-2158.032] (-2158.983) (-2156.262) (-2161.140) -- 0:03:14 Average standard deviation of split frequencies: 0.005660 270500 -- [-2152.619] (-2171.724) (-2160.581) (-2153.803) * (-2154.546) [-2167.234] (-2166.381) (-2168.329) -- 0:03:14 271000 -- (-2155.677) (-2162.004) [-2154.649] (-2154.403) * (-2153.640) (-2159.950) (-2156.696) [-2160.087] -- 0:03:13 271500 -- [-2155.518] (-2157.780) (-2155.157) (-2162.110) * (-2153.095) [-2155.650] (-2159.129) (-2156.229) -- 0:03:15 272000 -- (-2165.495) (-2163.402) (-2153.224) [-2157.901] * (-2157.131) (-2158.963) [-2155.239] (-2160.231) -- 0:03:15 272500 -- (-2160.059) (-2160.161) [-2156.333] (-2152.446) * [-2155.346] (-2159.580) (-2157.631) (-2157.044) -- 0:03:14 273000 -- (-2156.985) (-2161.067) (-2153.767) [-2151.661] * [-2159.287] (-2157.368) (-2168.127) (-2156.693) -- 0:03:14 273500 -- (-2160.304) [-2156.858] (-2152.158) (-2162.199) * [-2155.631] (-2157.134) (-2160.687) (-2163.269) -- 0:03:13 274000 -- (-2156.869) (-2163.656) (-2156.257) [-2155.794] * (-2148.517) (-2161.852) [-2161.060] (-2157.251) -- 0:03:13 274500 -- [-2161.989] (-2158.882) (-2157.577) (-2163.386) * (-2154.358) (-2159.981) [-2157.344] (-2164.540) -- 0:03:12 275000 -- (-2160.927) [-2158.868] (-2162.184) (-2160.264) * (-2155.970) (-2161.066) (-2158.679) [-2157.433] -- 0:03:12 Average standard deviation of split frequencies: 0.006405 275500 -- [-2162.942] (-2165.778) (-2162.940) (-2155.469) * (-2156.699) (-2158.862) [-2158.934] (-2154.786) -- 0:03:14 276000 -- [-2163.402] (-2162.855) (-2162.387) (-2168.595) * (-2159.211) (-2159.164) [-2159.445] (-2154.948) -- 0:03:14 276500 -- (-2177.701) (-2159.479) [-2159.060] (-2161.245) * (-2159.472) [-2155.753] (-2159.318) (-2158.203) -- 0:03:13 277000 -- (-2158.601) (-2155.546) (-2163.026) [-2154.091] * [-2156.050] (-2170.466) (-2157.431) (-2157.839) -- 0:03:13 277500 -- (-2163.183) [-2161.110] (-2155.574) (-2156.243) * [-2153.313] (-2156.947) (-2155.593) (-2168.004) -- 0:03:12 278000 -- (-2162.870) (-2160.408) [-2154.529] (-2163.329) * [-2157.365] (-2155.236) (-2153.294) (-2170.866) -- 0:03:12 278500 -- (-2170.030) [-2150.651] (-2152.140) (-2157.557) * (-2160.606) (-2153.585) [-2152.955] (-2161.393) -- 0:03:11 279000 -- (-2158.407) [-2157.728] (-2156.781) (-2157.901) * [-2157.145] (-2157.981) (-2157.087) (-2162.658) -- 0:03:13 279500 -- (-2161.279) (-2153.421) (-2157.682) [-2158.561] * [-2157.576] (-2156.633) (-2159.625) (-2164.501) -- 0:03:13 280000 -- (-2158.509) (-2156.395) (-2154.767) [-2153.753] * [-2157.475] (-2159.110) (-2157.180) (-2163.421) -- 0:03:12 Average standard deviation of split frequencies: 0.007138 280500 -- (-2160.945) (-2154.846) (-2157.094) [-2151.622] * (-2157.823) (-2160.892) [-2156.721] (-2162.413) -- 0:03:12 281000 -- (-2152.268) [-2153.693] (-2154.862) (-2153.960) * (-2163.332) (-2162.804) (-2157.992) [-2156.925] -- 0:03:11 281500 -- [-2154.579] (-2157.961) (-2155.880) (-2157.140) * (-2154.008) [-2155.210] (-2153.929) (-2154.795) -- 0:03:11 282000 -- [-2153.443] (-2156.884) (-2156.397) (-2155.549) * (-2155.199) (-2160.140) [-2155.273] (-2152.025) -- 0:03:10 282500 -- [-2152.429] (-2159.365) (-2156.415) (-2163.334) * (-2155.032) (-2158.482) [-2159.606] (-2160.683) -- 0:03:10 283000 -- [-2148.768] (-2152.292) (-2168.167) (-2154.981) * (-2163.724) (-2150.118) (-2157.476) [-2156.003] -- 0:03:12 283500 -- (-2158.920) [-2156.757] (-2157.689) (-2163.321) * [-2157.096] (-2158.300) (-2157.957) (-2153.051) -- 0:03:12 284000 -- (-2170.121) (-2152.783) [-2155.221] (-2158.486) * (-2166.777) (-2169.544) [-2154.830] (-2160.719) -- 0:03:11 284500 -- [-2161.796] (-2154.651) (-2158.501) (-2164.293) * (-2160.012) (-2157.250) [-2155.916] (-2155.348) -- 0:03:11 285000 -- (-2159.615) [-2158.040] (-2157.212) (-2159.225) * (-2163.054) (-2158.780) [-2155.753] (-2162.653) -- 0:03:10 Average standard deviation of split frequencies: 0.007005 285500 -- [-2155.645] (-2158.911) (-2157.893) (-2157.385) * (-2161.557) (-2155.880) [-2154.779] (-2156.191) -- 0:03:10 286000 -- (-2162.523) [-2153.347] (-2157.550) (-2159.141) * [-2159.357] (-2169.837) (-2150.526) (-2159.574) -- 0:03:09 286500 -- (-2155.980) (-2159.778) (-2162.335) [-2158.461] * (-2161.622) [-2158.828] (-2159.361) (-2159.806) -- 0:03:11 287000 -- (-2154.272) (-2154.377) (-2164.711) [-2155.399] * [-2153.290] (-2165.443) (-2153.982) (-2158.185) -- 0:03:11 287500 -- (-2158.090) [-2153.573] (-2156.046) (-2159.177) * (-2162.353) (-2165.845) [-2152.973] (-2153.678) -- 0:03:10 288000 -- (-2152.477) (-2162.140) [-2160.914] (-2163.429) * (-2159.847) (-2158.744) [-2153.003] (-2152.921) -- 0:03:10 288500 -- [-2156.341] (-2160.039) (-2153.495) (-2156.044) * (-2160.204) (-2155.045) (-2153.210) [-2159.070] -- 0:03:09 289000 -- (-2153.589) (-2163.999) [-2154.739] (-2167.457) * (-2167.145) (-2153.587) (-2158.846) [-2152.126] -- 0:03:09 289500 -- (-2154.553) (-2160.502) [-2153.368] (-2158.898) * [-2164.033] (-2154.151) (-2154.936) (-2163.426) -- 0:03:08 290000 -- (-2157.115) [-2155.505] (-2154.909) (-2156.907) * (-2163.428) (-2159.303) [-2157.381] (-2154.493) -- 0:03:08 Average standard deviation of split frequencies: 0.002838 290500 -- [-2157.543] (-2161.167) (-2157.096) (-2158.060) * [-2156.720] (-2151.088) (-2158.489) (-2155.099) -- 0:03:10 291000 -- (-2157.112) (-2158.829) [-2158.156] (-2159.503) * (-2159.043) [-2155.346] (-2163.846) (-2157.458) -- 0:03:10 291500 -- (-2160.936) (-2159.053) (-2158.511) [-2160.962] * (-2152.816) (-2153.499) [-2156.378] (-2155.692) -- 0:03:09 292000 -- (-2160.104) (-2159.351) [-2154.106] (-2162.803) * (-2159.552) (-2156.304) (-2160.968) [-2150.330] -- 0:03:09 292500 -- [-2154.328] (-2157.378) (-2157.135) (-2159.633) * (-2163.416) (-2154.263) [-2167.932] (-2157.943) -- 0:03:08 293000 -- (-2159.173) [-2156.196] (-2164.822) (-2157.339) * [-2163.645] (-2168.968) (-2155.586) (-2154.960) -- 0:03:08 293500 -- (-2153.859) (-2155.339) (-2156.018) [-2163.471] * (-2158.268) [-2155.106] (-2154.592) (-2158.500) -- 0:03:07 294000 -- (-2156.120) [-2154.852] (-2161.687) (-2160.413) * [-2154.621] (-2159.295) (-2152.687) (-2162.285) -- 0:03:09 294500 -- (-2156.914) (-2162.131) (-2159.389) [-2154.933] * [-2154.616] (-2165.718) (-2155.801) (-2161.188) -- 0:03:09 295000 -- (-2155.247) (-2164.068) [-2159.079] (-2163.002) * (-2159.292) [-2159.042] (-2157.651) (-2164.274) -- 0:03:08 Average standard deviation of split frequencies: 0.004380 295500 -- (-2158.398) [-2161.505] (-2158.080) (-2162.181) * (-2155.385) (-2158.599) [-2154.125] (-2160.746) -- 0:03:08 296000 -- (-2166.028) (-2161.110) [-2155.622] (-2162.833) * (-2158.398) [-2153.799] (-2160.290) (-2159.942) -- 0:03:07 296500 -- (-2158.263) (-2159.999) [-2157.263] (-2168.837) * (-2151.938) (-2158.501) [-2152.374] (-2157.764) -- 0:03:07 297000 -- (-2150.151) (-2157.796) [-2158.941] (-2162.363) * [-2152.549] (-2154.198) (-2163.152) (-2154.437) -- 0:03:06 297500 -- (-2161.001) (-2154.059) (-2157.935) [-2161.770] * (-2160.778) (-2160.441) [-2156.189] (-2155.572) -- 0:03:06 298000 -- (-2159.633) (-2160.952) [-2158.886] (-2159.648) * (-2160.450) (-2153.653) [-2154.267] (-2157.820) -- 0:03:08 298500 -- (-2157.920) (-2154.193) (-2159.713) [-2155.614] * (-2154.044) [-2153.848] (-2160.011) (-2154.345) -- 0:03:08 299000 -- (-2161.407) (-2154.130) (-2161.559) [-2154.707] * (-2156.384) [-2155.729] (-2156.492) (-2159.438) -- 0:03:07 299500 -- (-2161.856) (-2167.046) (-2153.727) [-2151.798] * (-2161.703) (-2151.767) (-2165.990) [-2154.051] -- 0:03:07 300000 -- [-2162.811] (-2154.335) (-2160.469) (-2156.285) * [-2155.450] (-2159.340) (-2158.228) (-2152.968) -- 0:03:06 Average standard deviation of split frequencies: 0.003920 300500 -- (-2160.423) [-2154.617] (-2164.488) (-2157.184) * [-2154.907] (-2154.778) (-2158.875) (-2159.009) -- 0:03:06 301000 -- (-2161.742) (-2157.065) [-2153.327] (-2165.178) * (-2158.200) [-2155.080] (-2161.905) (-2154.740) -- 0:03:05 301500 -- (-2154.605) [-2155.683] (-2153.989) (-2156.102) * (-2162.920) (-2166.334) (-2158.908) [-2158.680] -- 0:03:07 302000 -- (-2157.643) (-2162.006) [-2158.096] (-2155.077) * (-2163.891) (-2161.531) (-2150.011) [-2155.995] -- 0:03:07 302500 -- (-2162.783) (-2153.470) (-2154.370) [-2156.085] * (-2171.956) [-2160.615] (-2156.761) (-2154.600) -- 0:03:06 303000 -- [-2155.962] (-2155.040) (-2159.736) (-2158.259) * (-2171.762) [-2156.875] (-2158.415) (-2171.875) -- 0:03:06 303500 -- (-2153.637) [-2157.521] (-2159.442) (-2156.485) * (-2163.173) (-2164.474) [-2155.366] (-2167.651) -- 0:03:05 304000 -- (-2152.075) [-2153.608] (-2157.240) (-2158.173) * (-2162.480) [-2157.900] (-2160.639) (-2167.190) -- 0:03:05 304500 -- (-2157.545) [-2156.476] (-2156.859) (-2162.250) * (-2156.407) (-2156.343) (-2153.732) [-2158.008] -- 0:03:05 305000 -- [-2156.537] (-2152.846) (-2154.948) (-2154.218) * (-2158.687) (-2157.832) (-2159.446) [-2152.854] -- 0:03:04 Average standard deviation of split frequencies: 0.004236 305500 -- [-2153.588] (-2153.009) (-2154.211) (-2153.005) * [-2155.690] (-2157.023) (-2153.611) (-2157.811) -- 0:03:06 306000 -- (-2150.539) (-2154.205) (-2155.543) [-2152.333] * (-2159.269) (-2160.170) [-2156.110] (-2158.241) -- 0:03:05 306500 -- (-2156.124) [-2154.086] (-2156.851) (-2162.904) * (-2164.619) [-2160.866] (-2154.607) (-2154.903) -- 0:03:05 307000 -- (-2160.664) (-2161.340) [-2154.565] (-2154.662) * (-2160.674) [-2164.154] (-2162.927) (-2158.168) -- 0:03:05 307500 -- [-2154.189] (-2157.180) (-2170.562) (-2159.766) * [-2157.757] (-2159.719) (-2153.092) (-2155.704) -- 0:03:04 308000 -- (-2162.929) [-2155.943] (-2157.941) (-2151.793) * [-2158.088] (-2163.594) (-2154.137) (-2156.255) -- 0:03:04 308500 -- [-2158.976] (-2169.772) (-2156.258) (-2154.117) * [-2153.285] (-2156.699) (-2163.305) (-2160.540) -- 0:03:03 309000 -- (-2155.806) [-2153.557] (-2151.767) (-2160.997) * (-2152.955) [-2153.948] (-2165.031) (-2160.925) -- 0:03:05 309500 -- (-2153.959) [-2153.582] (-2157.123) (-2154.941) * (-2154.817) [-2160.745] (-2154.850) (-2163.920) -- 0:03:05 310000 -- (-2156.659) [-2157.252] (-2163.715) (-2157.030) * (-2156.935) (-2151.266) [-2153.949] (-2156.213) -- 0:03:04 Average standard deviation of split frequencies: 0.004173 310500 -- (-2156.028) [-2156.331] (-2156.949) (-2160.670) * (-2156.082) [-2162.049] (-2157.823) (-2160.736) -- 0:03:04 311000 -- (-2159.621) (-2154.607) (-2156.979) [-2152.975] * (-2166.606) [-2151.119] (-2160.995) (-2162.811) -- 0:03:03 311500 -- (-2155.894) [-2156.117] (-2159.733) (-2158.074) * (-2158.396) (-2157.620) (-2161.603) [-2153.604] -- 0:03:03 312000 -- (-2159.683) [-2154.009] (-2157.601) (-2161.322) * (-2166.468) (-2152.962) (-2156.820) [-2155.771] -- 0:03:03 312500 -- (-2160.964) (-2152.644) (-2159.544) [-2160.548] * (-2164.721) [-2156.228] (-2165.852) (-2157.866) -- 0:03:02 313000 -- [-2153.752] (-2154.064) (-2157.671) (-2164.541) * (-2162.013) [-2152.537] (-2155.803) (-2158.821) -- 0:03:04 313500 -- (-2157.575) (-2156.536) [-2156.488] (-2155.285) * (-2168.676) [-2154.628] (-2167.888) (-2157.368) -- 0:03:03 314000 -- (-2154.347) [-2160.030] (-2156.749) (-2159.419) * (-2163.319) (-2155.212) (-2161.084) [-2166.302] -- 0:03:03 314500 -- (-2161.566) (-2155.608) (-2154.108) [-2154.106] * [-2162.208] (-2154.898) (-2167.841) (-2156.891) -- 0:03:03 315000 -- [-2150.869] (-2158.384) (-2154.758) (-2154.047) * (-2158.336) [-2152.994] (-2162.117) (-2156.964) -- 0:03:02 Average standard deviation of split frequencies: 0.004102 315500 -- (-2156.960) [-2154.593] (-2154.334) (-2157.914) * [-2157.687] (-2163.097) (-2158.896) (-2155.833) -- 0:03:02 316000 -- [-2155.619] (-2162.187) (-2154.805) (-2153.419) * (-2161.024) (-2158.359) (-2153.659) [-2154.328] -- 0:03:01 316500 -- [-2157.189] (-2161.221) (-2154.024) (-2157.555) * (-2156.976) (-2155.536) (-2154.027) [-2153.974] -- 0:03:01 317000 -- (-2153.200) [-2157.635] (-2159.978) (-2158.460) * (-2160.835) [-2156.209] (-2156.140) (-2154.176) -- 0:03:03 317500 -- (-2157.038) (-2164.347) [-2155.722] (-2164.731) * [-2154.875] (-2160.830) (-2157.802) (-2164.519) -- 0:03:02 318000 -- (-2156.364) (-2164.922) (-2162.032) [-2162.165] * (-2160.020) (-2161.309) [-2155.641] (-2164.246) -- 0:03:02 318500 -- (-2151.941) (-2161.023) [-2161.570] (-2156.724) * (-2157.465) (-2156.917) (-2162.598) [-2156.172] -- 0:03:01 319000 -- (-2158.892) (-2158.914) (-2157.757) [-2153.792] * (-2156.618) (-2152.928) (-2157.701) [-2153.997] -- 0:03:01 319500 -- (-2159.382) (-2161.512) (-2156.801) [-2151.746] * [-2160.729] (-2157.884) (-2168.340) (-2154.800) -- 0:03:01 320000 -- (-2154.752) (-2157.513) (-2154.769) [-2152.315] * (-2157.204) [-2149.921] (-2158.448) (-2156.265) -- 0:03:00 Average standard deviation of split frequencies: 0.004778 320500 -- (-2158.146) [-2155.162] (-2161.915) (-2155.993) * (-2158.205) (-2153.023) (-2159.327) [-2156.772] -- 0:03:02 321000 -- [-2160.987] (-2154.055) (-2161.288) (-2157.799) * (-2154.986) (-2159.652) (-2151.791) [-2152.828] -- 0:03:01 321500 -- (-2155.169) [-2159.054] (-2172.883) (-2157.790) * (-2160.386) (-2160.500) [-2158.615] (-2161.641) -- 0:03:01 322000 -- (-2155.124) (-2165.866) [-2161.904] (-2165.087) * (-2154.515) [-2153.531] (-2155.101) (-2162.024) -- 0:03:01 322500 -- (-2161.313) [-2158.173] (-2154.064) (-2159.145) * [-2152.751] (-2157.836) (-2155.812) (-2160.877) -- 0:03:00 323000 -- (-2157.544) (-2160.234) (-2163.824) [-2153.341] * (-2164.190) [-2154.126] (-2158.888) (-2155.561) -- 0:03:00 323500 -- (-2165.357) (-2154.396) (-2162.484) [-2161.356] * (-2159.696) (-2159.692) [-2154.365] (-2156.701) -- 0:02:59 324000 -- [-2155.079] (-2157.670) (-2157.860) (-2160.723) * (-2157.514) (-2159.592) (-2157.926) [-2155.363] -- 0:02:59 324500 -- (-2157.291) [-2155.954] (-2158.965) (-2158.789) * (-2156.731) (-2157.627) (-2162.167) [-2159.204] -- 0:03:01 325000 -- [-2153.362] (-2154.270) (-2156.642) (-2151.922) * (-2155.042) (-2157.669) [-2161.591] (-2151.095) -- 0:03:00 Average standard deviation of split frequencies: 0.003254 325500 -- (-2167.532) [-2150.541] (-2158.797) (-2163.134) * (-2157.188) (-2161.442) [-2154.074] (-2160.384) -- 0:03:00 326000 -- [-2161.823] (-2159.130) (-2161.188) (-2165.459) * (-2160.239) [-2155.843] (-2162.858) (-2160.166) -- 0:02:59 326500 -- (-2162.797) (-2150.733) (-2154.108) [-2158.604] * (-2158.764) (-2161.395) (-2155.519) [-2154.249] -- 0:02:59 327000 -- [-2157.390] (-2159.737) (-2158.136) (-2152.143) * (-2157.445) (-2156.409) (-2156.392) [-2157.133] -- 0:02:59 327500 -- (-2157.237) (-2159.063) [-2155.859] (-2160.777) * (-2152.025) (-2159.470) [-2153.033] (-2156.677) -- 0:02:58 328000 -- (-2159.174) (-2154.465) [-2152.754] (-2155.918) * (-2160.359) [-2154.948] (-2157.980) (-2155.271) -- 0:03:00 328500 -- [-2156.032] (-2154.899) (-2159.870) (-2158.956) * (-2158.171) [-2155.473] (-2155.023) (-2158.986) -- 0:02:59 329000 -- (-2153.855) [-2158.354] (-2160.579) (-2152.814) * (-2154.794) [-2152.808] (-2165.971) (-2155.808) -- 0:02:59 329500 -- [-2149.264] (-2161.154) (-2160.979) (-2154.485) * (-2161.686) [-2155.107] (-2161.110) (-2158.707) -- 0:02:59 330000 -- (-2153.647) [-2157.389] (-2153.405) (-2152.950) * (-2156.570) (-2154.402) [-2155.865] (-2157.223) -- 0:02:58 Average standard deviation of split frequencies: 0.003208 330500 -- (-2157.057) (-2158.902) [-2157.351] (-2155.284) * (-2157.900) [-2153.013] (-2157.165) (-2160.798) -- 0:02:58 331000 -- [-2150.078] (-2161.098) (-2152.226) (-2160.379) * (-2167.132) (-2158.274) [-2157.681] (-2164.122) -- 0:02:57 331500 -- (-2159.780) (-2163.700) (-2155.012) [-2154.871] * [-2158.522] (-2162.552) (-2160.143) (-2160.255) -- 0:02:57 332000 -- (-2159.981) (-2151.104) (-2154.994) [-2152.466] * (-2152.302) (-2167.706) (-2157.015) [-2158.957] -- 0:02:59 332500 -- [-2154.406] (-2160.614) (-2160.661) (-2156.749) * (-2159.302) (-2156.665) [-2171.066] (-2161.458) -- 0:02:58 333000 -- (-2155.097) (-2162.345) [-2153.217] (-2157.940) * (-2156.486) [-2156.523] (-2161.788) (-2154.090) -- 0:02:58 333500 -- (-2156.301) (-2166.334) (-2157.632) [-2151.388] * (-2160.777) (-2159.056) (-2168.314) [-2155.511] -- 0:02:57 334000 -- (-2157.919) (-2167.550) [-2157.972] (-2158.822) * (-2161.469) [-2161.719] (-2172.100) (-2158.066) -- 0:02:57 334500 -- [-2151.659] (-2155.950) (-2157.219) (-2154.009) * (-2155.481) (-2158.217) (-2167.066) [-2155.895] -- 0:02:57 335000 -- (-2157.271) [-2159.083] (-2155.751) (-2156.963) * (-2156.791) (-2156.881) (-2163.677) [-2157.663] -- 0:02:56 Average standard deviation of split frequencies: 0.003157 335500 -- (-2156.633) (-2160.231) (-2155.215) [-2154.653] * [-2157.781] (-2155.176) (-2161.734) (-2153.009) -- 0:02:58 336000 -- (-2162.989) [-2157.396] (-2155.999) (-2164.747) * (-2155.516) (-2157.185) [-2163.270] (-2153.391) -- 0:02:57 336500 -- (-2156.097) [-2166.448] (-2154.782) (-2157.242) * (-2158.940) (-2157.369) (-2155.851) [-2153.633] -- 0:02:57 337000 -- (-2156.204) [-2154.539] (-2162.081) (-2156.729) * (-2165.994) (-2153.879) (-2154.143) [-2156.947] -- 0:02:57 337500 -- [-2157.821] (-2159.137) (-2153.307) (-2153.748) * (-2162.589) [-2151.393] (-2158.150) (-2154.974) -- 0:02:56 338000 -- (-2154.166) (-2161.405) (-2155.889) [-2156.154] * (-2158.539) (-2158.792) (-2159.463) [-2152.165] -- 0:02:56 338500 -- (-2157.543) (-2161.496) (-2155.070) [-2154.846] * (-2152.054) [-2157.214] (-2165.404) (-2159.700) -- 0:02:55 339000 -- [-2157.924] (-2159.487) (-2158.211) (-2158.837) * (-2155.262) (-2152.138) [-2152.942] (-2158.152) -- 0:02:55 339500 -- (-2154.677) (-2164.628) (-2154.430) [-2157.385] * (-2155.507) [-2158.415] (-2157.962) (-2164.404) -- 0:02:57 340000 -- [-2155.923] (-2167.045) (-2150.474) (-2158.132) * [-2157.630] (-2157.374) (-2164.175) (-2158.787) -- 0:02:56 Average standard deviation of split frequencies: 0.003113 340500 -- (-2157.384) (-2160.269) [-2153.197] (-2160.449) * [-2155.180] (-2153.057) (-2156.462) (-2158.164) -- 0:02:56 341000 -- (-2157.465) (-2166.246) [-2152.648] (-2163.490) * (-2152.971) (-2163.536) (-2160.775) [-2158.634] -- 0:02:55 341500 -- (-2155.115) (-2163.395) [-2151.488] (-2156.584) * [-2152.936] (-2154.611) (-2155.478) (-2157.714) -- 0:02:55 342000 -- (-2163.227) (-2156.999) [-2154.981] (-2158.229) * (-2152.332) (-2155.911) [-2154.929] (-2161.130) -- 0:02:55 342500 -- (-2168.481) (-2153.277) (-2155.103) [-2155.720] * (-2159.900) [-2155.773] (-2155.714) (-2154.790) -- 0:02:54 343000 -- (-2155.598) (-2153.090) [-2159.419] (-2160.164) * [-2155.265] (-2158.372) (-2159.993) (-2158.432) -- 0:02:56 343500 -- (-2156.920) (-2163.410) [-2154.354] (-2164.694) * [-2155.864] (-2159.284) (-2153.784) (-2156.360) -- 0:02:55 344000 -- [-2155.059] (-2161.306) (-2152.462) (-2161.941) * (-2157.207) [-2159.782] (-2164.881) (-2163.896) -- 0:02:55 344500 -- (-2158.511) (-2157.144) [-2152.980] (-2158.520) * (-2158.858) (-2156.263) (-2155.202) [-2154.804] -- 0:02:55 345000 -- (-2155.851) [-2157.469] (-2158.873) (-2155.772) * (-2151.539) [-2157.343] (-2157.657) (-2157.419) -- 0:02:54 Average standard deviation of split frequencies: 0.002725 345500 -- (-2156.540) (-2161.592) [-2158.630] (-2156.835) * [-2151.059] (-2156.772) (-2158.782) (-2159.118) -- 0:02:54 346000 -- (-2160.474) [-2160.802] (-2151.696) (-2154.068) * (-2155.723) (-2154.422) (-2153.653) [-2163.238] -- 0:02:53 346500 -- (-2158.895) (-2156.465) (-2166.374) [-2157.974] * [-2160.719] (-2156.403) (-2157.342) (-2156.367) -- 0:02:53 347000 -- (-2155.594) (-2159.381) (-2156.914) [-2160.622] * (-2152.810) [-2152.667] (-2154.649) (-2156.267) -- 0:02:55 347500 -- (-2170.521) (-2157.374) (-2162.088) [-2156.502] * (-2152.050) (-2155.920) (-2160.192) [-2152.212] -- 0:02:54 348000 -- [-2152.794] (-2163.581) (-2159.802) (-2160.338) * (-2153.371) (-2156.314) [-2156.350] (-2161.713) -- 0:02:54 348500 -- (-2159.648) [-2158.576] (-2169.173) (-2153.467) * (-2165.647) (-2160.843) [-2155.555] (-2156.227) -- 0:02:53 349000 -- [-2154.447] (-2155.430) (-2160.514) (-2156.404) * (-2164.408) (-2163.340) (-2158.695) [-2153.946] -- 0:02:53 349500 -- (-2154.774) (-2157.616) [-2159.254] (-2159.336) * (-2158.058) [-2159.300] (-2154.029) (-2155.913) -- 0:02:53 350000 -- (-2154.888) (-2156.610) (-2164.279) [-2157.389] * (-2158.357) (-2158.606) [-2155.906] (-2160.969) -- 0:02:52 Average standard deviation of split frequencies: 0.002689 350500 -- (-2149.790) [-2155.732] (-2166.675) (-2155.335) * (-2157.746) (-2163.756) (-2156.782) [-2154.824] -- 0:02:54 351000 -- (-2157.305) (-2157.503) (-2155.945) [-2155.962] * [-2157.307] (-2154.638) (-2157.234) (-2154.683) -- 0:02:53 351500 -- (-2155.019) (-2158.280) [-2157.398] (-2153.571) * (-2157.012) (-2155.316) (-2158.268) [-2158.006] -- 0:02:53 352000 -- (-2160.071) [-2160.610] (-2159.818) (-2156.143) * (-2152.295) [-2156.473] (-2151.514) (-2159.508) -- 0:02:53 352500 -- (-2155.900) (-2154.148) [-2152.641] (-2160.631) * [-2151.859] (-2156.974) (-2163.082) (-2166.136) -- 0:02:52 353000 -- (-2161.306) (-2153.987) [-2157.765] (-2168.561) * (-2158.517) (-2153.455) [-2157.686] (-2157.684) -- 0:02:52 353500 -- (-2160.692) [-2154.892] (-2160.653) (-2162.422) * (-2155.626) (-2154.583) [-2158.228] (-2153.774) -- 0:02:51 354000 -- (-2154.327) (-2159.192) [-2160.235] (-2165.483) * (-2161.283) (-2157.656) [-2154.758] (-2159.047) -- 0:02:51 354500 -- [-2151.065] (-2160.259) (-2155.905) (-2161.980) * (-2160.501) (-2162.534) [-2154.115] (-2157.542) -- 0:02:52 355000 -- (-2155.479) (-2158.799) [-2154.741] (-2162.632) * (-2153.718) [-2160.773] (-2158.822) (-2156.241) -- 0:02:52 Average standard deviation of split frequencies: 0.002648 355500 -- [-2156.327] (-2155.645) (-2162.628) (-2169.384) * (-2155.894) (-2156.440) [-2158.700] (-2157.621) -- 0:02:52 356000 -- [-2156.816] (-2151.317) (-2166.155) (-2162.091) * (-2156.436) [-2154.343] (-2168.575) (-2153.097) -- 0:02:51 356500 -- (-2156.867) [-2157.781] (-2153.606) (-2159.326) * (-2155.830) (-2160.678) [-2155.651] (-2158.820) -- 0:02:51 357000 -- (-2156.185) [-2162.108] (-2155.952) (-2157.259) * (-2158.535) (-2162.864) [-2152.846] (-2156.391) -- 0:02:51 357500 -- (-2158.590) (-2166.171) (-2158.769) [-2158.068] * (-2157.633) [-2154.103] (-2154.317) (-2165.094) -- 0:02:50 358000 -- (-2160.004) [-2152.410] (-2154.755) (-2157.866) * (-2159.159) (-2162.103) (-2163.773) [-2159.361] -- 0:02:52 358500 -- (-2158.623) (-2159.884) (-2160.213) [-2157.343] * (-2153.398) (-2161.054) (-2160.956) [-2153.694] -- 0:02:51 359000 -- (-2163.379) (-2159.045) [-2157.367] (-2163.768) * (-2159.138) [-2159.404] (-2155.170) (-2154.957) -- 0:02:51 359500 -- (-2156.509) [-2155.467] (-2157.977) (-2156.955) * (-2154.246) (-2158.997) [-2153.312] (-2154.492) -- 0:02:51 360000 -- (-2156.071) [-2153.705] (-2161.687) (-2156.699) * [-2159.457] (-2156.702) (-2160.959) (-2157.544) -- 0:02:50 Average standard deviation of split frequencies: 0.002614 360500 -- (-2156.940) [-2160.859] (-2154.344) (-2165.401) * (-2157.122) (-2158.368) [-2159.049] (-2156.451) -- 0:02:50 361000 -- [-2150.859] (-2156.272) (-2154.704) (-2158.924) * (-2152.770) (-2159.717) [-2155.446] (-2152.491) -- 0:02:49 361500 -- [-2160.852] (-2156.260) (-2157.786) (-2161.892) * (-2156.802) (-2161.840) [-2152.261] (-2151.861) -- 0:02:49 362000 -- (-2156.230) [-2157.746] (-2159.400) (-2160.583) * (-2156.511) [-2162.173] (-2157.026) (-2154.727) -- 0:02:50 362500 -- (-2151.534) (-2158.185) (-2161.284) [-2156.268] * [-2155.557] (-2165.931) (-2158.226) (-2161.575) -- 0:02:50 363000 -- (-2153.103) [-2150.213] (-2153.516) (-2152.801) * (-2161.470) (-2161.003) [-2155.108] (-2154.987) -- 0:02:50 363500 -- (-2159.567) [-2153.338] (-2154.746) (-2155.183) * (-2160.436) (-2158.150) [-2153.746] (-2163.226) -- 0:02:49 364000 -- (-2155.767) (-2155.790) (-2159.054) [-2151.736] * [-2155.783] (-2159.230) (-2163.251) (-2159.509) -- 0:02:49 364500 -- (-2161.723) [-2153.270] (-2154.799) (-2151.999) * (-2152.430) (-2165.748) [-2158.994] (-2162.076) -- 0:02:49 365000 -- (-2151.270) (-2157.444) [-2161.767] (-2153.333) * (-2153.354) (-2159.324) [-2156.760] (-2159.731) -- 0:02:48 Average standard deviation of split frequencies: 0.002898 365500 -- [-2160.405] (-2156.244) (-2157.202) (-2163.097) * [-2153.434] (-2170.788) (-2156.239) (-2160.453) -- 0:02:50 366000 -- (-2162.674) [-2161.027] (-2157.828) (-2158.276) * (-2149.168) (-2165.098) [-2155.400] (-2153.790) -- 0:02:49 366500 -- (-2158.411) [-2155.600] (-2157.876) (-2159.163) * [-2151.819] (-2161.359) (-2160.893) (-2158.706) -- 0:02:49 367000 -- (-2153.956) (-2161.127) [-2152.998] (-2168.354) * [-2154.494] (-2158.868) (-2156.475) (-2159.969) -- 0:02:49 367500 -- [-2155.044] (-2154.726) (-2153.590) (-2159.072) * (-2157.118) (-2159.658) [-2156.356] (-2161.699) -- 0:02:48 368000 -- (-2160.532) [-2157.885] (-2153.873) (-2160.512) * (-2158.795) (-2156.870) [-2155.101] (-2160.523) -- 0:02:48 368500 -- (-2154.814) (-2158.580) (-2159.885) [-2158.444] * [-2154.504] (-2159.277) (-2162.037) (-2155.526) -- 0:02:47 369000 -- (-2156.520) (-2159.204) (-2157.784) [-2156.200] * (-2167.753) (-2155.312) (-2154.898) [-2159.434] -- 0:02:47 369500 -- (-2158.236) (-2166.443) [-2152.614] (-2172.558) * (-2154.536) (-2158.134) [-2159.338] (-2162.305) -- 0:02:48 370000 -- (-2158.912) (-2163.056) [-2155.641] (-2169.192) * (-2155.193) (-2153.695) [-2158.373] (-2161.932) -- 0:02:48 Average standard deviation of split frequencies: 0.002226 370500 -- [-2155.883] (-2160.509) (-2161.656) (-2159.324) * (-2154.861) [-2156.002] (-2160.017) (-2166.539) -- 0:02:48 371000 -- (-2168.425) (-2159.186) [-2151.114] (-2158.163) * (-2163.567) (-2155.296) (-2158.772) [-2166.353] -- 0:02:47 371500 -- (-2161.185) (-2160.983) (-2155.394) [-2163.825] * (-2166.082) [-2156.527] (-2160.256) (-2156.241) -- 0:02:47 372000 -- (-2154.249) (-2157.442) (-2157.323) [-2158.705] * (-2165.113) (-2161.733) (-2159.156) [-2161.828] -- 0:02:47 372500 -- (-2154.064) (-2165.539) [-2158.558] (-2156.898) * (-2165.442) [-2156.390] (-2158.239) (-2160.074) -- 0:02:46 373000 -- [-2159.416] (-2161.090) (-2154.573) (-2157.031) * [-2158.284] (-2163.148) (-2152.043) (-2163.442) -- 0:02:48 373500 -- (-2163.931) (-2156.709) [-2150.514] (-2160.987) * (-2155.970) (-2154.849) (-2153.024) [-2154.584] -- 0:02:47 374000 -- (-2162.920) (-2159.368) [-2151.801] (-2164.625) * (-2158.461) (-2156.668) [-2153.370] (-2155.075) -- 0:02:47 374500 -- (-2160.760) (-2162.299) (-2154.180) [-2149.839] * (-2158.971) (-2164.038) [-2154.034] (-2163.103) -- 0:02:47 375000 -- (-2160.830) (-2159.405) (-2154.614) [-2154.518] * (-2157.447) [-2163.072] (-2153.538) (-2164.198) -- 0:02:46 Average standard deviation of split frequencies: 0.003761 375500 -- (-2156.591) (-2162.236) [-2160.173] (-2156.184) * (-2156.820) (-2155.235) (-2155.419) [-2157.570] -- 0:02:46 376000 -- (-2155.551) [-2154.961] (-2159.089) (-2152.877) * (-2158.933) (-2162.776) [-2158.600] (-2166.170) -- 0:02:45 376500 -- (-2149.970) [-2154.150] (-2152.327) (-2155.565) * (-2153.793) (-2158.172) [-2157.573] (-2160.515) -- 0:02:45 377000 -- (-2157.324) [-2156.536] (-2160.876) (-2159.159) * (-2159.360) (-2154.449) (-2159.311) [-2158.025] -- 0:02:46 377500 -- (-2154.478) (-2156.504) (-2158.896) [-2159.013] * (-2155.139) (-2157.585) [-2154.950] (-2153.219) -- 0:02:46 378000 -- (-2152.240) (-2165.271) [-2157.450] (-2153.264) * (-2152.424) (-2169.655) (-2154.288) [-2158.833] -- 0:02:46 378500 -- [-2155.415] (-2156.968) (-2155.689) (-2154.547) * (-2160.819) (-2158.102) (-2157.900) [-2157.062] -- 0:02:45 379000 -- (-2155.166) (-2162.797) (-2158.726) [-2153.788] * [-2152.802] (-2157.957) (-2162.639) (-2162.246) -- 0:02:45 379500 -- (-2155.606) (-2157.369) (-2169.860) [-2162.337] * [-2157.179] (-2160.228) (-2165.267) (-2162.386) -- 0:02:45 380000 -- (-2160.378) (-2159.591) [-2154.628] (-2162.622) * [-2163.581] (-2152.715) (-2168.661) (-2155.911) -- 0:02:44 Average standard deviation of split frequencies: 0.004025 380500 -- [-2154.183] (-2157.037) (-2154.998) (-2158.470) * [-2153.282] (-2153.655) (-2160.144) (-2155.291) -- 0:02:46 381000 -- [-2155.564] (-2160.432) (-2153.047) (-2161.623) * [-2149.949] (-2155.119) (-2164.896) (-2151.421) -- 0:02:45 381500 -- (-2165.079) [-2167.716] (-2157.924) (-2163.842) * (-2153.207) [-2158.842] (-2169.464) (-2158.032) -- 0:02:45 382000 -- (-2161.618) (-2164.267) (-2160.862) [-2156.599] * (-2154.620) (-2157.721) [-2161.965] (-2160.990) -- 0:02:45 382500 -- (-2161.356) [-2160.860] (-2157.097) (-2166.377) * (-2158.941) (-2157.342) (-2159.514) [-2158.845] -- 0:02:44 383000 -- (-2159.981) (-2157.637) (-2156.525) [-2155.726] * (-2173.060) [-2155.327] (-2157.674) (-2161.140) -- 0:02:44 383500 -- (-2158.855) [-2156.112] (-2160.617) (-2161.744) * [-2159.681] (-2162.866) (-2151.467) (-2154.118) -- 0:02:43 384000 -- (-2155.141) (-2153.235) [-2153.013] (-2160.153) * (-2164.083) [-2157.581] (-2162.353) (-2163.952) -- 0:02:43 384500 -- (-2153.707) [-2158.916] (-2155.278) (-2160.838) * (-2158.700) (-2155.931) [-2151.530] (-2163.246) -- 0:02:44 385000 -- (-2155.313) [-2157.791] (-2154.832) (-2161.563) * (-2158.300) [-2151.767] (-2158.993) (-2159.600) -- 0:02:44 Average standard deviation of split frequencies: 0.002748 385500 -- (-2154.900) [-2160.067] (-2154.305) (-2152.210) * (-2154.016) [-2150.174] (-2160.907) (-2160.284) -- 0:02:44 386000 -- (-2155.611) (-2161.509) [-2150.726] (-2154.308) * (-2162.738) (-2152.774) (-2155.163) [-2157.194] -- 0:02:43 386500 -- (-2165.481) (-2152.574) [-2154.050] (-2157.734) * (-2164.225) [-2156.765] (-2154.603) (-2157.125) -- 0:02:43 387000 -- (-2155.638) (-2156.730) [-2158.475] (-2157.585) * (-2161.657) (-2160.505) [-2156.122] (-2156.755) -- 0:02:43 387500 -- [-2157.088] (-2155.868) (-2154.706) (-2157.715) * (-2154.206) [-2155.304] (-2158.595) (-2152.736) -- 0:02:42 388000 -- [-2160.923] (-2155.787) (-2156.023) (-2154.258) * [-2152.842] (-2157.751) (-2156.948) (-2159.002) -- 0:02:42 388500 -- (-2164.725) (-2158.066) (-2156.153) [-2152.958] * (-2154.963) (-2152.276) (-2157.765) [-2155.581] -- 0:02:43 389000 -- (-2155.545) [-2154.462] (-2159.386) (-2157.145) * (-2158.750) [-2153.346] (-2157.907) (-2163.205) -- 0:02:43 389500 -- (-2161.931) (-2156.463) [-2161.996] (-2156.398) * (-2162.306) [-2157.646] (-2165.211) (-2159.852) -- 0:02:43 390000 -- (-2158.156) (-2161.589) (-2154.244) [-2152.661] * [-2160.235] (-2151.328) (-2159.594) (-2160.964) -- 0:02:42 Average standard deviation of split frequencies: 0.003620 390500 -- (-2160.960) (-2155.978) [-2151.450] (-2153.129) * (-2160.143) (-2161.072) (-2158.803) [-2157.172] -- 0:02:42 391000 -- [-2156.029] (-2161.105) (-2153.145) (-2160.662) * (-2157.476) (-2161.814) (-2158.805) [-2151.613] -- 0:02:41 391500 -- (-2165.029) [-2157.025] (-2160.523) (-2159.938) * (-2161.151) (-2158.269) [-2152.005] (-2150.446) -- 0:02:41 392000 -- (-2157.596) (-2155.923) (-2156.152) [-2151.385] * (-2167.550) (-2161.212) (-2156.430) [-2155.350] -- 0:02:42 392500 -- (-2156.837) (-2158.038) (-2153.667) [-2154.657] * (-2148.960) (-2163.660) (-2157.290) [-2152.456] -- 0:02:42 393000 -- (-2154.525) [-2158.823] (-2152.993) (-2152.681) * (-2158.363) (-2161.269) (-2164.490) [-2151.220] -- 0:02:42 393500 -- (-2162.271) (-2155.329) [-2160.967] (-2167.478) * (-2157.187) [-2160.070] (-2164.711) (-2157.906) -- 0:02:41 394000 -- [-2158.030] (-2153.823) (-2164.083) (-2160.693) * [-2152.747] (-2160.950) (-2152.814) (-2159.773) -- 0:02:41 394500 -- (-2161.385) [-2151.941] (-2162.094) (-2159.316) * (-2162.286) [-2157.208] (-2160.309) (-2161.417) -- 0:02:41 395000 -- (-2155.369) (-2152.742) (-2156.450) [-2154.979] * (-2157.869) [-2159.064] (-2157.483) (-2156.959) -- 0:02:40 Average standard deviation of split frequencies: 0.002083 395500 -- [-2156.906] (-2152.772) (-2157.042) (-2154.473) * [-2155.492] (-2158.232) (-2166.689) (-2159.198) -- 0:02:42 396000 -- [-2156.196] (-2156.605) (-2165.966) (-2156.051) * (-2154.484) (-2159.910) (-2162.214) [-2154.979] -- 0:02:41 396500 -- [-2152.284] (-2162.491) (-2165.762) (-2151.134) * (-2156.770) [-2155.559] (-2165.959) (-2163.403) -- 0:02:41 397000 -- [-2152.877] (-2157.770) (-2159.516) (-2159.690) * (-2161.856) [-2157.511] (-2156.487) (-2153.384) -- 0:02:41 397500 -- (-2158.720) (-2156.162) [-2156.895] (-2158.791) * (-2156.121) (-2156.008) [-2155.992] (-2154.435) -- 0:02:40 398000 -- (-2158.986) (-2156.856) [-2162.070] (-2162.218) * (-2162.700) [-2155.651] (-2159.425) (-2159.088) -- 0:02:40 398500 -- [-2155.423] (-2156.885) (-2164.315) (-2157.854) * (-2156.315) [-2158.341] (-2153.038) (-2155.857) -- 0:02:39 399000 -- (-2164.319) [-2158.747] (-2161.293) (-2157.185) * (-2160.528) (-2156.867) (-2156.056) [-2157.044] -- 0:02:39 399500 -- (-2154.355) (-2153.648) [-2156.439] (-2156.822) * (-2166.207) (-2158.154) [-2155.200] (-2157.647) -- 0:02:40 400000 -- (-2157.880) (-2153.060) [-2154.372] (-2164.309) * (-2155.660) (-2156.452) [-2154.749] (-2161.398) -- 0:02:40 Average standard deviation of split frequencies: 0.002059 400500 -- (-2159.396) (-2162.600) (-2155.177) [-2156.269] * (-2160.496) (-2151.993) (-2156.029) [-2154.528] -- 0:02:40 401000 -- (-2160.836) (-2159.973) [-2154.987] (-2154.086) * (-2157.314) (-2161.261) [-2155.051] (-2155.052) -- 0:02:39 401500 -- [-2158.122] (-2157.651) (-2163.785) (-2155.037) * (-2159.592) (-2160.825) [-2155.313] (-2153.679) -- 0:02:39 402000 -- (-2154.475) (-2158.141) (-2160.457) [-2156.212] * (-2154.141) (-2158.099) [-2159.297] (-2154.597) -- 0:02:39 402500 -- [-2155.972] (-2158.027) (-2156.548) (-2154.538) * [-2150.836] (-2153.518) (-2153.568) (-2160.318) -- 0:02:38 403000 -- (-2155.255) [-2157.422] (-2159.883) (-2155.611) * (-2160.182) (-2159.833) [-2153.781] (-2157.097) -- 0:02:39 403500 -- (-2160.995) [-2157.384] (-2160.932) (-2156.819) * (-2158.202) (-2155.661) (-2165.180) [-2151.526] -- 0:02:39 404000 -- [-2150.195] (-2156.276) (-2161.862) (-2160.659) * (-2161.582) (-2163.890) [-2155.448] (-2154.156) -- 0:02:39 404500 -- [-2156.656] (-2159.930) (-2158.475) (-2160.325) * [-2157.944] (-2161.233) (-2153.805) (-2156.686) -- 0:02:38 405000 -- (-2157.526) (-2159.569) [-2161.847] (-2156.031) * (-2156.004) [-2163.550] (-2161.771) (-2157.486) -- 0:02:38 Average standard deviation of split frequencies: 0.002032 405500 -- [-2155.372] (-2154.255) (-2157.482) (-2152.762) * (-2151.107) [-2155.237] (-2165.681) (-2170.546) -- 0:02:38 406000 -- (-2160.563) [-2158.763] (-2156.197) (-2154.754) * [-2159.778] (-2156.294) (-2156.546) (-2163.071) -- 0:02:38 406500 -- (-2159.213) (-2159.666) [-2153.526] (-2153.559) * [-2155.296] (-2153.906) (-2161.400) (-2184.067) -- 0:02:37 407000 -- (-2171.292) [-2163.929] (-2155.829) (-2162.970) * (-2156.665) (-2155.680) (-2154.366) [-2155.846] -- 0:02:38 407500 -- (-2158.368) (-2158.394) [-2157.432] (-2156.158) * [-2155.001] (-2165.472) (-2155.855) (-2154.847) -- 0:02:38 408000 -- (-2160.759) [-2158.173] (-2159.271) (-2155.535) * (-2160.929) (-2159.343) (-2154.574) [-2157.221] -- 0:02:38 408500 -- (-2157.564) (-2150.465) [-2152.145] (-2156.282) * (-2153.930) (-2164.659) [-2154.893] (-2154.680) -- 0:02:37 409000 -- (-2156.439) (-2156.227) [-2153.265] (-2165.605) * (-2155.620) [-2167.377] (-2159.249) (-2155.277) -- 0:02:37 409500 -- (-2161.726) (-2154.777) [-2156.121] (-2159.870) * (-2160.268) (-2158.082) (-2151.884) [-2154.473] -- 0:02:37 410000 -- [-2151.509] (-2160.030) (-2158.108) (-2158.637) * (-2157.287) [-2156.638] (-2156.657) (-2155.672) -- 0:02:36 Average standard deviation of split frequencies: 0.002009 410500 -- (-2156.691) [-2156.048] (-2154.894) (-2159.955) * (-2160.188) [-2155.909] (-2158.177) (-2152.999) -- 0:02:37 411000 -- (-2157.481) (-2161.024) (-2155.474) [-2152.187] * [-2158.367] (-2157.479) (-2157.126) (-2156.354) -- 0:02:37 411500 -- (-2163.427) (-2155.290) [-2160.444] (-2156.354) * [-2152.959] (-2153.628) (-2158.141) (-2165.729) -- 0:02:37 412000 -- (-2159.464) [-2157.623] (-2156.359) (-2154.202) * [-2154.670] (-2162.417) (-2160.060) (-2164.824) -- 0:02:36 412500 -- (-2152.779) (-2163.346) [-2156.216] (-2158.702) * [-2155.178] (-2158.518) (-2164.447) (-2159.838) -- 0:02:36 413000 -- (-2159.908) (-2155.492) (-2153.735) [-2157.930] * (-2156.065) [-2152.647] (-2162.227) (-2153.605) -- 0:02:36 413500 -- (-2151.869) (-2157.150) [-2155.302] (-2157.672) * (-2158.601) (-2161.504) [-2161.320] (-2156.307) -- 0:02:36 414000 -- [-2156.637] (-2161.831) (-2158.211) (-2158.479) * (-2155.170) [-2158.982] (-2167.011) (-2161.184) -- 0:02:37 414500 -- [-2156.403] (-2157.221) (-2155.366) (-2155.713) * [-2154.885] (-2155.118) (-2158.113) (-2159.178) -- 0:02:36 415000 -- (-2159.316) (-2165.010) [-2154.957] (-2164.195) * [-2152.576] (-2155.654) (-2157.938) (-2158.940) -- 0:02:36 Average standard deviation of split frequencies: 0.001983 415500 -- (-2156.643) (-2159.120) [-2152.862] (-2162.358) * (-2155.213) [-2154.700] (-2150.705) (-2159.771) -- 0:02:36 416000 -- [-2153.326] (-2155.647) (-2152.629) (-2162.323) * (-2153.543) (-2162.929) [-2149.757] (-2161.315) -- 0:02:35 416500 -- (-2152.731) (-2165.230) (-2156.146) [-2161.133] * (-2159.051) (-2154.391) [-2152.598] (-2160.727) -- 0:02:35 417000 -- [-2154.142] (-2161.958) (-2157.240) (-2163.777) * (-2160.885) (-2153.997) [-2159.371] (-2156.689) -- 0:02:35 417500 -- (-2161.895) (-2151.725) [-2158.057] (-2162.229) * (-2154.188) (-2158.613) (-2160.626) [-2159.013] -- 0:02:34 418000 -- (-2154.223) [-2156.419] (-2154.736) (-2161.607) * (-2159.397) (-2156.529) [-2157.007] (-2154.385) -- 0:02:35 418500 -- (-2161.635) (-2155.114) (-2156.555) [-2158.585] * (-2160.619) [-2156.432] (-2156.987) (-2155.620) -- 0:02:35 419000 -- (-2159.238) [-2153.880] (-2156.978) (-2162.201) * (-2165.882) (-2157.216) [-2156.986] (-2153.305) -- 0:02:35 419500 -- (-2155.420) [-2157.834] (-2152.955) (-2156.858) * (-2153.587) (-2154.096) (-2159.265) [-2161.786] -- 0:02:34 420000 -- (-2155.077) (-2172.703) (-2155.973) [-2155.684] * (-2159.106) [-2151.629] (-2155.643) (-2151.682) -- 0:02:34 Average standard deviation of split frequencies: 0.003082 420500 -- (-2155.628) (-2163.423) (-2154.372) [-2155.218] * [-2158.816] (-2156.681) (-2159.658) (-2154.497) -- 0:02:34 421000 -- [-2154.557] (-2158.611) (-2149.448) (-2155.968) * [-2155.423] (-2156.838) (-2160.118) (-2157.094) -- 0:02:34 421500 -- [-2156.946] (-2160.061) (-2157.483) (-2156.999) * [-2150.849] (-2154.527) (-2152.773) (-2154.302) -- 0:02:33 422000 -- [-2152.874] (-2155.455) (-2155.942) (-2157.316) * [-2150.508] (-2154.348) (-2155.324) (-2164.008) -- 0:02:34 422500 -- (-2154.865) (-2160.639) (-2159.996) [-2155.199] * (-2157.862) (-2160.593) (-2163.878) [-2152.634] -- 0:02:34 423000 -- [-2160.085] (-2161.740) (-2156.833) (-2159.636) * [-2158.119] (-2161.494) (-2153.220) (-2153.902) -- 0:02:34 423500 -- [-2149.807] (-2157.072) (-2162.829) (-2155.635) * (-2154.048) (-2159.428) (-2162.240) [-2159.563] -- 0:02:33 424000 -- (-2153.035) (-2162.420) [-2160.690] (-2156.076) * (-2159.881) [-2154.586] (-2156.792) (-2153.953) -- 0:02:33 424500 -- (-2163.691) (-2152.592) [-2160.231] (-2157.585) * (-2161.422) [-2157.156] (-2152.978) (-2163.222) -- 0:02:33 425000 -- (-2165.568) [-2151.768] (-2156.533) (-2156.292) * (-2153.978) (-2160.915) [-2157.911] (-2153.741) -- 0:02:32 Average standard deviation of split frequencies: 0.003873 425500 -- (-2163.412) (-2151.388) (-2157.274) [-2151.440] * (-2154.663) (-2156.537) (-2160.296) [-2156.402] -- 0:02:33 426000 -- (-2160.214) [-2157.193] (-2158.288) (-2155.286) * (-2156.717) (-2163.027) [-2156.768] (-2157.085) -- 0:02:33 426500 -- (-2159.189) [-2159.497] (-2156.053) (-2153.284) * (-2153.941) (-2158.337) (-2167.015) [-2152.706] -- 0:02:33 427000 -- (-2160.960) [-2153.879] (-2157.694) (-2154.388) * (-2161.873) (-2155.727) (-2162.728) [-2154.997] -- 0:02:32 427500 -- (-2158.636) [-2157.581] (-2155.554) (-2157.654) * (-2157.021) (-2165.498) (-2159.935) [-2151.927] -- 0:02:32 428000 -- (-2155.861) (-2170.026) (-2157.087) [-2156.519] * (-2155.215) (-2159.845) (-2153.481) [-2155.136] -- 0:02:32 428500 -- (-2167.543) (-2161.782) (-2157.569) [-2156.774] * [-2155.838] (-2161.054) (-2156.866) (-2157.561) -- 0:02:32 429000 -- [-2158.971] (-2164.571) (-2158.312) (-2157.465) * (-2156.737) [-2163.202] (-2155.525) (-2155.399) -- 0:02:31 429500 -- (-2158.268) [-2161.511] (-2155.601) (-2155.569) * (-2157.358) [-2154.351] (-2161.107) (-2156.405) -- 0:02:32 430000 -- (-2155.302) [-2156.943] (-2157.653) (-2164.058) * (-2158.680) (-2165.965) (-2155.873) [-2156.762] -- 0:02:32 Average standard deviation of split frequencies: 0.004926 430500 -- [-2155.799] (-2161.432) (-2164.984) (-2158.792) * (-2159.115) [-2157.975] (-2160.197) (-2155.842) -- 0:02:32 431000 -- [-2155.554] (-2158.216) (-2160.375) (-2161.918) * (-2160.376) (-2155.056) (-2152.653) [-2156.553] -- 0:02:31 431500 -- (-2153.924) [-2156.119] (-2154.741) (-2154.303) * (-2160.341) [-2154.322] (-2162.595) (-2159.759) -- 0:02:31 432000 -- (-2156.788) (-2157.373) [-2159.507] (-2151.926) * (-2153.198) [-2152.911] (-2154.876) (-2166.896) -- 0:02:31 432500 -- (-2164.309) (-2155.475) [-2154.945] (-2156.266) * [-2155.648] (-2155.372) (-2162.489) (-2167.862) -- 0:02:30 433000 -- (-2163.549) [-2157.200] (-2156.473) (-2163.378) * (-2157.816) (-2161.228) [-2156.196] (-2164.644) -- 0:02:31 433500 -- (-2156.233) [-2153.820] (-2162.848) (-2179.628) * (-2154.960) (-2155.432) [-2156.493] (-2161.237) -- 0:02:31 434000 -- [-2155.802] (-2155.390) (-2154.852) (-2162.803) * (-2154.374) (-2154.552) (-2159.244) [-2161.772] -- 0:02:31 434500 -- (-2152.978) [-2152.967] (-2160.512) (-2161.829) * (-2154.123) (-2158.553) [-2152.808] (-2163.577) -- 0:02:30 435000 -- (-2152.845) [-2156.024] (-2159.929) (-2160.167) * [-2153.138] (-2152.564) (-2156.673) (-2155.238) -- 0:02:30 Average standard deviation of split frequencies: 0.004595 435500 -- (-2156.164) (-2157.462) [-2158.978] (-2167.762) * [-2154.118] (-2153.452) (-2161.014) (-2158.811) -- 0:02:30 436000 -- [-2154.063] (-2156.508) (-2152.973) (-2157.055) * [-2156.112] (-2156.471) (-2153.929) (-2163.593) -- 0:02:30 436500 -- (-2160.904) (-2158.254) (-2156.548) [-2155.528] * (-2156.428) (-2162.839) [-2155.389] (-2151.945) -- 0:02:29 437000 -- (-2157.456) (-2156.835) [-2155.422] (-2156.985) * (-2161.903) [-2152.130] (-2155.465) (-2158.939) -- 0:02:30 437500 -- [-2152.753] (-2157.464) (-2156.241) (-2150.849) * [-2156.069] (-2158.917) (-2152.565) (-2170.418) -- 0:02:30 438000 -- (-2160.322) (-2156.264) (-2163.363) [-2152.327] * [-2153.434] (-2157.355) (-2164.497) (-2161.288) -- 0:02:30 438500 -- [-2162.851] (-2154.928) (-2169.301) (-2153.174) * [-2155.260] (-2156.022) (-2161.918) (-2162.613) -- 0:02:29 439000 -- (-2158.840) (-2157.247) [-2157.666] (-2155.221) * (-2160.843) (-2158.618) [-2157.921] (-2161.838) -- 0:02:29 439500 -- (-2157.265) [-2154.814] (-2157.684) (-2151.993) * [-2155.687] (-2163.664) (-2162.103) (-2158.144) -- 0:02:29 440000 -- (-2159.511) (-2163.194) [-2152.759] (-2154.189) * (-2154.990) (-2156.536) [-2160.533] (-2166.407) -- 0:02:28 Average standard deviation of split frequencies: 0.006151 440500 -- (-2158.543) (-2165.330) (-2157.624) [-2154.878] * [-2153.785] (-2154.486) (-2163.014) (-2163.704) -- 0:02:29 441000 -- (-2160.147) [-2163.203] (-2157.893) (-2158.754) * [-2154.263] (-2156.547) (-2157.496) (-2160.706) -- 0:02:29 441500 -- [-2160.216] (-2164.927) (-2160.217) (-2159.570) * (-2152.942) (-2161.084) (-2157.100) [-2150.800] -- 0:02:29 442000 -- (-2159.584) [-2155.759] (-2159.361) (-2156.202) * (-2150.649) [-2156.606] (-2161.461) (-2151.868) -- 0:02:28 442500 -- (-2168.256) (-2156.939) (-2162.486) [-2162.157] * (-2157.292) (-2158.196) (-2167.710) [-2153.684] -- 0:02:28 443000 -- [-2157.186] (-2156.212) (-2164.279) (-2158.257) * (-2156.869) (-2155.051) (-2166.157) [-2151.893] -- 0:02:28 443500 -- (-2156.753) (-2159.819) (-2158.824) [-2155.650] * [-2158.152] (-2157.888) (-2160.230) (-2161.638) -- 0:02:28 444000 -- [-2154.049] (-2151.675) (-2159.637) (-2151.320) * (-2160.217) (-2155.759) [-2160.140] (-2155.090) -- 0:02:27 444500 -- (-2160.852) (-2152.532) [-2161.980] (-2155.628) * (-2166.231) [-2157.814] (-2155.777) (-2154.764) -- 0:02:28 445000 -- [-2162.246] (-2154.985) (-2162.810) (-2162.702) * (-2156.182) [-2154.749] (-2155.827) (-2153.606) -- 0:02:28 Average standard deviation of split frequencies: 0.005549 445500 -- (-2168.772) (-2157.156) (-2161.080) [-2154.964] * (-2157.660) (-2158.783) [-2153.481] (-2156.017) -- 0:02:28 446000 -- (-2166.994) (-2156.407) (-2156.698) [-2156.393] * (-2156.240) [-2158.322] (-2163.696) (-2158.879) -- 0:02:27 446500 -- (-2162.838) (-2150.290) [-2158.380] (-2154.311) * (-2159.863) (-2156.100) [-2162.052] (-2161.849) -- 0:02:27 447000 -- (-2158.812) (-2161.582) (-2158.007) [-2152.382] * (-2160.772) (-2156.491) (-2159.390) [-2157.537] -- 0:02:27 447500 -- (-2163.529) (-2156.864) (-2159.799) [-2153.914] * (-2154.490) (-2157.193) (-2155.885) [-2155.007] -- 0:02:26 448000 -- (-2154.611) (-2159.411) [-2158.213] (-2152.968) * [-2158.163] (-2166.167) (-2158.905) (-2159.761) -- 0:02:27 448500 -- (-2156.722) (-2161.615) (-2161.779) [-2156.661] * (-2157.583) (-2154.082) (-2160.168) [-2155.215] -- 0:02:27 449000 -- (-2166.371) [-2157.915] (-2158.846) (-2152.130) * [-2154.607] (-2158.805) (-2175.599) (-2158.966) -- 0:02:27 449500 -- (-2160.298) (-2164.734) (-2160.254) [-2152.859] * [-2158.437] (-2160.058) (-2161.885) (-2152.871) -- 0:02:26 450000 -- (-2156.444) (-2163.262) (-2159.261) [-2156.234] * (-2154.887) (-2157.529) [-2156.642] (-2159.383) -- 0:02:26 Average standard deviation of split frequencies: 0.006015 450500 -- (-2159.488) (-2155.324) (-2160.291) [-2155.690] * [-2159.406] (-2152.473) (-2154.875) (-2158.450) -- 0:02:26 451000 -- (-2154.968) (-2162.327) (-2161.702) [-2161.708] * (-2155.058) (-2160.096) [-2157.332] (-2155.532) -- 0:02:26 451500 -- (-2163.310) (-2158.454) (-2159.302) [-2153.153] * [-2156.006] (-2170.135) (-2165.306) (-2155.320) -- 0:02:25 452000 -- (-2158.247) [-2154.454] (-2158.647) (-2152.213) * [-2154.024] (-2158.519) (-2156.370) (-2160.940) -- 0:02:26 452500 -- (-2159.975) (-2152.637) (-2158.518) [-2159.233] * (-2157.635) (-2164.697) [-2158.276] (-2160.698) -- 0:02:26 453000 -- (-2163.090) [-2160.390] (-2165.237) (-2160.217) * [-2157.147] (-2163.838) (-2156.534) (-2161.774) -- 0:02:26 453500 -- (-2155.150) (-2165.863) (-2165.660) [-2156.415] * (-2158.787) (-2160.427) [-2154.608] (-2171.464) -- 0:02:25 454000 -- (-2157.519) (-2168.977) [-2154.217] (-2154.170) * (-2160.970) [-2155.322] (-2152.528) (-2161.773) -- 0:02:25 454500 -- (-2168.972) [-2152.212] (-2159.646) (-2155.774) * (-2155.525) (-2154.384) (-2159.469) [-2157.704] -- 0:02:25 455000 -- (-2156.886) (-2159.049) [-2156.708] (-2151.682) * [-2156.011] (-2164.777) (-2157.930) (-2158.716) -- 0:02:24 Average standard deviation of split frequencies: 0.006203 455500 -- [-2156.624] (-2160.054) (-2159.047) (-2152.387) * [-2155.515] (-2156.466) (-2157.472) (-2154.002) -- 0:02:25 456000 -- (-2162.876) (-2158.647) [-2157.924] (-2155.131) * (-2155.827) [-2154.811] (-2165.695) (-2156.123) -- 0:02:25 456500 -- (-2163.790) (-2160.577) [-2151.143] (-2154.723) * (-2158.064) (-2151.665) (-2161.497) [-2154.685] -- 0:02:25 457000 -- (-2163.010) [-2152.367] (-2154.499) (-2157.049) * (-2159.350) (-2155.830) (-2158.685) [-2152.924] -- 0:02:24 457500 -- (-2158.354) (-2162.474) [-2154.432] (-2159.333) * (-2157.263) (-2153.649) (-2172.618) [-2153.449] -- 0:02:24 458000 -- [-2155.883] (-2150.827) (-2156.856) (-2154.056) * [-2162.514] (-2155.171) (-2161.143) (-2154.487) -- 0:02:24 458500 -- (-2162.141) (-2156.681) [-2160.418] (-2154.250) * [-2157.838] (-2157.343) (-2161.934) (-2154.119) -- 0:02:24 459000 -- (-2158.770) [-2157.218] (-2155.786) (-2159.565) * [-2154.118] (-2157.550) (-2155.135) (-2154.976) -- 0:02:23 459500 -- (-2154.527) (-2163.034) (-2160.871) [-2158.071] * (-2160.684) [-2154.066] (-2162.335) (-2152.763) -- 0:02:24 460000 -- (-2161.221) (-2162.695) [-2153.866] (-2163.203) * (-2159.124) [-2157.981] (-2156.905) (-2157.473) -- 0:02:24 Average standard deviation of split frequencies: 0.005372 460500 -- (-2153.393) [-2152.322] (-2156.919) (-2158.914) * (-2157.396) [-2155.103] (-2168.349) (-2157.787) -- 0:02:24 461000 -- (-2152.043) (-2158.251) (-2169.028) [-2156.540] * (-2160.577) [-2157.703] (-2157.868) (-2161.958) -- 0:02:23 461500 -- (-2156.919) [-2160.938] (-2162.381) (-2159.298) * (-2158.365) (-2158.350) (-2154.945) [-2158.849] -- 0:02:23 462000 -- (-2151.490) (-2162.551) [-2158.448] (-2157.154) * [-2151.185] (-2158.818) (-2155.179) (-2155.783) -- 0:02:23 462500 -- (-2157.237) (-2161.540) (-2157.202) [-2154.589] * (-2158.612) (-2167.896) (-2155.794) [-2157.171] -- 0:02:22 463000 -- (-2155.893) (-2159.879) (-2159.093) [-2158.172] * (-2154.856) (-2167.079) [-2160.925] (-2161.829) -- 0:02:23 463500 -- (-2157.356) [-2157.805] (-2154.151) (-2163.665) * (-2154.523) (-2154.587) [-2156.112] (-2160.949) -- 0:02:23 464000 -- (-2158.803) (-2158.821) [-2158.758] (-2161.453) * (-2157.028) (-2159.086) (-2167.774) [-2167.628] -- 0:02:23 464500 -- (-2157.141) (-2157.250) [-2158.577] (-2159.601) * (-2156.582) [-2155.512] (-2163.676) (-2158.185) -- 0:02:22 465000 -- (-2157.194) (-2158.918) [-2156.654] (-2152.008) * (-2154.595) (-2154.864) (-2159.520) [-2161.316] -- 0:02:22 Average standard deviation of split frequencies: 0.004552 465500 -- (-2163.518) (-2154.799) (-2156.665) [-2157.603] * (-2155.997) (-2158.366) [-2158.926] (-2156.348) -- 0:02:22 466000 -- (-2161.604) [-2154.743] (-2159.080) (-2161.506) * (-2153.660) [-2155.841] (-2159.304) (-2158.959) -- 0:02:22 466500 -- (-2158.482) (-2157.312) [-2154.406] (-2159.440) * (-2155.422) (-2159.906) (-2160.118) [-2156.584] -- 0:02:21 467000 -- (-2157.790) (-2158.613) [-2155.891] (-2157.833) * (-2153.704) (-2159.748) (-2162.785) [-2154.324] -- 0:02:22 467500 -- (-2156.964) (-2152.484) [-2165.934] (-2157.789) * (-2151.199) (-2159.335) (-2160.157) [-2157.345] -- 0:02:22 468000 -- (-2163.657) (-2154.818) (-2155.132) [-2153.218] * (-2160.648) (-2160.460) (-2154.527) [-2157.318] -- 0:02:22 468500 -- (-2160.371) (-2156.868) [-2155.650] (-2161.802) * [-2150.910] (-2160.448) (-2159.779) (-2164.088) -- 0:02:21 469000 -- (-2157.668) (-2157.073) (-2160.604) [-2162.472] * [-2154.366] (-2156.464) (-2159.372) (-2156.587) -- 0:02:21 469500 -- [-2152.202] (-2160.040) (-2154.578) (-2159.919) * [-2157.069] (-2167.423) (-2156.322) (-2160.208) -- 0:02:21 470000 -- [-2157.741] (-2162.890) (-2155.144) (-2152.513) * (-2158.449) [-2156.657] (-2161.180) (-2160.512) -- 0:02:20 Average standard deviation of split frequencies: 0.004257 470500 -- (-2162.062) (-2158.577) [-2157.251] (-2154.317) * (-2155.673) [-2160.168] (-2155.943) (-2156.488) -- 0:02:21 471000 -- (-2155.888) (-2161.188) (-2162.999) [-2162.058] * (-2162.324) (-2153.739) (-2157.964) [-2157.358] -- 0:02:21 471500 -- (-2152.234) [-2158.228] (-2162.503) (-2159.725) * (-2160.131) (-2159.561) (-2153.148) [-2159.917] -- 0:02:21 472000 -- (-2157.501) [-2154.323] (-2160.772) (-2162.334) * (-2157.895) (-2154.527) [-2152.764] (-2158.863) -- 0:02:20 472500 -- [-2156.969] (-2156.389) (-2154.358) (-2163.118) * (-2162.585) (-2155.106) (-2156.669) [-2154.869] -- 0:02:20 473000 -- (-2157.899) (-2159.814) (-2151.976) [-2157.000] * (-2159.302) [-2156.676] (-2162.008) (-2154.083) -- 0:02:20 473500 -- (-2163.637) (-2167.971) (-2156.680) [-2154.885] * (-2164.174) [-2152.736] (-2162.763) (-2160.031) -- 0:02:20 474000 -- [-2163.773] (-2155.461) (-2155.644) (-2159.741) * [-2157.233] (-2159.277) (-2160.393) (-2158.719) -- 0:02:19 474500 -- (-2158.622) (-2160.749) [-2158.805] (-2161.432) * (-2151.782) (-2166.376) [-2156.611] (-2162.822) -- 0:02:20 475000 -- (-2154.147) (-2153.777) (-2155.581) [-2156.741] * (-2156.731) [-2161.231] (-2163.233) (-2152.911) -- 0:02:20 Average standard deviation of split frequencies: 0.004704 475500 -- (-2152.530) [-2155.275] (-2161.616) (-2158.887) * (-2156.559) [-2154.934] (-2154.723) (-2157.732) -- 0:02:20 476000 -- (-2159.577) [-2153.133] (-2157.420) (-2160.447) * [-2154.239] (-2153.000) (-2157.590) (-2154.703) -- 0:02:19 476500 -- (-2160.441) (-2160.791) (-2155.597) [-2157.079] * (-2159.045) (-2155.936) (-2163.229) [-2158.640] -- 0:02:19 477000 -- (-2163.425) [-2156.336] (-2161.364) (-2155.468) * (-2154.655) [-2156.400] (-2158.380) (-2157.289) -- 0:02:19 477500 -- (-2164.564) (-2160.019) [-2154.528] (-2152.127) * (-2153.615) [-2157.495] (-2152.579) (-2153.545) -- 0:02:18 478000 -- (-2173.809) [-2158.994] (-2155.933) (-2158.265) * (-2153.480) (-2158.419) (-2159.255) [-2156.919] -- 0:02:19 478500 -- (-2161.691) (-2156.189) [-2151.570] (-2163.040) * (-2156.852) [-2158.334] (-2161.987) (-2163.247) -- 0:02:19 479000 -- (-2159.103) [-2165.446] (-2159.890) (-2155.276) * (-2164.729) [-2157.739] (-2164.584) (-2157.325) -- 0:02:19 479500 -- (-2159.341) [-2160.702] (-2156.078) (-2162.319) * (-2162.689) [-2155.407] (-2161.027) (-2157.872) -- 0:02:18 480000 -- [-2159.164] (-2156.673) (-2159.366) (-2161.856) * (-2154.070) (-2153.227) (-2160.280) [-2157.660] -- 0:02:18 Average standard deviation of split frequencies: 0.005639 480500 -- [-2159.301] (-2158.178) (-2162.836) (-2163.533) * [-2155.438] (-2160.160) (-2161.328) (-2157.133) -- 0:02:18 481000 -- (-2156.065) (-2157.704) (-2156.410) [-2158.071] * [-2157.062] (-2158.515) (-2158.561) (-2164.980) -- 0:02:18 481500 -- (-2161.134) [-2154.560] (-2152.991) (-2155.788) * [-2158.372] (-2156.656) (-2154.859) (-2156.738) -- 0:02:17 482000 -- (-2157.854) (-2153.493) [-2153.380] (-2160.347) * [-2157.650] (-2154.791) (-2158.143) (-2153.311) -- 0:02:18 482500 -- (-2154.699) (-2154.337) [-2153.665] (-2169.403) * (-2154.358) [-2160.402] (-2153.140) (-2156.589) -- 0:02:18 483000 -- (-2153.385) (-2162.164) [-2162.322] (-2157.193) * [-2156.338] (-2159.641) (-2162.903) (-2153.922) -- 0:02:18 483500 -- (-2155.398) [-2152.743] (-2159.247) (-2157.836) * (-2160.882) (-2159.844) (-2159.702) [-2152.515] -- 0:02:17 484000 -- (-2154.471) [-2162.084] (-2162.468) (-2160.293) * [-2161.503] (-2155.636) (-2156.635) (-2159.460) -- 0:02:17 484500 -- (-2162.317) (-2154.020) (-2161.630) [-2153.514] * (-2163.873) (-2160.189) [-2152.435] (-2159.034) -- 0:02:17 485000 -- (-2157.428) (-2163.502) (-2162.580) [-2156.707] * (-2164.039) (-2160.608) [-2156.263] (-2158.588) -- 0:02:16 Average standard deviation of split frequencies: 0.004850 485500 -- [-2156.571] (-2161.022) (-2159.049) (-2159.619) * [-2161.531] (-2158.125) (-2162.909) (-2152.985) -- 0:02:16 486000 -- (-2155.629) (-2158.896) [-2156.671] (-2153.042) * [-2160.451] (-2157.885) (-2157.715) (-2150.670) -- 0:02:17 486500 -- [-2156.905] (-2157.269) (-2155.695) (-2156.027) * (-2157.243) [-2151.547] (-2159.394) (-2151.792) -- 0:02:17 487000 -- (-2158.775) [-2151.786] (-2161.298) (-2160.569) * (-2156.070) [-2152.849] (-2157.061) (-2162.038) -- 0:02:16 487500 -- (-2154.760) [-2152.573] (-2156.626) (-2159.083) * (-2162.536) [-2153.938] (-2165.270) (-2164.668) -- 0:02:16 488000 -- (-2159.324) (-2155.411) (-2166.385) [-2159.526] * (-2157.931) [-2158.791] (-2164.854) (-2160.117) -- 0:02:16 488500 -- (-2161.716) (-2150.889) [-2153.452] (-2154.414) * [-2159.306] (-2150.908) (-2157.594) (-2154.890) -- 0:02:16 489000 -- (-2159.933) (-2156.684) [-2153.459] (-2157.528) * (-2155.514) [-2156.860] (-2156.346) (-2157.205) -- 0:02:15 489500 -- (-2159.978) (-2161.020) [-2150.888] (-2155.563) * (-2155.921) (-2164.617) (-2150.679) [-2154.481] -- 0:02:16 490000 -- (-2155.077) (-2154.813) (-2156.570) [-2154.828] * [-2158.911] (-2155.230) (-2163.170) (-2156.688) -- 0:02:16 Average standard deviation of split frequencies: 0.004564 490500 -- (-2161.476) [-2154.645] (-2157.082) (-2157.595) * [-2156.560] (-2154.819) (-2154.489) (-2155.620) -- 0:02:16 491000 -- (-2160.571) (-2157.975) [-2155.541] (-2154.503) * (-2156.659) (-2156.309) [-2153.025] (-2156.315) -- 0:02:15 491500 -- (-2159.583) [-2152.166] (-2156.480) (-2154.374) * (-2155.975) (-2152.895) (-2157.581) [-2153.048] -- 0:02:15 492000 -- (-2152.720) [-2156.863] (-2152.087) (-2158.898) * [-2163.781] (-2151.892) (-2154.198) (-2152.261) -- 0:02:15 492500 -- [-2151.542] (-2157.014) (-2154.119) (-2159.486) * (-2154.132) (-2163.007) (-2158.737) [-2154.323] -- 0:02:14 493000 -- [-2153.224] (-2158.432) (-2155.173) (-2155.195) * [-2154.206] (-2159.929) (-2156.858) (-2155.446) -- 0:02:15 493500 -- (-2153.898) (-2159.841) (-2152.754) [-2153.820] * (-2151.877) [-2154.794] (-2157.889) (-2158.476) -- 0:02:15 494000 -- (-2159.676) [-2154.734] (-2161.655) (-2157.053) * (-2169.094) (-2155.107) [-2160.951] (-2156.147) -- 0:02:15 494500 -- (-2155.711) (-2157.467) [-2155.083] (-2161.173) * (-2166.518) [-2153.607] (-2169.660) (-2158.916) -- 0:02:14 495000 -- (-2153.192) (-2153.423) [-2156.804] (-2155.784) * (-2167.135) (-2156.393) (-2160.283) [-2156.320] -- 0:02:14 Average standard deviation of split frequencies: 0.002851 495500 -- [-2155.672] (-2154.956) (-2157.038) (-2156.385) * (-2160.683) (-2159.392) [-2161.820] (-2158.287) -- 0:02:14 496000 -- (-2162.866) (-2155.416) [-2156.878] (-2155.021) * [-2157.986] (-2157.463) (-2158.504) (-2156.820) -- 0:02:14 496500 -- [-2151.508] (-2164.620) (-2160.671) (-2161.313) * (-2156.474) (-2166.191) [-2155.992] (-2158.939) -- 0:02:13 497000 -- (-2161.676) [-2156.504] (-2160.195) (-2165.646) * [-2156.370] (-2158.229) (-2155.783) (-2170.368) -- 0:02:14 497500 -- (-2165.886) [-2153.860] (-2162.522) (-2161.246) * (-2157.703) (-2154.736) [-2154.077] (-2157.258) -- 0:02:14 498000 -- (-2160.520) [-2156.555] (-2161.045) (-2162.157) * [-2155.133] (-2158.032) (-2149.094) (-2155.385) -- 0:02:14 498500 -- (-2157.649) (-2153.396) [-2153.133] (-2166.322) * (-2154.541) [-2154.833] (-2154.597) (-2157.176) -- 0:02:13 499000 -- (-2159.434) (-2151.887) [-2154.676] (-2157.485) * [-2151.580] (-2164.234) (-2157.721) (-2161.773) -- 0:02:13 499500 -- (-2156.982) (-2154.441) (-2166.512) [-2158.699] * (-2155.133) (-2156.222) [-2157.297] (-2155.986) -- 0:02:13 500000 -- (-2160.343) (-2151.125) (-2167.187) [-2157.276] * (-2150.726) (-2164.936) [-2158.497] (-2158.562) -- 0:02:13 Average standard deviation of split frequencies: 0.002118 500500 -- [-2153.789] (-2157.780) (-2160.130) (-2156.865) * (-2157.293) (-2161.610) (-2171.955) [-2152.939] -- 0:02:12 501000 -- (-2159.417) (-2154.647) [-2153.934] (-2159.325) * (-2157.793) (-2154.790) [-2152.010] (-2151.327) -- 0:02:13 501500 -- [-2157.459] (-2156.892) (-2157.715) (-2162.942) * (-2153.238) (-2156.394) (-2158.086) [-2153.330] -- 0:02:13 502000 -- [-2150.524] (-2161.631) (-2151.950) (-2157.827) * (-2157.921) [-2152.523] (-2152.419) (-2155.350) -- 0:02:12 502500 -- (-2151.970) (-2155.110) [-2158.916] (-2159.023) * (-2158.377) [-2151.763] (-2156.533) (-2158.616) -- 0:02:12 503000 -- (-2153.963) [-2159.205] (-2159.088) (-2155.942) * (-2154.440) (-2155.944) [-2159.716] (-2160.555) -- 0:02:12 503500 -- (-2156.367) (-2156.019) [-2156.406] (-2156.133) * (-2160.714) (-2154.509) [-2154.407] (-2162.429) -- 0:02:12 504000 -- (-2158.505) (-2156.645) [-2159.159] (-2158.691) * (-2160.681) [-2157.533] (-2159.095) (-2159.294) -- 0:02:11 504500 -- (-2162.196) (-2152.911) (-2158.677) [-2160.040] * [-2154.798] (-2157.267) (-2155.131) (-2161.459) -- 0:02:12 505000 -- [-2156.487] (-2161.237) (-2154.658) (-2159.860) * (-2158.158) [-2152.018] (-2156.146) (-2155.568) -- 0:02:12 Average standard deviation of split frequencies: 0.001863 505500 -- (-2157.343) (-2158.568) (-2152.752) [-2160.317] * (-2158.280) [-2155.539] (-2164.208) (-2152.405) -- 0:02:12 506000 -- (-2156.067) (-2162.162) (-2159.623) [-2156.878] * (-2161.143) (-2166.997) (-2160.466) [-2157.981] -- 0:02:11 506500 -- (-2158.487) (-2161.491) [-2151.024] (-2153.474) * [-2156.669] (-2161.806) (-2168.029) (-2154.489) -- 0:02:11 507000 -- [-2156.049] (-2156.031) (-2152.502) (-2154.596) * [-2153.832] (-2155.454) (-2160.343) (-2158.632) -- 0:02:11 507500 -- (-2152.520) (-2162.449) [-2158.513] (-2159.318) * (-2157.521) [-2155.807] (-2158.842) (-2162.764) -- 0:02:11 508000 -- (-2157.932) [-2159.366] (-2156.680) (-2154.128) * (-2157.496) (-2163.394) (-2157.905) [-2168.268] -- 0:02:10 508500 -- (-2153.174) (-2153.659) (-2153.819) [-2155.039] * (-2157.454) [-2158.676] (-2159.263) (-2159.298) -- 0:02:11 509000 -- [-2160.913] (-2166.763) (-2155.399) (-2157.816) * (-2156.054) (-2168.397) [-2153.157] (-2158.990) -- 0:02:11 509500 -- [-2157.505] (-2162.036) (-2160.710) (-2156.993) * [-2159.280] (-2164.719) (-2161.111) (-2158.423) -- 0:02:10 510000 -- (-2152.745) (-2158.641) [-2157.055] (-2156.412) * (-2155.775) (-2157.958) (-2161.265) [-2153.876] -- 0:02:10 Average standard deviation of split frequencies: 0.002769 510500 -- (-2156.119) (-2159.800) (-2159.408) [-2155.860] * [-2154.244] (-2157.114) (-2158.948) (-2154.251) -- 0:02:10 511000 -- (-2156.669) (-2157.943) [-2155.477] (-2155.063) * (-2156.108) (-2155.581) [-2154.821] (-2154.359) -- 0:02:10 511500 -- (-2155.604) (-2153.503) [-2156.202] (-2159.385) * (-2157.816) [-2150.993] (-2158.625) (-2158.481) -- 0:02:09 512000 -- (-2156.720) (-2155.243) (-2150.469) [-2162.218] * [-2153.345] (-2151.389) (-2159.657) (-2155.383) -- 0:02:10 512500 -- [-2154.012] (-2157.557) (-2154.462) (-2153.561) * [-2153.409] (-2160.861) (-2161.144) (-2160.358) -- 0:02:10 513000 -- (-2157.816) (-2156.775) (-2159.947) [-2154.129] * (-2157.998) (-2164.315) (-2161.437) [-2157.520] -- 0:02:10 513500 -- (-2157.577) (-2156.701) (-2155.838) [-2159.352] * (-2160.802) (-2156.242) [-2154.441] (-2153.194) -- 0:02:09 514000 -- (-2158.077) [-2157.539] (-2157.228) (-2151.810) * (-2157.098) (-2156.340) [-2153.133] (-2159.653) -- 0:02:09 514500 -- (-2160.644) (-2152.691) (-2159.191) [-2158.372] * (-2161.239) [-2158.243] (-2151.080) (-2159.171) -- 0:02:09 515000 -- (-2157.891) (-2158.194) (-2157.138) [-2158.621] * (-2165.929) (-2161.105) [-2150.779] (-2158.166) -- 0:02:09 Average standard deviation of split frequencies: 0.005025 515500 -- [-2162.488] (-2168.812) (-2154.386) (-2151.470) * (-2159.604) (-2158.063) [-2156.716] (-2153.617) -- 0:02:08 516000 -- (-2153.082) (-2155.799) [-2158.843] (-2159.011) * (-2155.829) [-2164.089] (-2157.599) (-2150.999) -- 0:02:09 516500 -- [-2153.721] (-2157.112) (-2154.691) (-2165.512) * (-2160.330) (-2163.609) [-2156.277] (-2153.247) -- 0:02:09 517000 -- [-2155.692] (-2160.082) (-2165.067) (-2163.019) * (-2163.273) (-2156.228) (-2153.119) [-2150.975] -- 0:02:08 517500 -- (-2153.719) (-2166.459) [-2151.250] (-2161.426) * (-2165.730) [-2167.156] (-2153.617) (-2161.624) -- 0:02:08 518000 -- (-2157.403) [-2158.155] (-2163.335) (-2165.881) * (-2160.752) (-2160.142) [-2155.022] (-2155.817) -- 0:02:08 518500 -- [-2156.043] (-2154.848) (-2152.434) (-2164.036) * (-2159.284) (-2156.960) (-2155.015) [-2154.705] -- 0:02:08 519000 -- [-2153.760] (-2151.997) (-2159.482) (-2167.845) * (-2171.523) (-2154.887) (-2156.400) [-2155.904] -- 0:02:07 519500 -- (-2156.733) (-2157.624) (-2158.022) [-2151.823] * (-2161.984) [-2156.981] (-2163.425) (-2153.678) -- 0:02:08 520000 -- (-2152.456) [-2153.243] (-2153.984) (-2154.027) * (-2160.392) (-2154.486) [-2154.621] (-2156.944) -- 0:02:08 Average standard deviation of split frequencies: 0.002716 520500 -- (-2153.928) [-2160.107] (-2171.142) (-2157.953) * (-2156.557) (-2152.631) [-2157.178] (-2154.007) -- 0:02:08 521000 -- (-2156.578) [-2153.907] (-2162.188) (-2157.066) * (-2163.468) (-2156.887) (-2161.023) [-2151.054] -- 0:02:07 521500 -- (-2151.050) (-2155.596) [-2154.029] (-2164.199) * (-2153.194) [-2152.924] (-2157.201) (-2157.549) -- 0:02:07 522000 -- (-2158.082) [-2155.588] (-2159.178) (-2159.736) * (-2156.702) (-2153.875) (-2156.958) [-2158.536] -- 0:02:07 522500 -- (-2157.401) (-2159.767) [-2156.926] (-2156.635) * [-2153.865] (-2161.268) (-2159.227) (-2163.804) -- 0:02:07 523000 -- (-2160.052) [-2156.686] (-2159.886) (-2162.892) * (-2158.875) [-2153.712] (-2156.694) (-2158.528) -- 0:02:06 523500 -- [-2153.549] (-2158.836) (-2161.164) (-2161.564) * (-2153.955) [-2152.306] (-2160.678) (-2157.755) -- 0:02:07 524000 -- (-2154.410) (-2157.674) (-2152.153) [-2158.412] * (-2155.261) (-2157.461) [-2153.518] (-2164.510) -- 0:02:07 524500 -- [-2155.065] (-2157.343) (-2158.113) (-2158.339) * (-2160.741) (-2157.903) [-2159.179] (-2154.704) -- 0:02:06 525000 -- [-2153.465] (-2157.198) (-2156.028) (-2154.135) * (-2154.522) (-2156.735) (-2155.336) [-2151.411] -- 0:02:06 Average standard deviation of split frequencies: 0.002689 525500 -- [-2157.812] (-2157.922) (-2160.576) (-2160.940) * [-2155.279] (-2156.291) (-2151.792) (-2158.488) -- 0:02:06 526000 -- [-2154.649] (-2153.972) (-2163.812) (-2154.964) * (-2155.856) (-2158.463) [-2151.516] (-2162.756) -- 0:02:06 526500 -- (-2158.033) (-2153.990) (-2157.932) [-2155.627] * (-2162.024) (-2158.622) [-2155.545] (-2159.401) -- 0:02:05 527000 -- [-2161.851] (-2162.582) (-2152.123) (-2155.414) * [-2153.370] (-2153.076) (-2165.202) (-2155.308) -- 0:02:06 527500 -- (-2159.528) (-2158.828) (-2159.797) [-2150.390] * [-2151.904] (-2163.588) (-2155.741) (-2152.528) -- 0:02:06 528000 -- (-2152.116) [-2159.004] (-2162.932) (-2151.415) * (-2160.582) (-2161.807) [-2152.870] (-2154.075) -- 0:02:06 528500 -- (-2154.818) (-2153.683) [-2152.897] (-2154.859) * (-2154.408) [-2158.040] (-2153.535) (-2155.048) -- 0:02:05 529000 -- (-2160.898) [-2153.305] (-2159.619) (-2154.399) * (-2155.537) (-2163.616) [-2155.740] (-2158.768) -- 0:02:05 529500 -- (-2155.357) (-2156.344) [-2154.322] (-2155.643) * [-2152.354] (-2160.429) (-2158.686) (-2160.689) -- 0:02:05 530000 -- (-2161.652) (-2153.589) [-2153.660] (-2159.377) * (-2163.184) (-2159.056) (-2155.381) [-2155.227] -- 0:02:05 Average standard deviation of split frequencies: 0.001777 530500 -- (-2161.004) (-2153.745) [-2151.966] (-2163.902) * (-2159.390) (-2162.456) [-2152.746] (-2154.994) -- 0:02:04 531000 -- (-2162.087) [-2154.677] (-2164.917) (-2160.427) * [-2156.587] (-2158.710) (-2156.404) (-2160.706) -- 0:02:05 531500 -- (-2159.845) [-2160.322] (-2158.802) (-2170.847) * (-2154.194) (-2152.214) [-2151.342] (-2158.674) -- 0:02:05 532000 -- (-2158.945) [-2164.482] (-2155.790) (-2157.474) * (-2155.383) [-2154.079] (-2159.224) (-2157.907) -- 0:02:04 532500 -- (-2153.735) (-2164.182) [-2158.720] (-2157.145) * (-2168.374) (-2157.874) [-2163.867] (-2151.067) -- 0:02:04 533000 -- (-2156.880) (-2152.860) [-2152.959] (-2152.030) * [-2152.502] (-2161.533) (-2162.724) (-2155.757) -- 0:02:04 533500 -- (-2152.135) [-2166.556] (-2157.856) (-2152.607) * (-2154.335) (-2159.865) (-2161.377) [-2156.387] -- 0:02:04 534000 -- [-2152.757] (-2156.494) (-2155.414) (-2151.976) * [-2155.203] (-2156.679) (-2155.803) (-2160.074) -- 0:02:03 534500 -- (-2152.297) (-2156.114) (-2153.576) [-2155.750] * (-2159.506) [-2160.453] (-2157.156) (-2153.344) -- 0:02:04 535000 -- (-2159.823) (-2165.783) [-2153.373] (-2158.631) * (-2155.823) [-2156.661] (-2153.802) (-2159.624) -- 0:02:04 Average standard deviation of split frequencies: 0.001539 535500 -- (-2156.344) (-2155.446) [-2164.512] (-2153.566) * (-2158.810) (-2158.345) [-2157.796] (-2158.956) -- 0:02:04 536000 -- [-2154.962] (-2162.179) (-2157.658) (-2153.974) * (-2158.658) (-2163.130) (-2159.128) [-2165.123] -- 0:02:03 536500 -- [-2160.386] (-2155.924) (-2156.654) (-2165.177) * [-2161.150] (-2153.351) (-2157.066) (-2160.712) -- 0:02:03 537000 -- (-2160.665) (-2163.330) (-2162.173) [-2160.510] * (-2155.599) (-2162.149) (-2158.453) [-2152.943] -- 0:02:03 537500 -- (-2159.731) (-2165.584) (-2166.774) [-2152.623] * (-2150.405) (-2155.588) [-2157.506] (-2153.083) -- 0:02:03 538000 -- (-2159.554) (-2161.736) [-2157.731] (-2160.021) * (-2158.862) (-2161.704) [-2159.136] (-2163.144) -- 0:02:02 538500 -- (-2163.941) [-2157.160] (-2158.422) (-2169.503) * (-2160.332) [-2153.805] (-2159.313) (-2161.355) -- 0:02:03 539000 -- (-2161.623) (-2161.123) [-2153.593] (-2163.687) * (-2155.276) [-2158.472] (-2165.187) (-2163.353) -- 0:02:03 539500 -- (-2156.093) (-2155.546) (-2156.509) [-2156.395] * (-2163.757) (-2156.877) (-2157.655) [-2157.237] -- 0:02:02 540000 -- [-2157.941] (-2158.934) (-2158.218) (-2158.915) * (-2162.917) (-2154.729) (-2155.596) [-2162.651] -- 0:02:02 Average standard deviation of split frequencies: 0.001744 540500 -- (-2160.784) (-2160.736) [-2153.116] (-2158.412) * (-2155.568) (-2153.617) [-2160.533] (-2161.205) -- 0:02:02 541000 -- [-2153.020] (-2157.206) (-2155.396) (-2161.341) * [-2160.346] (-2157.843) (-2153.073) (-2162.983) -- 0:02:02 541500 -- (-2152.495) (-2156.721) [-2161.048] (-2157.954) * (-2157.101) (-2152.887) (-2155.829) [-2160.784] -- 0:02:01 542000 -- [-2158.820] (-2159.370) (-2153.011) (-2159.147) * (-2158.967) (-2161.904) (-2155.000) [-2153.967] -- 0:02:02 542500 -- (-2156.110) [-2158.926] (-2158.541) (-2159.658) * (-2152.992) (-2160.192) (-2162.545) [-2155.293] -- 0:02:02 543000 -- (-2160.209) (-2152.430) [-2152.364] (-2157.204) * (-2156.204) (-2159.273) [-2154.064] (-2153.002) -- 0:02:02 543500 -- (-2157.329) (-2158.873) [-2156.125] (-2152.585) * (-2160.139) (-2152.378) [-2158.425] (-2151.609) -- 0:02:01 544000 -- (-2161.057) (-2154.081) (-2154.889) [-2153.046] * (-2156.427) (-2160.208) [-2160.385] (-2156.706) -- 0:02:01 544500 -- (-2163.913) (-2155.695) (-2158.074) [-2153.290] * (-2164.426) (-2156.676) [-2158.442] (-2159.439) -- 0:02:01 545000 -- (-2159.213) (-2158.214) [-2154.814] (-2160.425) * (-2156.022) (-2160.509) [-2149.813] (-2156.877) -- 0:02:01 Average standard deviation of split frequencies: 0.001943 545500 -- (-2162.704) (-2160.860) (-2161.937) [-2151.883] * (-2159.128) (-2157.041) (-2160.490) [-2157.124] -- 0:02:00 546000 -- [-2156.313] (-2158.834) (-2162.587) (-2152.471) * (-2160.749) (-2160.881) [-2155.310] (-2164.478) -- 0:02:01 546500 -- [-2165.541] (-2163.861) (-2166.209) (-2153.607) * (-2163.547) (-2154.154) [-2152.746] (-2155.161) -- 0:02:01 547000 -- (-2168.769) [-2155.643] (-2163.182) (-2153.897) * (-2151.568) (-2158.987) (-2159.438) [-2157.293] -- 0:02:00 547500 -- [-2152.555] (-2154.960) (-2162.926) (-2157.164) * (-2153.813) (-2153.963) [-2156.513] (-2160.645) -- 0:02:00 548000 -- (-2153.507) (-2159.108) (-2159.237) [-2156.051] * (-2160.600) (-2158.731) [-2156.144] (-2155.468) -- 0:02:00 548500 -- (-2151.629) (-2158.258) (-2152.456) [-2159.388] * (-2154.778) (-2161.753) [-2161.486] (-2161.181) -- 0:02:00 549000 -- [-2154.959] (-2167.937) (-2154.867) (-2154.289) * (-2153.683) [-2153.798] (-2160.007) (-2161.585) -- 0:01:59 549500 -- [-2154.259] (-2155.861) (-2158.255) (-2160.243) * (-2151.813) [-2156.439] (-2160.065) (-2156.134) -- 0:02:00 550000 -- (-2164.473) (-2162.298) (-2157.042) [-2149.964] * [-2154.466] (-2156.611) (-2161.108) (-2156.071) -- 0:02:00 Average standard deviation of split frequencies: 0.002140 550500 -- (-2159.055) [-2153.613] (-2156.257) (-2152.703) * [-2155.735] (-2154.495) (-2159.662) (-2160.142) -- 0:02:00 551000 -- (-2152.968) (-2158.135) [-2159.879] (-2157.976) * (-2156.341) (-2163.615) (-2156.926) [-2155.898] -- 0:01:59 551500 -- (-2159.458) (-2158.554) [-2153.665] (-2159.707) * [-2162.575] (-2162.109) (-2162.398) (-2158.934) -- 0:01:59 552000 -- [-2155.533] (-2155.533) (-2158.702) (-2161.290) * [-2158.023] (-2158.008) (-2163.126) (-2154.674) -- 0:01:59 552500 -- (-2160.409) [-2152.108] (-2156.096) (-2157.880) * [-2156.791] (-2158.284) (-2167.200) (-2158.249) -- 0:01:59 553000 -- (-2157.631) (-2154.339) [-2154.285] (-2160.324) * (-2153.909) (-2153.708) [-2164.173] (-2157.094) -- 0:01:58 553500 -- (-2155.987) (-2155.117) (-2152.095) [-2156.553] * (-2152.769) (-2156.626) (-2155.552) [-2155.960] -- 0:01:59 554000 -- (-2156.044) [-2155.816] (-2162.529) (-2152.190) * (-2160.191) [-2153.908] (-2162.091) (-2157.241) -- 0:01:59 554500 -- (-2152.293) [-2154.453] (-2159.772) (-2162.686) * [-2158.880] (-2162.003) (-2159.390) (-2152.000) -- 0:01:58 555000 -- [-2153.471] (-2156.404) (-2167.987) (-2152.686) * [-2156.631] (-2159.001) (-2158.608) (-2157.381) -- 0:01:58 Average standard deviation of split frequencies: 0.001272 555500 -- [-2158.560] (-2153.660) (-2162.749) (-2166.909) * (-2160.201) (-2157.054) (-2155.884) [-2153.575] -- 0:01:58 556000 -- (-2152.549) (-2158.905) [-2152.560] (-2157.024) * (-2162.215) (-2159.039) [-2155.830] (-2158.826) -- 0:01:58 556500 -- [-2160.435] (-2155.471) (-2155.580) (-2163.165) * (-2155.681) (-2158.304) [-2156.468] (-2155.797) -- 0:01:57 557000 -- (-2156.463) [-2162.586] (-2154.729) (-2154.461) * [-2156.629] (-2154.810) (-2163.086) (-2159.842) -- 0:01:58 557500 -- (-2154.331) (-2157.575) (-2159.727) [-2155.383] * (-2153.805) (-2154.920) (-2156.973) [-2153.885] -- 0:01:58 558000 -- (-2161.360) (-2158.147) [-2154.407] (-2159.351) * (-2159.541) (-2158.272) (-2155.425) [-2157.092] -- 0:01:58 558500 -- (-2155.091) [-2154.445] (-2157.198) (-2168.090) * (-2154.806) [-2159.595] (-2156.667) (-2165.645) -- 0:01:57 559000 -- (-2158.279) [-2156.522] (-2163.692) (-2162.652) * (-2158.106) [-2156.462] (-2154.047) (-2159.304) -- 0:01:57 559500 -- (-2156.052) (-2157.282) [-2159.064] (-2162.283) * (-2155.628) [-2156.410] (-2153.947) (-2158.901) -- 0:01:57 560000 -- (-2155.831) (-2159.551) [-2155.866] (-2161.017) * (-2157.650) [-2155.397] (-2159.197) (-2160.978) -- 0:01:57 Average standard deviation of split frequencies: 0.001051 560500 -- (-2162.324) [-2155.516] (-2156.359) (-2158.595) * [-2163.943] (-2159.788) (-2158.387) (-2151.788) -- 0:01:56 561000 -- (-2155.291) (-2159.130) [-2158.471] (-2163.711) * [-2157.928] (-2154.417) (-2156.112) (-2156.376) -- 0:01:57 561500 -- [-2151.543] (-2162.392) (-2154.714) (-2161.045) * (-2154.195) (-2168.577) [-2156.118] (-2157.383) -- 0:01:57 562000 -- (-2158.339) (-2162.088) [-2152.937] (-2161.482) * [-2151.288] (-2162.691) (-2154.546) (-2157.246) -- 0:01:56 562500 -- (-2152.830) [-2155.901] (-2159.001) (-2155.658) * [-2159.439] (-2159.954) (-2160.767) (-2160.014) -- 0:01:56 563000 -- (-2152.061) (-2153.318) (-2157.917) [-2155.549] * (-2159.248) [-2158.323] (-2156.251) (-2163.413) -- 0:01:56 563500 -- (-2159.974) (-2156.482) (-2162.108) [-2154.287] * [-2160.390] (-2150.658) (-2154.814) (-2158.661) -- 0:01:56 564000 -- (-2158.404) (-2153.977) (-2156.196) [-2153.985] * (-2168.509) [-2155.867] (-2167.188) (-2161.048) -- 0:01:55 564500 -- (-2158.615) [-2153.815] (-2159.761) (-2158.318) * (-2158.203) [-2155.693] (-2156.777) (-2156.853) -- 0:01:55 565000 -- [-2153.199] (-2156.479) (-2157.361) (-2155.597) * (-2166.648) [-2160.634] (-2157.457) (-2158.949) -- 0:01:56 Average standard deviation of split frequencies: 0.001041 565500 -- (-2155.985) [-2156.838] (-2151.529) (-2158.097) * (-2161.548) [-2152.873] (-2156.737) (-2162.263) -- 0:01:56 566000 -- (-2156.358) [-2152.367] (-2163.793) (-2164.209) * (-2155.011) (-2157.785) [-2150.149] (-2164.317) -- 0:01:55 566500 -- (-2151.326) [-2153.045] (-2151.429) (-2164.867) * (-2156.758) (-2157.304) [-2154.617] (-2158.181) -- 0:01:55 567000 -- (-2155.217) [-2156.563] (-2149.857) (-2161.700) * (-2154.177) [-2150.927] (-2156.376) (-2155.864) -- 0:01:55 567500 -- (-2161.737) (-2152.413) [-2156.973] (-2153.932) * (-2163.325) [-2156.909] (-2155.011) (-2157.278) -- 0:01:55 568000 -- (-2155.571) [-2152.025] (-2160.224) (-2154.307) * (-2156.261) (-2156.431) (-2156.112) [-2151.320] -- 0:01:54 568500 -- (-2156.940) (-2154.725) [-2155.432] (-2154.129) * [-2155.195] (-2159.928) (-2154.812) (-2151.371) -- 0:01:55 569000 -- (-2157.662) (-2157.211) [-2154.542] (-2161.085) * (-2154.607) [-2159.627] (-2161.277) (-2159.940) -- 0:01:55 569500 -- [-2154.022] (-2155.656) (-2159.931) (-2159.890) * (-2154.801) [-2154.694] (-2167.193) (-2154.351) -- 0:01:54 570000 -- [-2160.778] (-2155.337) (-2158.142) (-2157.039) * [-2151.084] (-2154.363) (-2156.729) (-2155.056) -- 0:01:54 Average standard deviation of split frequencies: 0.001033 570500 -- (-2158.120) [-2154.674] (-2158.330) (-2157.765) * [-2152.747] (-2159.491) (-2159.862) (-2162.883) -- 0:01:54 571000 -- (-2158.547) (-2159.934) [-2164.074] (-2154.794) * (-2159.052) [-2157.299] (-2161.287) (-2157.467) -- 0:01:54 571500 -- (-2154.089) [-2161.609] (-2168.185) (-2161.375) * [-2151.755] (-2158.434) (-2156.089) (-2158.494) -- 0:01:53 572000 -- (-2156.297) [-2157.818] (-2158.181) (-2155.614) * (-2160.760) (-2167.563) [-2153.156] (-2155.620) -- 0:01:53 572500 -- [-2156.360] (-2157.054) (-2156.030) (-2157.489) * (-2163.526) [-2162.623] (-2157.494) (-2162.029) -- 0:01:54 573000 -- (-2153.369) (-2157.040) (-2164.318) [-2153.303] * (-2159.262) (-2161.788) (-2159.744) [-2154.502] -- 0:01:54 573500 -- [-2151.904] (-2152.942) (-2154.950) (-2159.164) * (-2161.845) [-2156.316] (-2153.997) (-2155.367) -- 0:01:53 574000 -- (-2158.579) [-2152.930] (-2156.002) (-2156.234) * (-2157.464) (-2157.582) [-2159.366] (-2154.256) -- 0:01:53 574500 -- (-2154.437) (-2155.844) [-2151.620] (-2158.497) * (-2166.855) [-2160.680] (-2162.320) (-2156.988) -- 0:01:53 575000 -- (-2162.286) (-2157.096) (-2151.165) [-2154.069] * (-2162.416) (-2157.027) (-2154.948) [-2153.461] -- 0:01:53 Average standard deviation of split frequencies: 0.001023 575500 -- (-2157.320) (-2159.622) [-2154.854] (-2155.032) * [-2154.452] (-2159.408) (-2156.569) (-2159.618) -- 0:01:52 576000 -- [-2153.681] (-2155.186) (-2158.333) (-2158.411) * [-2153.190] (-2159.850) (-2158.023) (-2153.453) -- 0:01:53 576500 -- (-2156.110) (-2152.077) (-2159.915) [-2155.638] * (-2162.454) [-2160.675] (-2159.030) (-2160.404) -- 0:01:53 577000 -- (-2165.233) [-2153.757] (-2158.782) (-2157.472) * [-2156.360] (-2161.492) (-2156.290) (-2159.763) -- 0:01:52 577500 -- (-2168.491) (-2154.442) [-2153.374] (-2164.918) * (-2154.988) (-2153.854) [-2153.935] (-2165.195) -- 0:01:52 578000 -- (-2158.873) [-2160.955] (-2162.996) (-2157.172) * (-2160.964) (-2156.878) (-2157.008) [-2157.499] -- 0:01:52 578500 -- (-2157.231) (-2155.880) [-2156.133] (-2155.930) * (-2154.342) (-2157.558) [-2161.730] (-2164.554) -- 0:01:52 579000 -- (-2157.161) [-2156.294] (-2159.501) (-2158.824) * (-2157.395) (-2165.194) [-2155.115] (-2151.410) -- 0:01:51 579500 -- (-2159.085) (-2160.700) (-2152.831) [-2163.348] * (-2165.645) (-2162.925) [-2157.645] (-2152.534) -- 0:01:51 580000 -- (-2152.409) (-2156.479) [-2155.213] (-2164.823) * [-2155.677] (-2159.542) (-2156.202) (-2157.259) -- 0:01:52 Average standard deviation of split frequencies: 0.001015 580500 -- (-2161.297) (-2159.211) [-2153.512] (-2157.737) * [-2158.777] (-2159.069) (-2164.272) (-2159.338) -- 0:01:52 581000 -- (-2157.042) (-2165.210) [-2158.227] (-2163.747) * [-2154.840] (-2156.502) (-2155.102) (-2165.256) -- 0:01:51 581500 -- (-2164.329) [-2154.919] (-2154.157) (-2160.344) * [-2152.448] (-2161.340) (-2150.304) (-2169.434) -- 0:01:51 582000 -- (-2154.208) [-2158.565] (-2153.698) (-2159.092) * [-2157.615] (-2160.329) (-2155.267) (-2160.277) -- 0:01:51 582500 -- (-2166.427) (-2164.482) [-2156.998] (-2153.633) * (-2156.056) (-2154.888) (-2156.078) [-2162.967] -- 0:01:51 583000 -- (-2161.653) (-2160.911) [-2156.429] (-2157.284) * [-2154.946] (-2159.205) (-2158.741) (-2157.870) -- 0:01:50 583500 -- (-2160.683) (-2152.449) (-2157.299) [-2161.473] * (-2157.515) [-2156.590] (-2161.893) (-2157.505) -- 0:01:51 584000 -- (-2165.251) (-2157.913) [-2161.709] (-2157.584) * [-2153.137] (-2157.396) (-2159.582) (-2159.813) -- 0:01:51 584500 -- (-2153.382) (-2155.597) [-2158.872] (-2159.879) * (-2154.315) (-2163.549) (-2167.155) [-2160.997] -- 0:01:50 585000 -- (-2159.657) [-2155.901] (-2156.694) (-2153.616) * (-2158.746) (-2159.977) (-2159.187) [-2158.281] -- 0:01:50 Average standard deviation of split frequencies: 0.001408 585500 -- (-2162.103) (-2161.210) [-2160.957] (-2153.024) * (-2158.088) (-2161.876) [-2156.843] (-2155.915) -- 0:01:50 586000 -- (-2157.805) (-2158.307) [-2158.088] (-2162.270) * [-2157.338] (-2155.455) (-2152.420) (-2160.703) -- 0:01:50 586500 -- (-2156.942) (-2155.556) [-2158.696] (-2154.363) * (-2156.980) (-2156.867) (-2165.939) [-2156.046] -- 0:01:49 587000 -- (-2152.894) (-2156.002) (-2155.999) [-2157.748] * (-2158.533) (-2154.960) (-2156.308) [-2158.431] -- 0:01:49 587500 -- [-2154.168] (-2156.071) (-2158.509) (-2153.897) * [-2158.345] (-2155.232) (-2161.111) (-2164.054) -- 0:01:50 588000 -- (-2158.965) (-2156.553) (-2152.750) [-2155.647] * (-2160.439) (-2154.221) [-2152.226] (-2159.849) -- 0:01:50 588500 -- [-2158.569] (-2158.434) (-2163.853) (-2160.173) * (-2157.523) (-2154.715) [-2152.958] (-2161.315) -- 0:01:49 589000 -- (-2159.779) (-2155.591) (-2160.854) [-2155.241] * (-2152.901) (-2158.221) (-2155.960) [-2164.556] -- 0:01:49 589500 -- [-2159.337] (-2157.428) (-2157.813) (-2160.348) * [-2156.584] (-2158.231) (-2155.885) (-2159.989) -- 0:01:49 590000 -- (-2155.581) (-2160.441) (-2156.673) [-2154.455] * [-2154.938] (-2155.588) (-2157.980) (-2156.420) -- 0:01:49 Average standard deviation of split frequencies: 0.001596 590500 -- (-2152.192) (-2153.724) (-2156.967) [-2155.725] * (-2154.659) (-2157.790) [-2154.942] (-2152.718) -- 0:01:48 591000 -- (-2155.628) (-2153.242) (-2158.415) [-2157.107] * (-2155.785) (-2161.879) (-2157.859) [-2150.783] -- 0:01:49 591500 -- (-2157.358) (-2157.576) [-2160.571] (-2158.744) * (-2155.916) (-2153.440) [-2159.326] (-2161.234) -- 0:01:49 592000 -- (-2153.854) [-2154.346] (-2161.450) (-2154.336) * [-2162.107] (-2157.363) (-2161.276) (-2158.855) -- 0:01:48 592500 -- (-2161.004) (-2156.757) [-2155.687] (-2162.047) * [-2161.186] (-2158.417) (-2163.311) (-2160.749) -- 0:01:48 593000 -- (-2160.939) (-2160.528) (-2158.222) [-2158.538] * [-2156.470] (-2156.312) (-2166.344) (-2157.300) -- 0:01:48 593500 -- (-2156.427) [-2159.958] (-2154.168) (-2155.818) * (-2156.090) (-2150.653) [-2159.975] (-2159.729) -- 0:01:48 594000 -- (-2164.321) (-2167.303) [-2154.866] (-2158.565) * (-2152.618) [-2155.992] (-2160.359) (-2168.306) -- 0:01:47 594500 -- [-2153.393] (-2155.012) (-2156.696) (-2153.349) * [-2152.668] (-2161.655) (-2158.892) (-2160.784) -- 0:01:47 595000 -- (-2161.595) (-2160.057) [-2158.032] (-2161.310) * [-2165.654] (-2154.905) (-2161.350) (-2161.670) -- 0:01:48 Average standard deviation of split frequencies: 0.001582 595500 -- (-2154.526) (-2156.806) [-2156.440] (-2155.397) * (-2160.369) [-2158.432] (-2159.880) (-2161.278) -- 0:01:48 596000 -- (-2159.523) [-2158.399] (-2164.695) (-2156.433) * (-2159.004) (-2155.120) [-2158.538] (-2158.016) -- 0:01:47 596500 -- (-2154.725) [-2154.379] (-2159.968) (-2153.928) * (-2156.228) (-2159.319) (-2161.919) [-2156.033] -- 0:01:47 597000 -- (-2151.704) (-2162.653) (-2157.002) [-2160.900] * (-2152.131) (-2157.968) [-2154.681] (-2159.361) -- 0:01:47 597500 -- (-2155.703) [-2160.040] (-2159.471) (-2156.629) * (-2162.446) (-2157.091) [-2163.432] (-2160.337) -- 0:01:47 598000 -- [-2154.287] (-2157.146) (-2152.411) (-2155.755) * (-2160.701) [-2166.076] (-2156.175) (-2154.030) -- 0:01:46 598500 -- [-2158.259] (-2161.303) (-2150.716) (-2159.788) * (-2156.999) (-2160.866) [-2154.566] (-2165.931) -- 0:01:46 599000 -- [-2167.306] (-2156.920) (-2157.373) (-2156.416) * (-2159.811) (-2158.089) (-2157.066) [-2154.886] -- 0:01:47 599500 -- (-2156.544) [-2160.532] (-2157.370) (-2156.137) * (-2155.159) (-2157.370) (-2155.342) [-2154.158] -- 0:01:46 600000 -- (-2156.103) (-2165.537) [-2164.921] (-2155.870) * (-2156.144) [-2156.283] (-2156.337) (-2163.123) -- 0:01:46 Average standard deviation of split frequencies: 0.001766 600500 -- (-2153.170) (-2156.692) [-2150.576] (-2152.553) * (-2164.702) [-2153.020] (-2156.385) (-2163.408) -- 0:01:46 601000 -- [-2156.573] (-2155.584) (-2160.258) (-2159.001) * [-2150.416] (-2167.501) (-2158.246) (-2158.696) -- 0:01:46 601500 -- (-2162.207) (-2156.064) [-2154.771] (-2166.917) * (-2156.547) (-2158.480) (-2154.535) [-2155.255] -- 0:01:46 602000 -- (-2165.642) [-2155.683] (-2158.563) (-2166.527) * (-2157.149) [-2161.327] (-2154.663) (-2155.553) -- 0:01:45 602500 -- (-2162.885) [-2160.320] (-2155.475) (-2168.293) * [-2158.789] (-2154.251) (-2154.907) (-2152.575) -- 0:01:46 603000 -- (-2158.782) (-2155.489) [-2151.175] (-2158.603) * (-2162.330) [-2153.062] (-2157.574) (-2156.738) -- 0:01:45 603500 -- (-2158.489) [-2158.633] (-2164.016) (-2165.188) * (-2162.147) [-2156.072] (-2158.731) (-2156.856) -- 0:01:45 604000 -- (-2157.222) (-2157.365) [-2156.452] (-2153.126) * [-2158.284] (-2159.290) (-2155.028) (-2160.381) -- 0:01:45 604500 -- (-2158.524) (-2164.104) (-2161.437) [-2156.581] * (-2160.726) [-2156.032] (-2157.229) (-2154.331) -- 0:01:45 605000 -- (-2159.682) (-2157.956) [-2155.541] (-2157.668) * (-2160.815) [-2161.262] (-2156.817) (-2159.502) -- 0:01:45 Average standard deviation of split frequencies: 0.001750 605500 -- (-2164.478) (-2152.386) (-2155.099) [-2155.643] * (-2157.358) [-2159.992] (-2159.288) (-2157.620) -- 0:01:44 606000 -- (-2154.135) [-2154.880] (-2156.813) (-2166.552) * (-2154.796) [-2153.434] (-2159.275) (-2158.196) -- 0:01:44 606500 -- (-2163.757) (-2156.230) (-2156.412) [-2159.253] * (-2162.893) [-2156.436] (-2159.980) (-2157.991) -- 0:01:45 607000 -- (-2158.849) [-2151.022] (-2154.994) (-2164.403) * (-2157.707) [-2157.650] (-2156.875) (-2158.221) -- 0:01:44 607500 -- (-2158.637) [-2153.446] (-2156.119) (-2157.377) * (-2162.176) (-2156.910) [-2152.279] (-2153.120) -- 0:01:44 608000 -- (-2155.427) (-2157.237) (-2159.325) [-2148.701] * (-2157.742) [-2157.355] (-2157.477) (-2163.518) -- 0:01:44 608500 -- (-2165.800) [-2151.544] (-2159.937) (-2157.898) * (-2158.706) [-2153.625] (-2159.649) (-2154.733) -- 0:01:44 609000 -- (-2162.067) (-2157.988) (-2159.697) [-2157.214] * [-2154.259] (-2155.640) (-2160.045) (-2163.693) -- 0:01:44 609500 -- [-2154.741] (-2156.950) (-2156.480) (-2161.835) * [-2158.089] (-2157.070) (-2158.919) (-2156.111) -- 0:01:43 610000 -- (-2162.587) [-2156.867] (-2156.202) (-2152.217) * (-2163.158) [-2154.829] (-2161.665) (-2157.382) -- 0:01:44 Average standard deviation of split frequencies: 0.001737 610500 -- (-2158.746) [-2158.854] (-2156.426) (-2156.489) * [-2155.610] (-2152.072) (-2151.895) (-2155.608) -- 0:01:43 611000 -- (-2161.426) (-2160.581) (-2159.005) [-2153.904] * (-2155.748) (-2165.792) [-2164.362] (-2156.389) -- 0:01:43 611500 -- (-2158.107) (-2153.977) [-2157.245] (-2157.571) * (-2157.478) (-2157.291) (-2155.939) [-2155.513] -- 0:01:43 612000 -- (-2159.179) (-2152.832) [-2162.573] (-2152.362) * [-2161.785] (-2156.854) (-2158.683) (-2158.969) -- 0:01:43 612500 -- (-2160.396) [-2157.301] (-2159.220) (-2153.235) * (-2152.031) [-2160.177] (-2156.269) (-2164.378) -- 0:01:43 613000 -- [-2155.036] (-2157.916) (-2155.872) (-2163.173) * [-2155.224] (-2158.142) (-2158.514) (-2161.082) -- 0:01:42 613500 -- (-2160.007) (-2151.872) (-2151.310) [-2160.256] * (-2165.126) (-2159.418) (-2158.646) [-2161.208] -- 0:01:43 614000 -- (-2161.127) (-2157.479) [-2155.266] (-2160.209) * (-2161.751) [-2161.817] (-2158.213) (-2159.457) -- 0:01:43 614500 -- (-2153.849) [-2159.332] (-2160.014) (-2164.446) * [-2152.913] (-2159.678) (-2165.677) (-2155.439) -- 0:01:42 615000 -- (-2159.116) (-2153.111) [-2154.673] (-2156.505) * (-2157.861) (-2154.563) [-2157.726] (-2159.493) -- 0:01:42 Average standard deviation of split frequencies: 0.001913 615500 -- (-2156.704) (-2152.958) [-2156.694] (-2157.436) * (-2156.461) (-2157.936) [-2157.205] (-2168.461) -- 0:01:42 616000 -- (-2155.885) [-2152.523] (-2153.914) (-2156.110) * (-2159.768) (-2162.182) (-2154.734) [-2157.146] -- 0:01:42 616500 -- (-2162.178) (-2153.578) [-2157.007] (-2158.389) * (-2157.808) (-2162.161) (-2152.130) [-2156.167] -- 0:01:42 617000 -- (-2158.472) [-2164.259] (-2159.011) (-2164.305) * (-2157.938) [-2158.768] (-2157.813) (-2152.669) -- 0:01:41 617500 -- [-2160.218] (-2156.403) (-2156.237) (-2158.058) * (-2157.892) (-2163.597) (-2156.162) [-2159.171] -- 0:01:42 618000 -- [-2154.009] (-2154.000) (-2154.744) (-2160.489) * [-2155.443] (-2158.776) (-2156.523) (-2159.300) -- 0:01:41 618500 -- (-2157.696) (-2154.509) (-2159.669) [-2162.218] * [-2154.467] (-2157.629) (-2159.886) (-2157.848) -- 0:01:41 619000 -- (-2157.269) [-2152.951] (-2158.772) (-2162.501) * [-2155.630] (-2151.200) (-2160.408) (-2153.649) -- 0:01:41 619500 -- (-2152.714) (-2156.919) [-2155.472] (-2160.737) * [-2159.577] (-2155.214) (-2155.405) (-2156.691) -- 0:01:41 620000 -- [-2156.465] (-2161.919) (-2158.086) (-2156.266) * (-2157.986) (-2160.685) [-2155.064] (-2156.670) -- 0:01:41 Average standard deviation of split frequencies: 0.002468 620500 -- (-2154.039) [-2160.578] (-2159.409) (-2152.749) * (-2160.189) [-2157.014] (-2156.743) (-2158.986) -- 0:01:40 621000 -- (-2156.827) (-2160.993) [-2159.702] (-2153.449) * (-2158.422) (-2151.577) [-2153.912] (-2160.136) -- 0:01:41 621500 -- (-2162.734) [-2151.640] (-2151.772) (-2154.868) * (-2162.280) (-2153.966) (-2159.785) [-2156.890] -- 0:01:41 622000 -- (-2158.680) [-2156.489] (-2158.967) (-2157.808) * [-2157.946] (-2162.198) (-2160.789) (-2155.421) -- 0:01:40 622500 -- (-2156.959) (-2157.940) [-2154.307] (-2159.947) * (-2156.589) (-2158.288) [-2154.455] (-2162.914) -- 0:01:40 623000 -- (-2160.230) (-2161.268) [-2151.328] (-2159.568) * (-2160.529) [-2154.225] (-2163.540) (-2159.549) -- 0:01:40 623500 -- (-2158.720) (-2172.611) (-2152.793) [-2154.444] * (-2153.627) (-2152.864) (-2163.588) [-2161.472] -- 0:01:40 624000 -- (-2157.933) (-2159.977) (-2154.674) [-2156.026] * (-2154.742) [-2155.316] (-2157.784) (-2150.534) -- 0:01:40 624500 -- (-2157.851) (-2161.148) (-2153.816) [-2158.960] * (-2155.798) [-2154.662] (-2162.720) (-2152.171) -- 0:01:39 625000 -- [-2153.224] (-2163.556) (-2165.368) (-2157.661) * (-2155.753) (-2152.322) [-2159.900] (-2162.686) -- 0:01:40 Average standard deviation of split frequencies: 0.001506 625500 -- (-2156.387) (-2160.614) [-2158.707] (-2159.487) * (-2152.529) [-2153.849] (-2155.914) (-2161.934) -- 0:01:39 626000 -- (-2155.451) (-2163.387) [-2154.936] (-2156.263) * (-2151.044) (-2159.675) [-2158.286] (-2162.481) -- 0:01:39 626500 -- (-2161.816) (-2159.365) [-2151.843] (-2156.580) * [-2152.576] (-2161.020) (-2157.183) (-2158.683) -- 0:01:39 627000 -- [-2151.751] (-2155.266) (-2155.352) (-2158.958) * (-2156.352) (-2157.047) (-2155.061) [-2156.620] -- 0:01:39 627500 -- (-2156.235) (-2162.307) (-2154.340) [-2157.164] * (-2159.793) (-2154.563) (-2156.242) [-2152.886] -- 0:01:39 628000 -- (-2157.237) [-2161.618] (-2150.359) (-2159.028) * (-2158.061) [-2153.001] (-2156.685) (-2156.127) -- 0:01:38 628500 -- (-2160.842) [-2152.956] (-2161.128) (-2165.531) * (-2163.500) (-2154.525) [-2160.629] (-2156.006) -- 0:01:39 629000 -- (-2161.303) [-2155.016] (-2165.591) (-2167.598) * (-2162.984) [-2152.567] (-2161.108) (-2164.717) -- 0:01:39 629500 -- (-2168.344) (-2156.529) (-2155.624) [-2159.187] * (-2157.811) [-2151.771] (-2165.113) (-2168.841) -- 0:01:38 630000 -- [-2151.079] (-2157.341) (-2157.440) (-2158.284) * (-2156.964) (-2152.005) (-2163.558) [-2159.766] -- 0:01:38 Average standard deviation of split frequencies: 0.001869 630500 -- (-2153.061) [-2155.801] (-2161.985) (-2155.423) * (-2161.288) (-2160.229) (-2158.210) [-2152.385] -- 0:01:38 631000 -- (-2161.890) [-2156.133] (-2156.911) (-2162.997) * (-2166.173) (-2160.671) (-2157.124) [-2153.840] -- 0:01:38 631500 -- (-2152.697) [-2153.601] (-2149.778) (-2156.021) * [-2155.344] (-2159.534) (-2157.289) (-2153.453) -- 0:01:38 632000 -- (-2158.259) (-2165.511) [-2158.258] (-2160.044) * [-2154.609] (-2156.658) (-2159.581) (-2150.763) -- 0:01:37 632500 -- (-2155.127) (-2157.219) [-2153.984] (-2161.413) * [-2154.181] (-2158.541) (-2160.900) (-2155.315) -- 0:01:38 633000 -- [-2152.479] (-2158.597) (-2154.752) (-2163.072) * (-2156.635) (-2150.823) (-2161.879) [-2155.182] -- 0:01:37 633500 -- [-2159.549] (-2153.593) (-2160.343) (-2157.189) * [-2157.230] (-2155.498) (-2157.736) (-2155.447) -- 0:01:37 634000 -- (-2158.009) (-2154.767) [-2150.361] (-2161.776) * (-2158.843) (-2154.724) (-2159.780) [-2152.081] -- 0:01:37 634500 -- (-2156.162) [-2156.162] (-2161.325) (-2162.379) * (-2159.462) (-2159.939) [-2157.699] (-2159.619) -- 0:01:37 635000 -- [-2156.398] (-2158.679) (-2154.464) (-2165.123) * (-2163.643) (-2156.064) (-2157.951) [-2156.895] -- 0:01:37 Average standard deviation of split frequencies: 0.001668 635500 -- (-2166.574) (-2169.913) [-2156.501] (-2162.878) * [-2155.204] (-2155.517) (-2157.866) (-2160.460) -- 0:01:36 636000 -- (-2159.900) (-2151.712) [-2152.939] (-2160.830) * [-2151.107] (-2155.699) (-2157.141) (-2160.554) -- 0:01:37 636500 -- (-2165.818) (-2159.012) [-2153.492] (-2157.018) * (-2159.456) [-2156.786] (-2159.901) (-2159.763) -- 0:01:37 637000 -- [-2154.799] (-2171.486) (-2155.711) (-2158.334) * (-2156.545) (-2156.438) [-2153.842] (-2165.728) -- 0:01:36 637500 -- [-2156.604] (-2163.797) (-2156.700) (-2155.461) * (-2154.244) (-2153.499) (-2160.103) [-2156.333] -- 0:01:36 638000 -- (-2155.432) (-2164.192) (-2156.870) [-2162.704] * (-2164.492) (-2155.231) [-2157.455] (-2153.254) -- 0:01:36 638500 -- (-2151.471) (-2169.275) [-2151.883] (-2158.243) * (-2154.493) (-2161.967) [-2161.955] (-2152.932) -- 0:01:36 639000 -- (-2157.874) (-2159.451) (-2161.177) [-2153.441] * (-2153.092) [-2150.321] (-2160.083) (-2163.612) -- 0:01:36 639500 -- [-2160.816] (-2158.828) (-2162.405) (-2159.677) * (-2155.747) (-2160.074) (-2157.702) [-2159.781] -- 0:01:35 640000 -- (-2158.169) [-2153.858] (-2167.117) (-2158.518) * (-2161.587) (-2155.003) (-2152.483) [-2159.440] -- 0:01:36 Average standard deviation of split frequencies: 0.003495 640500 -- (-2151.185) (-2163.209) (-2158.096) [-2158.149] * (-2161.427) (-2157.182) [-2156.992] (-2160.998) -- 0:01:35 641000 -- [-2157.997] (-2168.560) (-2157.902) (-2154.339) * (-2155.761) (-2159.069) (-2160.886) [-2158.848] -- 0:01:35 641500 -- (-2154.829) (-2158.281) [-2151.379] (-2153.544) * (-2154.459) (-2159.431) [-2160.520] (-2155.203) -- 0:01:35 642000 -- [-2157.944] (-2160.482) (-2169.592) (-2159.866) * (-2160.362) (-2164.118) (-2154.730) [-2156.825] -- 0:01:35 642500 -- (-2162.175) (-2157.382) (-2155.859) [-2153.390] * (-2158.505) (-2159.985) [-2155.196] (-2161.063) -- 0:01:35 643000 -- (-2163.088) [-2156.826] (-2161.536) (-2155.351) * (-2156.908) [-2155.586] (-2159.330) (-2159.925) -- 0:01:34 643500 -- [-2153.590] (-2152.087) (-2157.237) (-2150.183) * [-2156.948] (-2155.406) (-2163.251) (-2160.301) -- 0:01:34 644000 -- (-2154.155) [-2156.219] (-2152.768) (-2155.174) * (-2154.413) [-2157.545] (-2164.899) (-2156.273) -- 0:01:35 644500 -- (-2160.592) [-2156.881] (-2156.652) (-2156.233) * [-2158.586] (-2163.920) (-2153.424) (-2155.630) -- 0:01:34 645000 -- (-2160.931) (-2160.008) [-2153.101] (-2159.439) * (-2163.076) (-2168.021) [-2156.466] (-2161.813) -- 0:01:34 Average standard deviation of split frequencies: 0.003831 645500 -- (-2155.086) (-2154.648) [-2157.598] (-2158.125) * (-2165.331) (-2155.718) (-2160.525) [-2155.002] -- 0:01:34 646000 -- (-2157.802) (-2161.806) (-2154.965) [-2155.721] * (-2159.412) [-2157.509] (-2153.519) (-2153.059) -- 0:01:34 646500 -- (-2157.078) [-2152.968] (-2161.759) (-2160.441) * (-2173.834) (-2156.274) [-2154.062] (-2155.130) -- 0:01:34 647000 -- (-2160.636) [-2157.209] (-2162.857) (-2162.078) * (-2165.358) (-2155.194) (-2155.332) [-2154.087] -- 0:01:33 647500 -- [-2167.138] (-2157.126) (-2162.426) (-2160.080) * (-2155.741) (-2154.557) (-2165.887) [-2154.428] -- 0:01:34 648000 -- (-2158.640) (-2151.403) [-2157.568] (-2153.632) * [-2158.355] (-2156.235) (-2164.802) (-2156.802) -- 0:01:33 648500 -- (-2156.153) (-2152.424) (-2158.140) [-2153.195] * (-2156.497) [-2156.457] (-2151.808) (-2154.058) -- 0:01:33 649000 -- (-2155.731) (-2160.015) [-2151.802] (-2163.448) * (-2158.160) [-2155.062] (-2161.325) (-2154.168) -- 0:01:33 649500 -- (-2154.695) (-2157.481) (-2171.585) [-2161.435] * [-2154.577] (-2157.329) (-2152.068) (-2157.037) -- 0:01:33 650000 -- (-2167.548) (-2160.165) (-2159.881) [-2151.601] * (-2158.981) [-2157.477] (-2161.178) (-2157.997) -- 0:01:33 Average standard deviation of split frequencies: 0.002536 650500 -- (-2168.149) (-2162.523) [-2154.410] (-2157.170) * (-2154.180) [-2162.581] (-2158.262) (-2158.569) -- 0:01:32 651000 -- (-2160.858) (-2158.501) (-2154.560) [-2157.259] * (-2155.817) (-2159.323) (-2157.264) [-2161.261] -- 0:01:33 651500 -- (-2156.182) (-2155.298) [-2155.677] (-2163.101) * (-2156.324) (-2159.052) [-2151.289] (-2167.693) -- 0:01:33 652000 -- (-2158.587) (-2162.274) (-2159.186) [-2161.163] * (-2162.290) (-2163.436) (-2154.990) [-2153.166] -- 0:01:32 652500 -- (-2160.011) [-2154.240] (-2151.815) (-2158.160) * [-2150.362] (-2158.825) (-2162.504) (-2160.865) -- 0:01:32 653000 -- (-2156.490) (-2158.415) (-2156.384) [-2161.852] * [-2155.562] (-2159.807) (-2155.065) (-2154.149) -- 0:01:32 653500 -- (-2163.078) [-2155.649] (-2153.705) (-2153.177) * [-2159.340] (-2153.727) (-2155.630) (-2155.342) -- 0:01:32 654000 -- (-2161.208) (-2160.590) [-2156.459] (-2153.330) * (-2158.905) (-2158.031) [-2154.950] (-2154.006) -- 0:01:32 654500 -- [-2152.321] (-2157.452) (-2156.129) (-2154.161) * (-2162.490) (-2165.038) [-2157.060] (-2163.599) -- 0:01:31 655000 -- (-2154.313) [-2153.932] (-2153.342) (-2160.756) * (-2155.543) (-2162.456) [-2154.271] (-2159.903) -- 0:01:32 Average standard deviation of split frequencies: 0.002335 655500 -- (-2158.214) (-2159.817) (-2156.063) [-2149.859] * (-2151.630) (-2166.899) (-2154.761) [-2159.692] -- 0:01:31 656000 -- (-2157.811) (-2160.929) (-2158.027) [-2152.745] * [-2155.203] (-2156.057) (-2154.961) (-2164.224) -- 0:01:31 656500 -- (-2158.372) (-2156.509) (-2159.190) [-2154.385] * (-2164.434) [-2152.391] (-2156.521) (-2164.234) -- 0:01:31 657000 -- (-2159.210) (-2161.138) (-2156.874) [-2151.868] * [-2160.180] (-2162.410) (-2161.417) (-2159.083) -- 0:01:31 657500 -- (-2162.305) (-2158.517) (-2155.210) [-2151.144] * (-2167.971) (-2154.525) (-2158.809) [-2163.002] -- 0:01:31 658000 -- [-2157.743] (-2161.917) (-2153.047) (-2156.125) * (-2162.282) [-2152.885] (-2155.141) (-2162.884) -- 0:01:30 658500 -- (-2155.731) (-2167.655) [-2157.761] (-2154.137) * (-2170.350) (-2159.672) (-2156.873) [-2159.968] -- 0:01:31 659000 -- (-2156.470) [-2155.698] (-2159.505) (-2158.416) * (-2153.283) (-2152.174) [-2159.392] (-2163.676) -- 0:01:31 659500 -- [-2157.337] (-2159.124) (-2153.238) (-2160.092) * (-2153.326) (-2154.407) [-2154.399] (-2157.747) -- 0:01:30 660000 -- [-2150.922] (-2159.694) (-2163.500) (-2165.127) * (-2155.850) [-2153.217] (-2162.475) (-2157.997) -- 0:01:30 Average standard deviation of split frequencies: 0.003389 660500 -- (-2158.726) [-2160.362] (-2154.512) (-2160.437) * (-2159.454) (-2154.643) (-2162.394) [-2152.617] -- 0:01:30 661000 -- (-2161.449) (-2151.389) (-2163.357) [-2153.579] * (-2162.131) [-2152.972] (-2164.008) (-2156.931) -- 0:01:30 661500 -- [-2168.501] (-2156.866) (-2155.874) (-2159.274) * [-2163.164] (-2159.149) (-2159.300) (-2158.443) -- 0:01:30 662000 -- (-2158.659) (-2152.671) [-2156.057] (-2160.292) * (-2154.823) [-2151.820] (-2155.103) (-2159.059) -- 0:01:29 662500 -- [-2160.840] (-2163.949) (-2154.383) (-2162.230) * (-2160.296) (-2158.584) [-2155.459] (-2165.669) -- 0:01:30 663000 -- (-2155.250) (-2158.667) (-2155.987) [-2158.241] * (-2164.866) (-2160.184) [-2153.718] (-2163.006) -- 0:01:29 663500 -- (-2158.420) [-2154.043] (-2165.189) (-2157.326) * [-2159.808] (-2164.741) (-2153.064) (-2156.299) -- 0:01:29 664000 -- [-2152.073] (-2156.013) (-2156.384) (-2154.396) * (-2160.621) (-2166.058) [-2154.453] (-2162.452) -- 0:01:29 664500 -- (-2155.453) (-2159.314) (-2159.300) [-2162.241] * (-2161.416) [-2155.553] (-2155.166) (-2168.639) -- 0:01:29 665000 -- (-2154.826) (-2156.158) [-2156.242] (-2155.233) * (-2158.519) [-2153.378] (-2152.898) (-2159.542) -- 0:01:29 Average standard deviation of split frequencies: 0.003362 665500 -- (-2150.590) (-2157.552) [-2159.984] (-2157.422) * (-2173.818) (-2158.479) [-2150.291] (-2154.733) -- 0:01:29 666000 -- (-2157.211) (-2159.220) (-2162.480) [-2155.853] * (-2152.175) [-2156.449] (-2164.937) (-2158.732) -- 0:01:29 666500 -- (-2162.127) (-2166.548) (-2163.092) [-2154.245] * (-2157.414) (-2153.602) [-2157.842] (-2164.713) -- 0:01:29 667000 -- (-2156.562) (-2168.252) (-2159.185) [-2153.834] * (-2158.968) (-2157.767) [-2153.004] (-2167.132) -- 0:01:28 667500 -- (-2165.667) (-2167.089) [-2160.246] (-2160.868) * (-2160.026) (-2156.252) (-2152.347) [-2162.311] -- 0:01:28 668000 -- (-2157.638) (-2160.234) [-2154.199] (-2158.153) * (-2153.341) [-2152.398] (-2151.788) (-2161.069) -- 0:01:28 668500 -- (-2154.806) (-2162.963) (-2155.774) [-2153.516] * (-2152.359) (-2162.570) [-2153.849] (-2165.959) -- 0:01:28 669000 -- (-2156.882) (-2159.792) [-2151.630] (-2160.274) * (-2155.576) (-2153.015) [-2156.046] (-2158.425) -- 0:01:28 669500 -- (-2155.085) (-2151.753) (-2154.821) [-2159.600] * (-2160.742) (-2159.487) (-2154.215) [-2161.126] -- 0:01:28 670000 -- (-2155.458) (-2153.945) [-2159.476] (-2163.726) * (-2158.363) [-2153.897] (-2152.346) (-2159.693) -- 0:01:28 Average standard deviation of split frequencies: 0.002636 670500 -- (-2154.410) [-2153.656] (-2166.054) (-2158.900) * [-2154.143] (-2155.272) (-2154.572) (-2158.451) -- 0:01:27 671000 -- (-2161.880) (-2162.302) (-2154.720) [-2150.788] * (-2154.872) (-2155.753) (-2154.090) [-2157.059] -- 0:01:27 671500 -- (-2156.228) [-2161.494] (-2157.705) (-2153.481) * [-2157.334] (-2155.915) (-2160.539) (-2160.890) -- 0:01:27 672000 -- [-2156.888] (-2157.387) (-2154.763) (-2155.147) * (-2156.597) (-2157.879) (-2154.994) [-2162.805] -- 0:01:27 672500 -- (-2160.867) (-2159.741) (-2166.259) [-2154.292] * (-2157.637) [-2159.663] (-2155.619) (-2161.668) -- 0:01:27 673000 -- (-2160.049) [-2163.453] (-2153.395) (-2158.880) * [-2157.464] (-2160.121) (-2156.292) (-2158.705) -- 0:01:27 673500 -- (-2156.657) (-2166.493) (-2158.484) [-2152.379] * (-2157.035) (-2155.271) [-2152.566] (-2157.523) -- 0:01:27 674000 -- (-2154.720) (-2157.750) (-2159.479) [-2165.167] * [-2156.128] (-2157.673) (-2158.901) (-2157.465) -- 0:01:27 674500 -- (-2159.487) [-2157.176] (-2155.882) (-2156.361) * [-2151.145] (-2156.048) (-2156.774) (-2161.079) -- 0:01:26 675000 -- (-2161.313) (-2157.360) (-2153.897) [-2154.012] * [-2156.611] (-2159.257) (-2153.769) (-2162.395) -- 0:01:26 Average standard deviation of split frequencies: 0.002266 675500 -- [-2155.827] (-2155.328) (-2158.445) (-2155.201) * [-2158.137] (-2159.043) (-2153.212) (-2161.890) -- 0:01:26 676000 -- [-2153.128] (-2166.113) (-2156.051) (-2161.399) * (-2154.549) (-2161.180) (-2155.217) [-2154.765] -- 0:01:26 676500 -- (-2157.261) (-2153.668) (-2154.397) [-2163.188] * (-2153.185) [-2160.881] (-2152.881) (-2160.617) -- 0:01:26 677000 -- (-2160.009) (-2154.632) [-2153.790] (-2155.201) * (-2156.118) (-2159.829) [-2156.243] (-2154.873) -- 0:01:26 677500 -- (-2160.260) (-2160.536) (-2154.274) [-2160.189] * (-2159.453) (-2169.547) (-2152.935) [-2152.255] -- 0:01:26 678000 -- (-2156.314) [-2157.876] (-2155.812) (-2157.806) * (-2160.490) (-2154.451) (-2165.810) [-2162.483] -- 0:01:25 678500 -- [-2153.024] (-2158.900) (-2162.608) (-2152.940) * (-2161.941) (-2156.655) [-2158.586] (-2154.752) -- 0:01:25 679000 -- (-2157.842) (-2161.589) (-2167.134) [-2154.769] * [-2154.493] (-2159.821) (-2159.914) (-2161.857) -- 0:01:25 679500 -- (-2157.768) (-2165.237) [-2155.767] (-2156.166) * (-2161.804) (-2160.571) (-2159.052) [-2156.737] -- 0:01:25 680000 -- (-2154.264) (-2166.121) (-2154.123) [-2158.660] * [-2157.771] (-2168.972) (-2156.539) (-2154.153) -- 0:01:25 Average standard deviation of split frequencies: 0.003463 680500 -- (-2157.660) (-2157.021) [-2159.374] (-2154.019) * (-2164.255) (-2167.703) [-2154.270] (-2160.544) -- 0:01:25 681000 -- [-2153.105] (-2159.949) (-2160.942) (-2151.561) * (-2163.316) (-2153.501) (-2157.102) [-2153.795] -- 0:01:25 681500 -- (-2155.175) (-2164.210) (-2161.111) [-2156.284] * (-2155.722) [-2156.809] (-2160.254) (-2157.924) -- 0:01:25 682000 -- (-2153.221) (-2164.698) (-2158.493) [-2156.164] * (-2157.234) (-2158.479) [-2152.396] (-2156.272) -- 0:01:24 682500 -- (-2154.523) [-2161.587] (-2154.157) (-2153.809) * (-2156.960) [-2154.541] (-2158.922) (-2152.190) -- 0:01:24 683000 -- (-2157.061) (-2152.092) (-2154.577) [-2156.310] * (-2158.448) (-2155.294) [-2153.625] (-2160.557) -- 0:01:24 683500 -- (-2162.344) (-2159.793) [-2151.836] (-2154.210) * (-2165.561) [-2155.716] (-2152.949) (-2159.643) -- 0:01:24 684000 -- (-2170.709) [-2154.995] (-2157.288) (-2160.080) * [-2155.366] (-2157.778) (-2158.508) (-2158.466) -- 0:01:24 684500 -- (-2159.517) [-2152.074] (-2154.570) (-2160.810) * (-2153.695) [-2151.345] (-2159.131) (-2156.301) -- 0:01:24 685000 -- (-2156.900) [-2156.101] (-2157.934) (-2156.277) * [-2152.900] (-2157.503) (-2162.620) (-2155.910) -- 0:01:24 Average standard deviation of split frequencies: 0.004123 685500 -- (-2152.915) [-2158.775] (-2158.343) (-2161.473) * [-2159.626] (-2157.831) (-2159.627) (-2155.669) -- 0:01:23 686000 -- [-2154.103] (-2154.684) (-2158.090) (-2155.604) * (-2164.515) (-2161.677) [-2159.071] (-2156.802) -- 0:01:23 686500 -- (-2165.225) (-2158.999) [-2156.334] (-2156.755) * (-2165.315) [-2155.536] (-2158.767) (-2154.923) -- 0:01:23 687000 -- (-2152.560) (-2155.378) [-2159.061] (-2151.889) * (-2157.560) [-2159.870] (-2161.515) (-2151.361) -- 0:01:23 687500 -- [-2152.837] (-2159.445) (-2154.061) (-2159.463) * (-2161.294) (-2157.146) [-2152.840] (-2155.406) -- 0:01:23 688000 -- [-2153.223] (-2158.624) (-2159.991) (-2156.792) * (-2155.185) (-2153.245) (-2157.413) [-2151.935] -- 0:01:23 688500 -- [-2158.293] (-2156.599) (-2160.908) (-2154.843) * (-2149.916) (-2157.174) [-2156.014] (-2162.733) -- 0:01:23 689000 -- (-2158.781) (-2154.921) (-2161.659) [-2154.966] * (-2163.527) (-2154.075) (-2154.337) [-2166.393] -- 0:01:23 689500 -- (-2159.571) (-2156.137) [-2153.460] (-2157.720) * (-2158.216) [-2158.513] (-2156.830) (-2164.697) -- 0:01:22 690000 -- (-2154.761) (-2158.228) [-2153.811] (-2157.193) * (-2157.379) (-2157.261) (-2154.919) [-2161.376] -- 0:01:22 Average standard deviation of split frequencies: 0.003413 690500 -- (-2155.594) (-2163.107) (-2158.116) [-2155.218] * (-2162.874) (-2165.536) (-2156.170) [-2156.330] -- 0:01:22 691000 -- (-2161.452) (-2156.495) (-2159.403) [-2152.474] * (-2152.154) (-2157.938) (-2156.845) [-2157.978] -- 0:01:22 691500 -- [-2153.749] (-2156.045) (-2155.059) (-2154.776) * (-2161.453) [-2154.935] (-2161.070) (-2157.925) -- 0:01:22 692000 -- (-2162.527) (-2157.166) (-2153.622) [-2153.398] * (-2156.054) (-2156.525) [-2157.887] (-2160.264) -- 0:01:22 692500 -- (-2155.951) (-2159.296) [-2155.133] (-2156.112) * (-2157.821) (-2154.985) [-2154.306] (-2157.301) -- 0:01:22 693000 -- (-2158.613) (-2156.006) (-2155.894) [-2158.624] * (-2157.247) (-2159.704) (-2154.583) [-2155.061] -- 0:01:21 693500 -- [-2160.403] (-2153.763) (-2160.414) (-2153.639) * (-2156.073) (-2157.143) (-2156.526) [-2157.048] -- 0:01:21 694000 -- [-2162.128] (-2154.828) (-2164.182) (-2160.569) * (-2165.298) (-2164.826) [-2158.216] (-2153.557) -- 0:01:21 694500 -- (-2157.643) (-2155.042) (-2155.092) [-2155.207] * (-2155.166) (-2157.872) (-2155.618) [-2156.284] -- 0:01:21 695000 -- (-2153.804) [-2157.272] (-2153.292) (-2154.526) * [-2154.929] (-2156.762) (-2156.207) (-2152.941) -- 0:01:21 Average standard deviation of split frequencies: 0.003387 695500 -- (-2161.197) (-2163.069) (-2156.937) [-2159.385] * [-2155.957] (-2154.447) (-2157.069) (-2154.074) -- 0:01:21 696000 -- [-2151.591] (-2158.593) (-2150.568) (-2156.080) * (-2154.428) (-2159.141) [-2155.782] (-2154.747) -- 0:01:21 696500 -- [-2154.127] (-2154.816) (-2161.870) (-2159.092) * (-2160.486) (-2155.082) [-2155.849] (-2152.925) -- 0:01:21 697000 -- (-2157.728) [-2153.591] (-2156.463) (-2156.803) * (-2157.417) (-2154.208) [-2157.398] (-2152.651) -- 0:01:20 697500 -- (-2161.969) (-2156.641) [-2159.003] (-2156.564) * (-2156.037) (-2154.643) [-2158.047] (-2157.584) -- 0:01:20 698000 -- (-2154.100) (-2150.165) (-2164.784) [-2151.973] * (-2155.960) [-2160.970] (-2165.954) (-2156.537) -- 0:01:20 698500 -- [-2154.617] (-2161.554) (-2153.686) (-2154.724) * [-2157.840] (-2158.081) (-2161.027) (-2159.333) -- 0:01:20 699000 -- (-2155.890) (-2159.137) [-2158.586] (-2156.671) * (-2167.106) [-2150.266] (-2158.815) (-2156.134) -- 0:01:20 699500 -- (-2154.963) (-2151.998) (-2154.227) [-2155.967] * (-2163.512) (-2155.575) (-2157.562) [-2153.368] -- 0:01:20 700000 -- [-2149.099] (-2156.427) (-2163.902) (-2158.681) * (-2160.310) [-2159.209] (-2160.073) (-2157.333) -- 0:01:20 Average standard deviation of split frequencies: 0.002355 700500 -- (-2151.801) [-2158.997] (-2164.410) (-2159.955) * (-2165.923) [-2161.532] (-2154.953) (-2165.821) -- 0:01:19 701000 -- (-2153.660) [-2155.324] (-2159.244) (-2165.055) * (-2162.666) (-2156.882) [-2152.748] (-2159.654) -- 0:01:19 701500 -- (-2157.761) [-2158.515] (-2153.608) (-2158.149) * (-2158.409) (-2156.626) [-2151.941] (-2157.434) -- 0:01:19 702000 -- (-2162.164) (-2155.069) (-2155.736) [-2158.110] * (-2155.567) (-2162.747) (-2157.291) [-2153.929] -- 0:01:19 702500 -- (-2154.878) (-2163.519) (-2160.544) [-2155.524] * [-2158.029] (-2152.362) (-2156.736) (-2163.733) -- 0:01:19 703000 -- (-2159.866) [-2156.771] (-2158.751) (-2160.759) * (-2153.142) [-2156.370] (-2157.931) (-2157.184) -- 0:01:19 703500 -- (-2158.764) [-2152.939] (-2160.549) (-2150.350) * [-2158.299] (-2157.655) (-2167.790) (-2159.207) -- 0:01:19 704000 -- (-2154.665) [-2155.112] (-2161.646) (-2151.654) * (-2154.952) [-2161.431] (-2159.063) (-2157.354) -- 0:01:19 704500 -- (-2154.091) [-2156.349] (-2159.056) (-2158.013) * (-2155.923) (-2156.557) [-2154.122] (-2155.538) -- 0:01:18 705000 -- (-2161.505) (-2160.169) [-2153.969] (-2157.345) * (-2161.936) (-2158.247) [-2155.872] (-2161.426) -- 0:01:18 Average standard deviation of split frequencies: 0.001669 705500 -- (-2160.934) (-2155.587) (-2155.387) [-2160.117] * [-2159.143] (-2159.781) (-2157.356) (-2163.943) -- 0:01:18 706000 -- (-2161.380) [-2156.533] (-2158.383) (-2154.660) * (-2161.775) (-2157.027) (-2159.247) [-2157.424] -- 0:01:18 706500 -- [-2152.942] (-2156.149) (-2158.633) (-2156.571) * (-2160.514) (-2155.131) [-2156.942] (-2164.622) -- 0:01:18 707000 -- (-2160.751) (-2155.408) [-2156.229] (-2160.749) * [-2156.522] (-2158.574) (-2166.549) (-2163.608) -- 0:01:18 707500 -- [-2157.041] (-2160.392) (-2162.105) (-2165.746) * (-2159.892) (-2161.338) (-2164.651) [-2157.262] -- 0:01:18 708000 -- (-2168.509) [-2155.500] (-2157.558) (-2153.470) * (-2164.376) [-2155.536] (-2172.193) (-2161.931) -- 0:01:17 708500 -- (-2161.832) (-2155.516) (-2160.220) [-2152.979] * (-2161.784) [-2152.669] (-2155.720) (-2155.622) -- 0:01:17 709000 -- [-2153.918] (-2154.276) (-2164.612) (-2159.500) * [-2153.090] (-2153.587) (-2154.723) (-2163.584) -- 0:01:17 709500 -- (-2151.769) (-2158.686) [-2160.310] (-2154.329) * (-2154.320) (-2154.849) [-2157.502] (-2155.835) -- 0:01:17 710000 -- [-2153.954] (-2158.782) (-2160.014) (-2152.804) * (-2157.945) (-2160.470) (-2157.327) [-2157.381] -- 0:01:17 Average standard deviation of split frequencies: 0.001824 710500 -- [-2157.372] (-2153.574) (-2156.033) (-2157.081) * (-2166.799) [-2154.958] (-2163.751) (-2157.768) -- 0:01:17 711000 -- (-2158.270) (-2155.376) (-2157.364) [-2158.462] * (-2161.751) (-2159.108) (-2154.376) [-2153.019] -- 0:01:17 711500 -- (-2160.540) (-2156.072) (-2160.266) [-2165.958] * (-2158.054) [-2156.535] (-2154.639) (-2159.382) -- 0:01:17 712000 -- [-2156.625] (-2160.573) (-2160.647) (-2158.820) * [-2153.452] (-2162.434) (-2155.009) (-2168.871) -- 0:01:16 712500 -- [-2152.551] (-2164.136) (-2158.462) (-2156.414) * (-2160.365) (-2163.207) (-2157.802) [-2161.538] -- 0:01:16 713000 -- (-2155.506) (-2158.903) (-2163.752) [-2153.325] * (-2162.499) (-2158.688) [-2155.711] (-2158.437) -- 0:01:16 713500 -- [-2156.045] (-2161.308) (-2159.819) (-2152.436) * (-2159.956) (-2153.705) (-2155.487) [-2155.427] -- 0:01:16 714000 -- [-2153.923] (-2157.151) (-2160.014) (-2156.476) * (-2159.163) [-2149.440] (-2154.705) (-2170.217) -- 0:01:16 714500 -- (-2156.760) (-2154.742) (-2157.642) [-2159.540] * [-2159.726] (-2164.435) (-2157.297) (-2161.705) -- 0:01:16 715000 -- (-2160.100) [-2158.548] (-2159.164) (-2156.477) * (-2152.395) (-2159.767) (-2159.528) [-2160.902] -- 0:01:16 Average standard deviation of split frequencies: 0.001811 715500 -- (-2160.304) (-2154.515) (-2160.843) [-2155.164] * [-2152.613] (-2155.847) (-2159.691) (-2163.287) -- 0:01:15 716000 -- (-2153.417) [-2153.731] (-2156.085) (-2153.888) * [-2154.951] (-2157.589) (-2159.073) (-2164.059) -- 0:01:15 716500 -- (-2170.397) (-2153.278) (-2156.669) [-2158.405] * (-2162.916) (-2163.734) [-2153.135] (-2159.308) -- 0:01:15 717000 -- (-2162.228) (-2158.965) [-2155.721] (-2157.587) * (-2159.561) [-2156.721] (-2151.328) (-2166.199) -- 0:01:15 717500 -- (-2160.759) (-2158.189) (-2159.656) [-2157.425] * [-2154.475] (-2160.005) (-2158.067) (-2156.970) -- 0:01:15 718000 -- (-2167.335) [-2154.773] (-2155.838) (-2152.324) * (-2152.209) [-2158.026] (-2156.137) (-2155.517) -- 0:01:15 718500 -- (-2152.927) (-2161.855) [-2156.065] (-2161.299) * (-2155.845) [-2158.157] (-2158.320) (-2156.623) -- 0:01:15 719000 -- (-2152.747) (-2161.942) [-2154.120] (-2161.881) * (-2156.664) (-2156.987) (-2156.376) [-2162.750] -- 0:01:15 719500 -- (-2157.238) [-2153.622] (-2156.597) (-2155.650) * (-2157.648) (-2155.221) [-2154.698] (-2156.667) -- 0:01:14 720000 -- [-2154.077] (-2154.157) (-2160.673) (-2155.321) * (-2156.667) [-2162.174] (-2158.563) (-2161.150) -- 0:01:14 Average standard deviation of split frequencies: 0.001799 720500 -- (-2159.820) [-2153.352] (-2159.544) (-2164.098) * (-2164.001) (-2166.069) (-2160.446) [-2152.896] -- 0:01:14 721000 -- [-2156.499] (-2158.156) (-2155.694) (-2159.121) * (-2157.248) (-2162.064) (-2163.192) [-2153.576] -- 0:01:14 721500 -- [-2153.863] (-2158.088) (-2153.928) (-2162.803) * (-2153.762) (-2157.228) [-2161.107] (-2154.725) -- 0:01:14 722000 -- (-2153.863) [-2157.916] (-2164.808) (-2154.560) * (-2156.630) (-2156.281) (-2153.538) [-2158.190] -- 0:01:14 722500 -- (-2158.560) [-2156.152] (-2158.465) (-2155.912) * (-2158.005) [-2151.188] (-2154.943) (-2159.995) -- 0:01:14 723000 -- (-2159.551) (-2155.205) [-2153.067] (-2160.166) * [-2155.152] (-2157.765) (-2153.332) (-2160.401) -- 0:01:13 723500 -- (-2157.319) (-2154.421) [-2154.354] (-2165.339) * [-2153.049] (-2155.861) (-2157.401) (-2154.998) -- 0:01:13 724000 -- (-2153.220) (-2159.266) [-2154.590] (-2165.967) * (-2152.192) (-2157.611) [-2160.686] (-2156.312) -- 0:01:13 724500 -- (-2164.482) (-2160.422) [-2154.749] (-2155.596) * (-2157.041) [-2157.898] (-2161.168) (-2157.144) -- 0:01:13 725000 -- (-2161.165) (-2153.114) (-2156.831) [-2153.215] * (-2153.548) (-2154.552) [-2155.119] (-2155.619) -- 0:01:13 Average standard deviation of split frequencies: 0.001786 725500 -- (-2160.149) [-2153.670] (-2162.636) (-2153.361) * (-2159.480) (-2155.952) (-2167.788) [-2153.380] -- 0:01:13 726000 -- (-2154.272) [-2152.175] (-2162.641) (-2158.670) * (-2155.390) [-2151.244] (-2157.376) (-2162.119) -- 0:01:13 726500 -- (-2160.974) (-2150.418) [-2159.801] (-2154.835) * [-2161.518] (-2159.146) (-2153.911) (-2157.597) -- 0:01:13 727000 -- [-2156.857] (-2156.298) (-2153.605) (-2157.330) * (-2156.522) (-2162.459) (-2152.862) [-2165.036] -- 0:01:12 727500 -- (-2157.993) (-2154.510) (-2157.719) [-2154.109] * (-2154.856) [-2152.909] (-2154.291) (-2160.017) -- 0:01:12 728000 -- (-2156.741) (-2169.199) [-2153.938] (-2159.414) * (-2160.195) (-2155.623) (-2157.322) [-2158.631] -- 0:01:12 728500 -- (-2158.051) (-2157.268) [-2159.093] (-2151.665) * [-2156.551] (-2156.614) (-2162.016) (-2158.503) -- 0:01:12 729000 -- (-2156.647) (-2160.544) (-2158.370) [-2155.533] * (-2153.850) [-2155.684] (-2154.356) (-2157.944) -- 0:01:12 729500 -- (-2157.397) (-2157.760) (-2154.576) [-2157.739] * (-2154.710) (-2158.174) (-2151.497) [-2152.933] -- 0:01:12 730000 -- (-2168.363) (-2160.757) [-2156.195] (-2166.379) * [-2153.408] (-2158.982) (-2148.659) (-2159.660) -- 0:01:12 Average standard deviation of split frequencies: 0.001936 730500 -- (-2157.616) [-2155.102] (-2160.448) (-2158.554) * (-2155.076) (-2153.554) [-2158.657] (-2161.974) -- 0:01:11 731000 -- (-2160.498) (-2160.422) [-2153.460] (-2161.661) * (-2159.546) (-2164.575) (-2166.507) [-2162.066] -- 0:01:11 731500 -- (-2157.300) (-2166.144) [-2160.486] (-2161.947) * [-2154.032] (-2161.125) (-2158.749) (-2156.570) -- 0:01:11 732000 -- (-2160.915) [-2158.271] (-2155.474) (-2160.796) * (-2152.981) (-2164.919) (-2157.113) [-2151.587] -- 0:01:11 732500 -- (-2156.543) (-2155.527) [-2157.686] (-2158.988) * (-2155.335) (-2158.227) (-2160.924) [-2156.961] -- 0:01:11 733000 -- (-2161.369) (-2157.666) [-2158.153] (-2154.288) * [-2154.782] (-2157.520) (-2154.624) (-2157.552) -- 0:01:11 733500 -- [-2154.366] (-2158.309) (-2161.572) (-2161.945) * [-2157.155] (-2154.018) (-2159.487) (-2152.835) -- 0:01:11 734000 -- (-2149.748) (-2154.188) [-2160.441] (-2158.234) * [-2159.726] (-2157.982) (-2160.855) (-2154.844) -- 0:01:11 734500 -- [-2152.398] (-2154.212) (-2153.046) (-2154.408) * (-2158.304) (-2159.054) (-2158.271) [-2155.120] -- 0:01:10 735000 -- (-2153.232) [-2157.538] (-2161.879) (-2161.220) * [-2161.266] (-2153.134) (-2155.097) (-2157.352) -- 0:01:10 Average standard deviation of split frequencies: 0.001921 735500 -- (-2152.479) [-2157.561] (-2158.826) (-2158.740) * (-2155.895) (-2158.983) [-2159.381] (-2160.734) -- 0:01:10 736000 -- (-2153.530) (-2157.781) (-2158.539) [-2162.957] * (-2162.662) (-2153.975) [-2152.877] (-2157.745) -- 0:01:10 736500 -- [-2158.364] (-2156.554) (-2163.620) (-2165.051) * (-2154.491) [-2155.914] (-2154.346) (-2158.817) -- 0:01:10 737000 -- (-2155.460) (-2158.729) (-2154.860) [-2155.531] * [-2156.335] (-2168.614) (-2162.152) (-2150.574) -- 0:01:10 737500 -- (-2157.520) [-2157.097] (-2163.536) (-2156.325) * (-2156.938) [-2153.127] (-2166.382) (-2157.434) -- 0:01:10 738000 -- (-2161.798) (-2156.680) [-2158.403] (-2158.230) * (-2157.367) [-2154.641] (-2160.891) (-2154.297) -- 0:01:09 738500 -- (-2158.505) (-2158.973) [-2156.564] (-2156.013) * (-2159.191) (-2155.273) [-2157.203] (-2162.929) -- 0:01:09 739000 -- (-2156.177) (-2162.145) (-2159.707) [-2153.126] * (-2161.125) [-2155.111] (-2156.272) (-2155.578) -- 0:01:09 739500 -- (-2155.746) [-2158.385] (-2155.743) (-2159.780) * (-2157.929) (-2155.863) (-2161.579) [-2154.294] -- 0:01:09 740000 -- (-2159.144) (-2157.694) [-2157.533] (-2150.641) * (-2166.853) [-2157.955] (-2155.416) (-2154.718) -- 0:01:09 Average standard deviation of split frequencies: 0.001909 740500 -- (-2157.762) [-2153.349] (-2156.415) (-2157.893) * (-2158.660) (-2156.112) (-2154.419) [-2159.878] -- 0:01:09 741000 -- (-2163.188) [-2156.063] (-2161.889) (-2160.275) * (-2161.951) (-2152.971) [-2156.382] (-2169.336) -- 0:01:09 741500 -- (-2154.994) (-2156.097) (-2158.981) [-2155.078] * (-2160.123) [-2159.648] (-2156.437) (-2164.371) -- 0:01:09 742000 -- (-2155.355) (-2152.612) [-2157.633] (-2151.016) * [-2152.000] (-2156.626) (-2155.787) (-2152.094) -- 0:01:08 742500 -- [-2155.784] (-2166.007) (-2160.255) (-2157.183) * (-2155.305) (-2153.124) [-2152.117] (-2158.924) -- 0:01:08 743000 -- (-2153.100) (-2162.521) [-2156.984] (-2157.493) * (-2154.475) [-2153.634] (-2157.109) (-2155.825) -- 0:01:08 743500 -- (-2155.672) [-2155.545] (-2154.478) (-2159.592) * (-2157.875) [-2156.397] (-2156.057) (-2158.128) -- 0:01:08 744000 -- (-2154.017) (-2161.418) [-2154.315] (-2159.632) * (-2155.116) (-2153.313) (-2154.578) [-2157.807] -- 0:01:08 744500 -- (-2158.909) (-2155.700) (-2158.900) [-2152.891] * (-2159.589) [-2157.832] (-2157.270) (-2159.716) -- 0:01:08 745000 -- (-2160.208) [-2155.555] (-2155.108) (-2159.092) * [-2158.667] (-2161.071) (-2163.667) (-2162.990) -- 0:01:08 Average standard deviation of split frequencies: 0.003476 745500 -- (-2156.327) [-2158.174] (-2158.204) (-2157.035) * (-2161.329) [-2160.199] (-2159.127) (-2157.008) -- 0:01:07 746000 -- (-2160.208) (-2150.692) [-2156.018] (-2157.919) * [-2152.581] (-2157.238) (-2153.162) (-2156.316) -- 0:01:07 746500 -- (-2161.798) [-2161.160] (-2165.676) (-2158.355) * (-2151.495) (-2156.501) [-2158.943] (-2158.454) -- 0:01:07 747000 -- (-2156.985) (-2162.182) (-2152.827) [-2160.812] * (-2161.147) (-2158.554) (-2155.814) [-2156.340] -- 0:01:07 747500 -- (-2163.566) [-2155.596] (-2158.627) (-2158.793) * [-2154.679] (-2159.634) (-2151.782) (-2155.951) -- 0:01:07 748000 -- [-2153.173] (-2155.833) (-2161.439) (-2156.268) * (-2156.715) [-2156.192] (-2161.297) (-2160.058) -- 0:01:07 748500 -- (-2161.133) [-2156.414] (-2159.394) (-2156.711) * (-2154.544) [-2163.526] (-2161.770) (-2157.315) -- 0:01:07 749000 -- (-2157.509) [-2156.861] (-2153.888) (-2161.396) * (-2153.269) (-2155.229) [-2154.012] (-2156.457) -- 0:01:07 749500 -- (-2158.959) (-2152.152) [-2158.749] (-2154.515) * (-2156.273) (-2152.966) [-2154.410] (-2158.012) -- 0:01:06 750000 -- (-2164.043) (-2158.838) (-2158.608) [-2155.405] * (-2155.852) (-2155.288) [-2160.097] (-2151.684) -- 0:01:06 Average standard deviation of split frequencies: 0.003140 750500 -- (-2155.859) [-2155.543] (-2153.723) (-2158.151) * (-2159.991) (-2150.679) [-2150.358] (-2161.217) -- 0:01:06 751000 -- (-2160.088) [-2151.083] (-2154.764) (-2155.411) * [-2156.550] (-2158.962) (-2151.492) (-2161.975) -- 0:01:06 751500 -- (-2157.844) (-2162.841) (-2153.321) [-2165.503] * (-2150.554) (-2162.213) [-2161.838] (-2153.421) -- 0:01:06 752000 -- [-2156.933] (-2158.977) (-2156.816) (-2155.463) * (-2152.931) (-2157.005) (-2163.141) [-2152.401] -- 0:01:06 752500 -- (-2151.011) (-2161.090) (-2160.192) [-2157.435] * (-2150.239) (-2152.609) [-2157.404] (-2162.523) -- 0:01:06 753000 -- (-2155.036) (-2152.294) [-2154.960] (-2158.498) * (-2157.604) [-2161.833] (-2157.130) (-2160.975) -- 0:01:05 753500 -- [-2152.786] (-2153.645) (-2155.337) (-2156.509) * [-2157.322] (-2152.807) (-2157.583) (-2157.559) -- 0:01:05 754000 -- (-2154.841) (-2159.170) [-2155.920] (-2152.123) * [-2155.945] (-2163.495) (-2156.950) (-2155.307) -- 0:01:05 754500 -- [-2153.628] (-2157.244) (-2158.681) (-2160.851) * [-2153.617] (-2161.377) (-2154.792) (-2156.380) -- 0:01:05 755000 -- [-2158.848] (-2159.556) (-2160.652) (-2165.253) * (-2156.333) (-2156.930) (-2157.707) [-2158.326] -- 0:01:05 Average standard deviation of split frequencies: 0.002806 755500 -- [-2154.771] (-2155.215) (-2158.010) (-2163.182) * (-2159.265) (-2156.084) (-2160.177) [-2157.922] -- 0:01:05 756000 -- (-2164.017) [-2153.935] (-2162.581) (-2160.897) * [-2153.893] (-2154.936) (-2161.040) (-2158.591) -- 0:01:05 756500 -- (-2160.389) [-2155.975] (-2158.937) (-2155.052) * [-2156.185] (-2159.034) (-2164.211) (-2155.740) -- 0:01:05 757000 -- (-2162.181) (-2157.780) [-2157.296] (-2161.886) * [-2152.969] (-2156.549) (-2158.828) (-2157.875) -- 0:01:04 757500 -- (-2157.683) (-2159.593) (-2157.863) [-2159.924] * [-2158.480] (-2164.515) (-2158.616) (-2160.434) -- 0:01:04 758000 -- (-2157.298) [-2157.050] (-2153.462) (-2167.352) * [-2154.352] (-2156.316) (-2157.518) (-2163.184) -- 0:01:04 758500 -- (-2161.471) (-2158.069) [-2158.543] (-2155.558) * (-2163.190) (-2152.928) (-2157.117) [-2153.357] -- 0:01:04 759000 -- [-2159.803] (-2162.428) (-2162.900) (-2151.830) * (-2160.870) [-2153.999] (-2154.144) (-2157.279) -- 0:01:04 759500 -- (-2158.221) [-2154.619] (-2160.110) (-2155.911) * (-2159.500) (-2161.636) [-2154.568] (-2157.333) -- 0:01:04 760000 -- (-2152.108) (-2155.385) (-2155.154) [-2153.517] * (-2164.096) (-2159.394) (-2155.640) [-2158.308] -- 0:01:04 Average standard deviation of split frequencies: 0.002324 760500 -- [-2151.529] (-2160.168) (-2156.196) (-2153.984) * [-2154.272] (-2167.226) (-2157.474) (-2152.196) -- 0:01:03 761000 -- (-2160.235) [-2156.893] (-2165.611) (-2155.777) * (-2156.447) [-2154.907] (-2157.483) (-2156.276) -- 0:01:03 761500 -- (-2161.548) (-2155.523) [-2158.001] (-2161.595) * (-2155.698) (-2154.559) (-2162.477) [-2153.838] -- 0:01:03 762000 -- [-2164.514] (-2164.039) (-2164.313) (-2158.452) * [-2153.813] (-2155.207) (-2164.568) (-2158.417) -- 0:01:03 762500 -- [-2156.485] (-2155.111) (-2162.145) (-2160.933) * (-2162.175) [-2153.908] (-2165.468) (-2160.875) -- 0:01:03 763000 -- (-2155.082) [-2155.164] (-2158.428) (-2166.188) * (-2157.604) (-2157.865) [-2167.386] (-2161.050) -- 0:01:03 763500 -- [-2153.901] (-2157.191) (-2155.310) (-2159.702) * [-2157.826] (-2159.710) (-2161.113) (-2155.934) -- 0:01:03 764000 -- (-2159.392) (-2155.060) [-2153.180] (-2157.476) * [-2156.382] (-2158.573) (-2157.703) (-2154.478) -- 0:01:03 764500 -- [-2163.010] (-2154.960) (-2157.907) (-2155.446) * [-2155.108] (-2160.691) (-2153.835) (-2154.541) -- 0:01:02 765000 -- (-2156.060) [-2155.618] (-2156.405) (-2157.328) * (-2166.786) (-2156.423) [-2153.783] (-2159.065) -- 0:01:02 Average standard deviation of split frequencies: 0.002000 765500 -- (-2154.806) (-2159.709) [-2160.459] (-2153.259) * (-2161.456) (-2155.990) [-2154.916] (-2160.319) -- 0:01:02 766000 -- (-2159.172) [-2153.812] (-2160.383) (-2156.214) * (-2160.897) (-2152.929) [-2154.435] (-2160.252) -- 0:01:02 766500 -- (-2161.720) (-2154.545) (-2156.922) [-2154.350] * (-2163.269) (-2159.804) (-2157.853) [-2160.988] -- 0:01:02 767000 -- (-2158.783) [-2156.147] (-2159.942) (-2161.394) * (-2155.700) [-2154.351] (-2157.877) (-2161.139) -- 0:01:02 767500 -- (-2156.155) [-2153.949] (-2159.297) (-2158.127) * (-2166.126) [-2154.156] (-2157.367) (-2158.000) -- 0:01:02 768000 -- (-2157.787) [-2153.210] (-2161.618) (-2162.645) * [-2154.827] (-2156.126) (-2165.560) (-2164.570) -- 0:01:01 768500 -- (-2155.089) [-2150.745] (-2156.609) (-2153.606) * (-2155.474) (-2160.567) [-2153.299] (-2160.167) -- 0:01:01 769000 -- [-2156.500] (-2157.547) (-2155.000) (-2168.024) * (-2154.974) [-2161.732] (-2157.442) (-2160.216) -- 0:01:01 769500 -- (-2156.407) [-2159.715] (-2155.142) (-2156.999) * (-2161.635) [-2157.220] (-2153.437) (-2150.406) -- 0:01:01 770000 -- (-2161.552) [-2154.707] (-2164.199) (-2156.987) * (-2166.399) (-2160.862) [-2158.579] (-2159.425) -- 0:01:01 Average standard deviation of split frequencies: 0.001988 770500 -- (-2159.808) [-2153.400] (-2165.054) (-2156.741) * (-2167.710) (-2155.029) (-2164.058) [-2158.625] -- 0:01:01 771000 -- [-2152.117] (-2152.186) (-2157.674) (-2152.428) * (-2158.092) (-2157.059) (-2160.687) [-2158.456] -- 0:01:01 771500 -- (-2165.490) (-2154.990) (-2160.023) [-2156.039] * (-2158.185) [-2154.062] (-2157.338) (-2155.738) -- 0:01:01 772000 -- (-2161.901) (-2155.163) [-2156.471] (-2164.988) * (-2155.929) [-2152.930] (-2160.185) (-2155.201) -- 0:01:00 772500 -- (-2162.827) (-2153.129) (-2161.514) [-2156.613] * (-2156.036) (-2157.943) (-2157.201) [-2154.395] -- 0:01:00 773000 -- (-2156.144) (-2161.362) (-2157.595) [-2156.328] * (-2160.852) (-2151.920) (-2156.091) [-2159.026] -- 0:01:00 773500 -- (-2160.933) [-2155.156] (-2159.411) (-2157.629) * (-2158.377) (-2160.083) (-2157.388) [-2151.847] -- 0:01:00 774000 -- [-2159.624] (-2155.727) (-2157.406) (-2157.023) * [-2155.694] (-2164.376) (-2157.209) (-2154.597) -- 0:01:00 774500 -- [-2157.046] (-2160.700) (-2159.656) (-2158.158) * (-2156.105) [-2156.115] (-2158.781) (-2153.757) -- 0:01:00 775000 -- (-2158.353) (-2165.660) (-2160.047) [-2153.828] * (-2160.156) [-2158.708] (-2162.707) (-2157.548) -- 0:01:00 Average standard deviation of split frequencies: 0.001974 775500 -- (-2163.817) [-2161.285] (-2167.446) (-2155.314) * (-2156.545) (-2159.544) (-2156.167) [-2162.025] -- 0:00:59 776000 -- [-2157.617] (-2153.974) (-2161.246) (-2157.213) * (-2155.412) [-2151.585] (-2158.964) (-2162.805) -- 0:00:59 776500 -- (-2161.132) (-2152.926) [-2153.956] (-2164.834) * (-2156.992) (-2151.035) (-2157.972) [-2159.086] -- 0:00:59 777000 -- (-2163.359) (-2155.973) [-2150.129] (-2157.867) * (-2158.575) (-2156.378) [-2157.953] (-2157.254) -- 0:00:59 777500 -- (-2156.234) (-2159.803) [-2158.030] (-2156.887) * (-2161.548) [-2154.373] (-2165.289) (-2152.025) -- 0:00:59 778000 -- (-2166.540) [-2160.113] (-2160.556) (-2158.154) * (-2165.160) (-2160.088) [-2158.648] (-2153.717) -- 0:00:59 778500 -- (-2160.189) (-2154.022) (-2164.267) [-2156.676] * (-2159.354) [-2155.639] (-2152.534) (-2162.324) -- 0:00:59 779000 -- (-2153.470) [-2156.154] (-2153.786) (-2159.195) * (-2161.079) (-2159.233) (-2156.921) [-2157.481] -- 0:00:59 779500 -- [-2155.855] (-2155.195) (-2156.887) (-2156.773) * (-2161.092) (-2157.841) [-2149.787] (-2160.268) -- 0:00:58 780000 -- [-2153.900] (-2157.634) (-2159.526) (-2156.948) * (-2160.858) (-2153.235) [-2151.908] (-2163.842) -- 0:00:58 Average standard deviation of split frequencies: 0.002113 780500 -- (-2152.934) [-2153.837] (-2154.638) (-2162.092) * (-2160.316) (-2155.831) (-2156.896) [-2157.707] -- 0:00:58 781000 -- (-2154.818) (-2158.132) [-2151.695] (-2160.264) * [-2156.626] (-2152.397) (-2160.359) (-2163.315) -- 0:00:58 781500 -- (-2156.914) (-2157.768) (-2159.667) [-2157.235] * [-2159.402] (-2153.264) (-2156.720) (-2161.683) -- 0:00:58 782000 -- (-2156.103) (-2154.393) [-2153.680] (-2163.312) * (-2159.483) [-2156.407] (-2167.696) (-2164.606) -- 0:00:58 782500 -- [-2154.141] (-2158.915) (-2156.579) (-2156.060) * [-2154.220] (-2167.914) (-2161.104) (-2155.243) -- 0:00:58 783000 -- (-2162.142) [-2152.944] (-2160.613) (-2158.832) * (-2157.750) (-2162.100) (-2162.888) [-2159.714] -- 0:00:57 783500 -- [-2162.566] (-2154.823) (-2157.341) (-2158.895) * [-2156.597] (-2155.876) (-2160.739) (-2153.870) -- 0:00:57 784000 -- (-2158.108) (-2152.156) [-2164.626] (-2159.706) * (-2166.583) (-2154.247) (-2154.118) [-2153.726] -- 0:00:57 784500 -- (-2158.038) [-2151.727] (-2160.445) (-2161.057) * [-2157.903] (-2158.757) (-2156.503) (-2166.153) -- 0:00:57 785000 -- (-2167.373) (-2157.062) (-2158.479) [-2158.766] * (-2159.054) (-2155.618) [-2156.260] (-2154.109) -- 0:00:57 Average standard deviation of split frequencies: 0.002249 785500 -- (-2153.344) [-2154.095] (-2166.328) (-2157.380) * [-2155.827] (-2158.532) (-2158.525) (-2156.110) -- 0:00:57 786000 -- [-2157.327] (-2160.434) (-2159.814) (-2158.661) * (-2160.170) [-2155.580] (-2158.994) (-2158.654) -- 0:00:57 786500 -- (-2156.043) [-2155.992] (-2156.901) (-2153.363) * (-2160.129) (-2161.699) (-2157.500) [-2153.339] -- 0:00:57 787000 -- (-2160.914) [-2158.338] (-2158.086) (-2156.317) * (-2157.253) (-2153.669) [-2156.955] (-2154.937) -- 0:00:56 787500 -- (-2155.786) [-2160.914] (-2155.610) (-2158.890) * (-2159.480) (-2156.598) [-2150.998] (-2156.479) -- 0:00:56 788000 -- (-2156.310) (-2154.326) (-2155.281) [-2151.365] * (-2155.551) (-2157.941) [-2153.889] (-2160.510) -- 0:00:56 788500 -- (-2156.799) (-2162.410) (-2159.692) [-2154.472] * (-2156.617) (-2163.521) [-2157.544] (-2160.150) -- 0:00:56 789000 -- (-2154.332) (-2160.894) [-2161.627] (-2156.321) * [-2157.268] (-2158.556) (-2157.285) (-2157.514) -- 0:00:56 789500 -- (-2157.308) [-2157.330] (-2154.879) (-2156.727) * (-2163.374) (-2159.200) (-2156.314) [-2161.016] -- 0:00:56 790000 -- (-2156.803) (-2157.833) (-2158.404) [-2155.083] * [-2160.773] (-2153.379) (-2168.708) (-2164.226) -- 0:00:56 Average standard deviation of split frequencies: 0.002236 790500 -- (-2158.913) (-2158.128) (-2159.107) [-2162.037] * (-2151.907) (-2152.641) (-2161.199) [-2163.679] -- 0:00:55 791000 -- (-2156.231) [-2158.304] (-2157.138) (-2163.463) * (-2158.747) [-2153.592] (-2160.641) (-2161.428) -- 0:00:55 791500 -- [-2155.846] (-2155.988) (-2159.097) (-2162.222) * (-2153.344) (-2157.637) (-2157.876) [-2158.000] -- 0:00:55 792000 -- (-2163.621) [-2159.105] (-2158.364) (-2165.477) * (-2164.759) (-2159.269) [-2151.482] (-2157.470) -- 0:00:55 792500 -- [-2155.067] (-2155.081) (-2158.354) (-2156.723) * [-2157.528] (-2162.044) (-2161.883) (-2152.321) -- 0:00:55 793000 -- (-2155.172) [-2157.343] (-2154.147) (-2156.296) * (-2159.577) (-2155.212) [-2153.975] (-2157.081) -- 0:00:55 793500 -- (-2156.659) (-2153.902) (-2151.359) [-2154.373] * (-2157.190) (-2155.076) [-2156.622] (-2159.606) -- 0:00:55 794000 -- (-2158.910) (-2155.749) [-2155.175] (-2155.778) * (-2156.231) (-2152.703) (-2152.177) [-2150.936] -- 0:00:55 794500 -- (-2158.728) (-2155.597) [-2154.112] (-2163.878) * (-2153.041) (-2163.101) [-2152.575] (-2155.220) -- 0:00:54 795000 -- (-2159.444) [-2153.546] (-2153.055) (-2156.803) * (-2155.431) [-2156.225] (-2159.672) (-2157.598) -- 0:00:54 Average standard deviation of split frequencies: 0.002221 795500 -- (-2162.008) (-2150.528) (-2155.826) [-2154.956] * (-2155.691) (-2159.310) (-2162.417) [-2154.604] -- 0:00:54 796000 -- (-2161.561) (-2159.590) (-2163.645) [-2161.834] * (-2155.570) [-2161.851] (-2157.597) (-2159.738) -- 0:00:54 796500 -- (-2157.542) (-2153.816) (-2161.317) [-2157.354] * (-2156.054) [-2151.978] (-2158.082) (-2153.264) -- 0:00:54 797000 -- [-2155.993] (-2159.073) (-2155.762) (-2159.306) * (-2154.669) (-2158.207) (-2156.513) [-2154.751] -- 0:00:54 797500 -- (-2154.426) (-2152.660) [-2156.174] (-2160.206) * (-2156.194) (-2161.272) (-2154.437) [-2152.328] -- 0:00:54 798000 -- (-2154.972) (-2158.195) [-2155.219] (-2155.102) * [-2161.083] (-2157.763) (-2156.202) (-2158.662) -- 0:00:53 798500 -- (-2156.977) (-2155.796) [-2152.826] (-2154.701) * (-2157.476) (-2153.435) (-2154.198) [-2157.113] -- 0:00:53 799000 -- (-2153.787) [-2158.376] (-2157.901) (-2155.850) * (-2151.755) (-2151.427) [-2162.250] (-2175.532) -- 0:00:53 799500 -- (-2164.350) (-2153.547) [-2160.189] (-2158.919) * [-2159.730] (-2153.853) (-2152.371) (-2163.184) -- 0:00:53 800000 -- (-2156.353) [-2155.147] (-2159.424) (-2154.309) * [-2154.237] (-2153.281) (-2154.998) (-2158.291) -- 0:00:53 Average standard deviation of split frequencies: 0.002502 800500 -- [-2157.408] (-2157.430) (-2164.406) (-2155.352) * (-2156.381) [-2158.247] (-2160.720) (-2157.270) -- 0:00:53 801000 -- (-2160.517) [-2159.384] (-2165.222) (-2157.008) * (-2158.821) (-2162.912) (-2160.729) [-2157.931] -- 0:00:53 801500 -- (-2160.050) (-2160.693) (-2164.346) [-2153.393] * [-2160.364] (-2158.686) (-2161.434) (-2162.191) -- 0:00:52 802000 -- (-2165.765) (-2159.979) (-2164.370) [-2159.111] * (-2163.466) [-2158.557] (-2156.018) (-2157.942) -- 0:00:52 802500 -- (-2166.240) (-2167.050) (-2157.912) [-2152.083] * (-2155.379) [-2162.263] (-2154.411) (-2152.767) -- 0:00:52 803000 -- (-2159.963) (-2154.940) [-2154.135] (-2156.457) * (-2155.356) (-2158.337) [-2158.072] (-2154.476) -- 0:00:52 803500 -- (-2153.922) (-2155.869) [-2151.164] (-2157.323) * [-2156.209] (-2157.891) (-2158.590) (-2156.675) -- 0:00:52 804000 -- (-2153.828) [-2154.886] (-2153.709) (-2158.178) * (-2155.105) (-2163.913) [-2155.832] (-2158.117) -- 0:00:52 804500 -- [-2156.750] (-2154.759) (-2156.827) (-2154.310) * (-2154.265) [-2153.742] (-2153.542) (-2152.340) -- 0:00:52 805000 -- (-2153.077) (-2154.402) (-2155.985) [-2153.165] * (-2155.149) (-2155.515) [-2153.884] (-2157.035) -- 0:00:52 Average standard deviation of split frequencies: 0.002339 805500 -- [-2152.043] (-2152.471) (-2154.759) (-2158.058) * (-2158.464) [-2153.328] (-2153.162) (-2152.912) -- 0:00:51 806000 -- (-2159.437) [-2151.972] (-2151.162) (-2154.370) * (-2157.328) (-2157.364) (-2156.101) [-2156.516] -- 0:00:51 806500 -- (-2154.873) [-2154.456] (-2157.040) (-2154.652) * (-2163.724) [-2152.324] (-2161.915) (-2162.079) -- 0:00:51 807000 -- (-2159.921) (-2155.131) [-2159.272] (-2155.604) * [-2158.257] (-2160.594) (-2163.887) (-2168.122) -- 0:00:51 807500 -- (-2161.745) [-2158.890] (-2155.911) (-2157.372) * (-2153.441) [-2155.398] (-2167.389) (-2156.992) -- 0:00:51 808000 -- (-2159.078) (-2157.136) [-2154.708] (-2166.934) * (-2156.318) (-2162.957) [-2158.074] (-2154.505) -- 0:00:51 808500 -- (-2161.072) (-2155.751) [-2156.641] (-2159.476) * [-2156.649] (-2153.422) (-2154.073) (-2154.893) -- 0:00:51 809000 -- (-2163.250) [-2157.176] (-2155.416) (-2159.515) * (-2153.939) [-2153.796] (-2158.527) (-2159.257) -- 0:00:50 809500 -- (-2160.173) [-2152.521] (-2162.724) (-2163.314) * [-2155.616] (-2161.302) (-2154.927) (-2161.733) -- 0:00:50 810000 -- (-2164.017) [-2155.454] (-2160.164) (-2156.225) * (-2156.373) [-2153.585] (-2158.510) (-2163.081) -- 0:00:50 Average standard deviation of split frequencies: 0.002326 810500 -- [-2157.665] (-2154.791) (-2157.721) (-2159.865) * (-2156.141) (-2160.277) [-2159.432] (-2162.067) -- 0:00:50 811000 -- (-2155.023) (-2156.673) (-2155.522) [-2159.288] * [-2156.628] (-2162.204) (-2158.412) (-2159.009) -- 0:00:50 811500 -- [-2156.967] (-2157.002) (-2159.088) (-2152.730) * (-2159.173) [-2158.698] (-2159.608) (-2153.660) -- 0:00:50 812000 -- (-2163.613) [-2156.764] (-2154.113) (-2155.763) * (-2161.279) [-2155.226] (-2154.156) (-2169.193) -- 0:00:50 812500 -- (-2160.246) (-2153.227) [-2154.600] (-2156.549) * (-2163.066) (-2158.323) (-2159.579) [-2154.985] -- 0:00:50 813000 -- [-2151.156] (-2167.302) (-2161.104) (-2153.860) * (-2155.485) (-2158.864) (-2156.127) [-2154.866] -- 0:00:49 813500 -- (-2159.126) (-2151.274) [-2153.154] (-2161.621) * (-2156.375) (-2155.869) [-2157.976] (-2156.233) -- 0:00:49 814000 -- (-2159.524) (-2161.285) [-2154.929] (-2156.293) * (-2154.246) (-2154.054) (-2155.444) [-2156.137] -- 0:00:49 814500 -- (-2159.583) (-2164.712) (-2158.983) [-2160.648] * (-2161.887) (-2150.314) (-2168.127) [-2150.077] -- 0:00:49 815000 -- (-2158.304) (-2156.108) [-2155.608] (-2159.745) * (-2165.758) [-2155.633] (-2161.844) (-2157.037) -- 0:00:49 Average standard deviation of split frequencies: 0.002889 815500 -- (-2154.501) [-2160.647] (-2155.318) (-2157.957) * (-2158.931) (-2155.121) (-2156.430) [-2155.948] -- 0:00:49 816000 -- (-2160.636) [-2156.282] (-2160.530) (-2161.585) * [-2158.101] (-2156.422) (-2157.829) (-2150.860) -- 0:00:49 816500 -- (-2158.160) [-2159.476] (-2162.766) (-2164.567) * (-2166.225) (-2155.812) (-2163.422) [-2155.304] -- 0:00:48 817000 -- (-2153.347) [-2158.463] (-2156.665) (-2159.674) * (-2170.741) (-2155.756) (-2156.990) [-2153.380] -- 0:00:48 817500 -- (-2161.920) (-2161.603) [-2154.906] (-2153.296) * (-2166.852) (-2159.762) (-2153.430) [-2158.181] -- 0:00:48 818000 -- [-2156.010] (-2162.336) (-2155.530) (-2160.184) * (-2157.021) (-2163.040) [-2158.405] (-2161.762) -- 0:00:48 818500 -- [-2158.478] (-2162.037) (-2157.155) (-2161.615) * (-2157.447) [-2164.527] (-2162.393) (-2158.809) -- 0:00:48 819000 -- (-2157.985) (-2155.113) [-2156.497] (-2161.299) * [-2158.224] (-2152.847) (-2159.922) (-2174.820) -- 0:00:48 819500 -- [-2158.971] (-2151.717) (-2159.394) (-2155.116) * [-2158.823] (-2166.606) (-2158.385) (-2167.871) -- 0:00:48 820000 -- (-2159.190) (-2159.656) [-2156.153] (-2158.811) * (-2162.371) (-2153.855) [-2158.897] (-2155.299) -- 0:00:48 Average standard deviation of split frequencies: 0.004595 820500 -- [-2152.786] (-2159.432) (-2157.957) (-2160.918) * (-2160.606) (-2153.924) (-2167.518) [-2154.959] -- 0:00:47 821000 -- [-2151.357] (-2156.675) (-2155.817) (-2154.617) * (-2161.722) (-2157.422) (-2157.950) [-2153.928] -- 0:00:47 821500 -- [-2154.031] (-2153.531) (-2162.676) (-2151.140) * (-2165.673) (-2157.121) (-2157.387) [-2162.359] -- 0:00:47 822000 -- (-2155.544) [-2154.213] (-2157.911) (-2161.700) * (-2161.426) [-2151.427] (-2162.189) (-2158.024) -- 0:00:47 822500 -- [-2154.836] (-2162.222) (-2157.905) (-2156.565) * (-2166.846) [-2162.741] (-2159.915) (-2158.196) -- 0:00:47 823000 -- (-2159.828) [-2155.189] (-2157.972) (-2158.096) * (-2158.773) (-2152.058) [-2151.540] (-2155.262) -- 0:00:47 823500 -- (-2160.391) (-2165.295) [-2154.810] (-2158.798) * (-2164.059) (-2154.981) (-2163.445) [-2161.893] -- 0:00:47 824000 -- (-2158.612) (-2157.785) [-2156.266] (-2151.776) * [-2163.876] (-2161.406) (-2157.748) (-2164.410) -- 0:00:46 824500 -- (-2162.418) (-2155.354) (-2160.302) [-2151.915] * (-2157.961) (-2158.087) [-2157.091] (-2161.269) -- 0:00:46 825000 -- (-2159.694) (-2153.623) [-2155.489] (-2156.405) * [-2155.113] (-2161.784) (-2160.205) (-2161.748) -- 0:00:46 Average standard deviation of split frequencies: 0.004566 825500 -- [-2158.462] (-2158.175) (-2171.043) (-2158.674) * [-2152.263] (-2159.232) (-2157.043) (-2162.343) -- 0:00:46 826000 -- [-2156.834] (-2156.802) (-2153.856) (-2156.822) * (-2160.284) (-2160.357) (-2156.714) [-2151.881] -- 0:00:46 826500 -- (-2160.301) (-2160.265) (-2156.617) [-2158.985] * (-2157.231) (-2160.277) [-2151.359] (-2152.197) -- 0:00:46 827000 -- [-2159.374] (-2158.430) (-2157.461) (-2155.733) * [-2159.157] (-2163.703) (-2155.066) (-2157.601) -- 0:00:46 827500 -- (-2157.634) (-2157.072) (-2161.506) [-2152.927] * (-2164.021) (-2167.477) (-2158.014) [-2158.903] -- 0:00:46 828000 -- [-2160.446] (-2155.310) (-2157.203) (-2165.992) * [-2152.395] (-2160.637) (-2157.439) (-2154.908) -- 0:00:45 828500 -- (-2165.262) (-2154.493) [-2153.394] (-2161.967) * (-2153.605) (-2156.452) (-2159.287) [-2153.157] -- 0:00:45 829000 -- (-2160.093) (-2156.933) [-2159.766] (-2158.048) * (-2157.905) (-2156.150) [-2155.661] (-2158.680) -- 0:00:45 829500 -- [-2156.002] (-2159.667) (-2158.181) (-2161.544) * (-2156.282) (-2160.531) (-2159.886) [-2155.926] -- 0:00:45 830000 -- (-2153.063) [-2160.574] (-2162.208) (-2154.406) * [-2151.718] (-2159.985) (-2163.654) (-2155.933) -- 0:00:45 Average standard deviation of split frequencies: 0.003973 830500 -- (-2153.414) [-2150.315] (-2162.825) (-2157.529) * (-2161.534) (-2160.420) [-2157.754] (-2157.118) -- 0:00:45 831000 -- (-2158.778) [-2153.855] (-2160.419) (-2156.442) * [-2152.600] (-2162.793) (-2157.299) (-2160.260) -- 0:00:44 831500 -- [-2156.769] (-2158.662) (-2167.327) (-2160.198) * (-2150.105) [-2156.240] (-2165.405) (-2159.248) -- 0:00:44 832000 -- (-2159.839) [-2155.836] (-2165.219) (-2154.879) * (-2156.314) [-2161.327] (-2159.149) (-2158.889) -- 0:00:44 832500 -- (-2160.036) (-2155.355) [-2159.262] (-2154.861) * (-2159.097) [-2159.183] (-2156.702) (-2156.408) -- 0:00:44 833000 -- [-2151.238] (-2158.241) (-2161.454) (-2156.388) * (-2160.571) (-2157.042) [-2155.791] (-2158.882) -- 0:00:44 833500 -- (-2160.771) [-2159.682] (-2158.267) (-2157.329) * (-2153.934) (-2154.099) [-2155.726] (-2159.941) -- 0:00:44 834000 -- (-2158.985) [-2158.310] (-2153.895) (-2162.009) * (-2162.244) (-2154.878) (-2159.009) [-2157.274] -- 0:00:44 834500 -- (-2155.630) (-2163.017) [-2156.088] (-2156.848) * (-2154.854) (-2151.197) [-2154.733] (-2162.560) -- 0:00:44 835000 -- (-2158.084) (-2161.785) [-2153.334] (-2156.490) * [-2156.737] (-2153.214) (-2159.253) (-2162.628) -- 0:00:44 Average standard deviation of split frequencies: 0.003665 835500 -- (-2155.596) [-2161.891] (-2154.724) (-2158.306) * (-2156.978) (-2157.754) (-2159.082) [-2155.423] -- 0:00:43 836000 -- [-2157.109] (-2157.769) (-2161.499) (-2157.667) * (-2156.698) (-2158.262) (-2155.262) [-2153.762] -- 0:00:43 836500 -- (-2153.526) [-2155.680] (-2157.164) (-2162.349) * (-2151.531) (-2159.081) (-2160.186) [-2152.472] -- 0:00:43 837000 -- [-2150.661] (-2157.413) (-2160.607) (-2156.055) * (-2159.998) [-2157.968] (-2159.775) (-2153.605) -- 0:00:43 837500 -- (-2156.751) (-2157.542) (-2162.703) [-2160.472] * (-2163.018) (-2157.124) [-2159.780] (-2155.185) -- 0:00:43 838000 -- [-2158.359] (-2164.004) (-2162.908) (-2156.246) * (-2159.946) [-2162.040] (-2155.349) (-2155.415) -- 0:00:43 838500 -- (-2158.282) (-2157.513) (-2158.229) [-2158.618] * (-2162.606) (-2162.487) (-2162.471) [-2156.129] -- 0:00:42 839000 -- (-2157.104) (-2160.581) [-2157.298] (-2162.625) * [-2160.414] (-2158.969) (-2155.095) (-2156.077) -- 0:00:42 839500 -- [-2154.822] (-2165.513) (-2157.217) (-2157.166) * (-2161.998) [-2158.670] (-2161.394) (-2161.110) -- 0:00:42 840000 -- (-2154.436) [-2156.561] (-2159.268) (-2154.911) * (-2157.974) [-2153.870] (-2162.550) (-2155.467) -- 0:00:42 Average standard deviation of split frequencies: 0.003365 840500 -- (-2161.905) [-2156.158] (-2155.487) (-2156.743) * (-2156.558) (-2164.726) (-2157.736) [-2154.258] -- 0:00:42 841000 -- (-2154.444) (-2162.531) [-2167.157] (-2156.704) * (-2154.941) [-2153.770] (-2161.694) (-2158.018) -- 0:00:42 841500 -- [-2157.242] (-2156.862) (-2157.468) (-2155.913) * [-2157.703] (-2161.353) (-2164.249) (-2154.323) -- 0:00:42 842000 -- [-2163.350] (-2157.882) (-2161.396) (-2156.095) * (-2154.420) [-2156.855] (-2178.111) (-2156.408) -- 0:00:42 842500 -- (-2150.907) (-2161.459) (-2156.716) [-2155.233] * [-2154.477] (-2167.019) (-2163.070) (-2158.265) -- 0:00:42 843000 -- (-2153.593) (-2153.574) (-2157.408) [-2162.218] * (-2156.728) [-2151.217] (-2161.348) (-2160.292) -- 0:00:41 843500 -- [-2154.808] (-2155.801) (-2162.763) (-2159.815) * [-2153.670] (-2157.145) (-2159.633) (-2157.251) -- 0:00:41 844000 -- [-2158.277] (-2158.506) (-2156.902) (-2165.345) * [-2158.641] (-2155.629) (-2156.614) (-2160.639) -- 0:00:41 844500 -- (-2158.763) (-2153.601) [-2156.439] (-2162.094) * (-2165.085) (-2156.884) [-2152.912] (-2161.414) -- 0:00:41 845000 -- (-2162.184) [-2157.894] (-2156.740) (-2173.556) * (-2152.812) (-2154.304) (-2154.297) [-2161.230] -- 0:00:41 Average standard deviation of split frequencies: 0.003761 845500 -- [-2157.014] (-2161.701) (-2154.037) (-2153.285) * (-2157.187) [-2151.898] (-2160.467) (-2161.872) -- 0:00:41 846000 -- (-2153.671) (-2158.548) (-2158.299) [-2154.341] * (-2154.260) [-2151.619] (-2157.766) (-2157.822) -- 0:00:40 846500 -- [-2154.261] (-2154.721) (-2167.205) (-2151.780) * [-2153.351] (-2159.485) (-2155.958) (-2159.118) -- 0:00:40 847000 -- (-2154.580) (-2158.694) [-2158.019] (-2156.290) * (-2153.815) (-2155.605) [-2155.976] (-2158.681) -- 0:00:40 847500 -- (-2164.419) (-2153.998) [-2155.877] (-2156.367) * (-2155.157) [-2153.797] (-2159.173) (-2156.394) -- 0:00:40 848000 -- [-2162.194] (-2158.847) (-2162.214) (-2157.119) * (-2160.416) (-2150.849) [-2151.677] (-2161.848) -- 0:00:40 848500 -- (-2155.931) [-2153.634] (-2155.877) (-2152.799) * [-2156.777] (-2160.472) (-2155.682) (-2159.069) -- 0:00:40 849000 -- (-2161.321) (-2161.364) (-2158.535) [-2156.297] * (-2157.481) (-2164.211) (-2159.300) [-2154.644] -- 0:00:40 849500 -- (-2160.320) (-2154.633) [-2158.619] (-2157.786) * (-2154.367) (-2158.910) [-2153.885] (-2160.433) -- 0:00:40 850000 -- [-2159.193] (-2157.784) (-2157.552) (-2153.817) * [-2152.084] (-2162.469) (-2154.422) (-2151.738) -- 0:00:39 Average standard deviation of split frequencies: 0.004572 850500 -- [-2153.860] (-2152.770) (-2155.913) (-2160.312) * (-2152.966) [-2154.915] (-2153.926) (-2160.458) -- 0:00:39 851000 -- [-2153.195] (-2160.444) (-2156.129) (-2158.875) * (-2153.937) (-2155.967) (-2154.497) [-2159.989] -- 0:00:39 851500 -- (-2153.812) (-2159.748) (-2156.829) [-2155.926] * (-2154.882) [-2153.611] (-2158.451) (-2158.145) -- 0:00:39 852000 -- (-2163.114) [-2155.048] (-2166.376) (-2163.091) * [-2156.613] (-2159.061) (-2155.133) (-2158.854) -- 0:00:39 852500 -- (-2152.564) (-2157.275) [-2162.060] (-2162.199) * (-2161.879) [-2156.275] (-2156.087) (-2158.528) -- 0:00:39 853000 -- [-2156.118] (-2159.543) (-2156.862) (-2160.908) * (-2161.747) [-2158.022] (-2162.304) (-2159.872) -- 0:00:39 853500 -- (-2157.211) (-2156.657) [-2157.220] (-2168.277) * (-2163.819) (-2158.311) (-2156.137) [-2157.150] -- 0:00:38 854000 -- [-2157.315] (-2154.597) (-2153.599) (-2161.906) * (-2159.294) [-2159.352] (-2160.138) (-2154.023) -- 0:00:38 854500 -- (-2164.938) (-2153.397) [-2157.536] (-2158.502) * (-2158.515) (-2158.177) (-2161.209) [-2158.062] -- 0:00:38 855000 -- (-2158.425) [-2155.188] (-2157.134) (-2154.691) * (-2159.950) [-2160.637] (-2157.058) (-2159.102) -- 0:00:38 Average standard deviation of split frequencies: 0.003580 855500 -- [-2159.958] (-2153.111) (-2159.783) (-2156.056) * (-2159.354) (-2157.762) (-2153.819) [-2155.723] -- 0:00:38 856000 -- (-2156.633) [-2151.253] (-2156.610) (-2157.495) * (-2163.651) (-2157.452) (-2154.109) [-2161.393] -- 0:00:38 856500 -- (-2164.371) (-2154.658) (-2153.696) [-2155.400] * (-2159.135) (-2156.759) [-2157.746] (-2155.944) -- 0:00:38 857000 -- [-2164.530] (-2160.108) (-2154.338) (-2160.641) * (-2163.556) [-2155.311] (-2156.031) (-2155.169) -- 0:00:38 857500 -- [-2159.499] (-2161.654) (-2157.722) (-2153.397) * (-2160.365) (-2166.499) (-2162.247) [-2158.499] -- 0:00:37 858000 -- (-2156.592) (-2159.098) [-2156.383] (-2155.020) * (-2159.692) (-2159.032) [-2157.108] (-2155.341) -- 0:00:37 858500 -- (-2158.426) [-2151.174] (-2165.729) (-2165.332) * [-2149.023] (-2161.187) (-2156.650) (-2162.244) -- 0:00:37 859000 -- (-2154.961) (-2156.388) (-2161.950) [-2161.405] * [-2154.418] (-2157.299) (-2159.474) (-2162.902) -- 0:00:37 859500 -- (-2158.252) [-2152.991] (-2165.623) (-2157.501) * (-2163.775) [-2154.171] (-2156.930) (-2155.273) -- 0:00:37 860000 -- (-2160.735) (-2152.475) [-2162.005] (-2159.041) * [-2156.169] (-2155.813) (-2158.793) (-2159.245) -- 0:00:37 Average standard deviation of split frequencies: 0.003149 860500 -- (-2160.455) [-2158.962] (-2155.316) (-2158.977) * [-2154.161] (-2156.478) (-2160.614) (-2167.259) -- 0:00:37 861000 -- (-2163.228) (-2155.307) [-2151.591] (-2163.166) * (-2154.366) [-2156.137] (-2153.911) (-2160.618) -- 0:00:36 861500 -- (-2162.121) (-2163.454) (-2153.205) [-2156.880] * (-2151.414) (-2156.821) [-2155.952] (-2158.440) -- 0:00:36 862000 -- [-2164.413] (-2154.335) (-2163.929) (-2157.569) * (-2157.897) (-2152.982) (-2164.493) [-2156.536] -- 0:00:36 862500 -- (-2157.208) (-2157.227) (-2154.533) [-2155.148] * (-2169.625) [-2153.896] (-2156.629) (-2161.664) -- 0:00:36 863000 -- (-2166.345) [-2159.659] (-2153.629) (-2160.686) * (-2163.394) (-2156.013) [-2154.621] (-2157.250) -- 0:00:36 863500 -- (-2155.745) (-2152.681) [-2157.144] (-2155.043) * (-2162.282) (-2159.447) [-2160.875] (-2158.572) -- 0:00:36 864000 -- (-2156.631) (-2160.492) (-2167.395) [-2153.257] * (-2174.262) [-2159.543] (-2156.312) (-2156.985) -- 0:00:36 864500 -- (-2158.905) (-2159.645) (-2156.091) [-2156.350] * [-2162.097] (-2161.766) (-2159.944) (-2155.203) -- 0:00:36 865000 -- (-2162.576) (-2152.267) (-2155.061) [-2154.166] * [-2153.132] (-2158.978) (-2166.574) (-2161.804) -- 0:00:35 Average standard deviation of split frequencies: 0.002450 865500 -- [-2150.676] (-2160.532) (-2153.638) (-2158.121) * [-2159.598] (-2158.461) (-2156.617) (-2156.718) -- 0:00:35 866000 -- (-2154.090) (-2158.733) (-2154.577) [-2159.065] * (-2157.137) (-2158.992) (-2150.351) [-2156.467] -- 0:00:35 866500 -- (-2157.049) (-2156.699) (-2153.683) [-2151.991] * [-2155.667] (-2156.435) (-2158.348) (-2155.950) -- 0:00:35 867000 -- (-2164.180) [-2155.535] (-2160.629) (-2150.153) * [-2155.835] (-2156.075) (-2156.543) (-2160.354) -- 0:00:35 867500 -- (-2160.911) [-2155.025] (-2157.894) (-2157.959) * (-2157.626) [-2156.958] (-2153.361) (-2158.843) -- 0:00:35 868000 -- (-2156.163) [-2160.228] (-2169.668) (-2157.572) * (-2154.128) (-2156.879) (-2155.689) [-2156.439] -- 0:00:35 868500 -- [-2158.149] (-2153.492) (-2170.927) (-2162.925) * (-2155.959) [-2153.245] (-2165.710) (-2158.553) -- 0:00:34 869000 -- (-2158.469) (-2155.652) [-2158.329] (-2161.186) * (-2161.310) (-2166.685) [-2157.951] (-2154.870) -- 0:00:34 869500 -- [-2160.593] (-2151.483) (-2163.705) (-2159.692) * (-2163.817) (-2161.238) (-2159.588) [-2157.809] -- 0:00:34 870000 -- [-2153.206] (-2154.915) (-2157.519) (-2154.282) * (-2162.620) [-2157.257] (-2157.546) (-2159.317) -- 0:00:34 Average standard deviation of split frequencies: 0.002436 870500 -- (-2162.999) [-2156.654] (-2152.444) (-2157.557) * (-2171.945) (-2159.035) [-2154.896] (-2158.577) -- 0:00:34 871000 -- (-2164.693) (-2159.790) [-2154.950] (-2151.623) * (-2155.763) (-2161.397) (-2168.158) [-2152.162] -- 0:00:34 871500 -- (-2159.502) (-2161.077) [-2155.489] (-2153.505) * [-2159.035] (-2155.949) (-2161.459) (-2153.597) -- 0:00:34 872000 -- (-2161.392) (-2154.521) [-2160.510] (-2158.631) * (-2156.485) [-2155.584] (-2152.872) (-2158.047) -- 0:00:34 872500 -- (-2155.056) [-2154.041] (-2158.205) (-2157.938) * (-2159.239) (-2153.749) (-2164.399) [-2157.513] -- 0:00:33 873000 -- (-2154.856) (-2155.212) (-2154.515) [-2160.301] * (-2160.593) (-2153.154) (-2160.264) [-2152.756] -- 0:00:33 873500 -- (-2160.767) [-2150.106] (-2161.320) (-2159.541) * (-2160.735) (-2156.604) (-2157.660) [-2161.608] -- 0:00:33 874000 -- (-2157.214) (-2158.257) [-2158.071] (-2160.103) * (-2158.300) [-2157.565] (-2155.745) (-2152.788) -- 0:00:33 874500 -- (-2160.392) (-2158.758) (-2154.714) [-2159.297] * (-2156.007) [-2160.596] (-2159.851) (-2154.837) -- 0:00:33 875000 -- (-2158.126) [-2167.001] (-2165.332) (-2156.461) * (-2153.234) (-2161.873) [-2153.157] (-2152.109) -- 0:00:33 Average standard deviation of split frequencies: 0.002422 875500 -- [-2162.087] (-2162.213) (-2164.381) (-2164.598) * (-2153.991) (-2162.964) [-2155.197] (-2157.745) -- 0:00:33 876000 -- (-2161.190) (-2164.094) (-2166.092) [-2157.100] * (-2161.521) [-2156.355] (-2156.799) (-2161.920) -- 0:00:32 876500 -- (-2156.114) [-2157.142] (-2160.235) (-2162.834) * [-2161.881] (-2154.819) (-2156.955) (-2158.423) -- 0:00:32 877000 -- [-2153.733] (-2157.579) (-2166.241) (-2153.814) * (-2157.099) (-2158.935) (-2154.997) [-2158.484] -- 0:00:32 877500 -- (-2153.963) [-2164.026] (-2161.453) (-2159.241) * (-2158.673) (-2166.810) [-2154.980] (-2164.349) -- 0:00:32 878000 -- (-2159.849) (-2164.582) (-2162.958) [-2157.914] * (-2155.922) [-2154.732] (-2165.795) (-2159.266) -- 0:00:32 878500 -- [-2149.726] (-2158.046) (-2156.202) (-2155.113) * (-2156.217) [-2151.452] (-2160.967) (-2158.756) -- 0:00:32 879000 -- (-2154.650) [-2155.410] (-2155.294) (-2155.868) * (-2159.231) [-2150.757] (-2161.913) (-2155.273) -- 0:00:32 879500 -- (-2162.932) (-2158.911) (-2159.290) [-2151.081] * (-2169.610) (-2153.285) [-2154.594] (-2163.422) -- 0:00:32 880000 -- [-2162.375] (-2155.861) (-2160.388) (-2158.322) * (-2154.990) (-2170.013) (-2153.203) [-2163.253] -- 0:00:31 Average standard deviation of split frequencies: 0.002409 880500 -- (-2160.838) (-2155.865) [-2157.694] (-2155.085) * (-2156.686) (-2156.015) (-2158.500) [-2153.272] -- 0:00:31 881000 -- (-2162.423) (-2159.422) (-2163.181) [-2157.116] * (-2165.181) [-2153.228] (-2153.259) (-2164.242) -- 0:00:31 881500 -- (-2157.016) [-2161.360] (-2170.206) (-2160.119) * [-2155.868] (-2154.622) (-2155.936) (-2162.177) -- 0:00:31 882000 -- (-2160.130) (-2155.526) [-2160.426] (-2152.632) * (-2160.735) (-2158.989) (-2158.248) [-2158.715] -- 0:00:31 882500 -- (-2160.846) [-2152.580] (-2154.594) (-2161.657) * (-2159.780) (-2168.032) (-2159.602) [-2153.797] -- 0:00:31 883000 -- (-2153.348) (-2155.592) [-2154.833] (-2156.136) * (-2158.071) (-2166.824) [-2153.058] (-2155.968) -- 0:00:31 883500 -- (-2164.302) (-2157.569) [-2160.168] (-2153.581) * (-2159.227) (-2158.500) (-2153.662) [-2156.986] -- 0:00:30 884000 -- (-2157.444) (-2162.345) [-2155.104] (-2157.683) * (-2156.373) [-2160.276] (-2159.114) (-2159.490) -- 0:00:30 884500 -- (-2158.309) [-2162.208] (-2155.500) (-2159.962) * [-2157.985] (-2162.325) (-2153.926) (-2163.227) -- 0:00:30 885000 -- [-2155.203] (-2161.381) (-2156.593) (-2161.165) * [-2157.883] (-2162.089) (-2159.719) (-2166.329) -- 0:00:30 Average standard deviation of split frequencies: 0.002261 885500 -- (-2154.857) [-2156.002] (-2157.338) (-2153.012) * (-2164.382) (-2165.715) (-2159.794) [-2162.277] -- 0:00:30 886000 -- (-2156.245) (-2158.106) [-2156.118] (-2156.992) * (-2166.487) [-2160.936] (-2156.199) (-2151.245) -- 0:00:30 886500 -- [-2159.401] (-2159.839) (-2160.031) (-2153.776) * (-2161.797) (-2152.968) (-2159.493) [-2155.983] -- 0:00:30 887000 -- (-2158.479) [-2155.278] (-2162.376) (-2156.318) * (-2161.091) [-2161.360] (-2153.528) (-2160.745) -- 0:00:30 887500 -- (-2162.352) [-2156.470] (-2160.965) (-2163.403) * (-2157.553) [-2153.478] (-2157.038) (-2157.428) -- 0:00:29 888000 -- (-2157.665) (-2161.629) (-2158.275) [-2155.042] * (-2155.047) [-2154.054] (-2162.725) (-2153.911) -- 0:00:29 888500 -- (-2165.613) [-2155.041] (-2162.130) (-2159.827) * (-2156.032) (-2155.165) [-2155.807] (-2162.291) -- 0:00:29 889000 -- (-2163.214) (-2158.459) (-2161.183) [-2161.636] * (-2154.815) [-2154.955] (-2156.301) (-2158.097) -- 0:00:29 889500 -- (-2156.632) (-2157.388) [-2156.358] (-2157.413) * [-2155.270] (-2156.211) (-2157.418) (-2161.132) -- 0:00:29 890000 -- (-2159.434) (-2156.056) (-2157.552) [-2159.126] * (-2154.799) [-2152.226] (-2152.552) (-2161.592) -- 0:00:29 Average standard deviation of split frequencies: 0.002249 890500 -- (-2159.603) (-2159.197) [-2156.581] (-2161.473) * (-2152.114) (-2153.888) (-2164.523) [-2154.677] -- 0:00:29 891000 -- (-2156.729) [-2155.214] (-2152.720) (-2159.938) * (-2160.610) (-2152.392) (-2158.284) [-2153.510] -- 0:00:28 891500 -- (-2158.157) [-2154.382] (-2171.279) (-2156.193) * [-2153.147] (-2152.615) (-2156.378) (-2154.071) -- 0:00:28 892000 -- (-2154.244) (-2159.127) (-2167.618) [-2156.247] * (-2165.857) (-2155.039) [-2157.789] (-2165.803) -- 0:00:28 892500 -- [-2153.687] (-2155.862) (-2158.633) (-2155.621) * (-2161.903) [-2155.576] (-2163.825) (-2164.320) -- 0:00:28 893000 -- [-2155.565] (-2167.764) (-2155.400) (-2156.887) * (-2160.392) [-2155.508] (-2152.237) (-2164.927) -- 0:00:28 893500 -- (-2154.084) [-2155.993] (-2161.512) (-2152.321) * [-2153.962] (-2163.616) (-2154.603) (-2152.803) -- 0:00:28 894000 -- (-2159.382) [-2155.683] (-2157.219) (-2153.000) * (-2153.709) (-2160.104) [-2152.823] (-2153.247) -- 0:00:28 894500 -- (-2153.673) (-2160.299) [-2158.629] (-2155.432) * (-2165.691) (-2161.112) [-2161.179] (-2157.302) -- 0:00:28 895000 -- (-2154.863) (-2155.573) [-2161.078] (-2151.206) * (-2153.968) (-2160.829) [-2160.072] (-2159.476) -- 0:00:27 Average standard deviation of split frequencies: 0.002236 895500 -- (-2155.534) (-2162.423) [-2155.169] (-2157.131) * (-2161.400) (-2158.292) [-2153.460] (-2157.445) -- 0:00:27 896000 -- [-2152.705] (-2156.175) (-2159.269) (-2156.537) * (-2158.604) [-2156.055] (-2158.782) (-2154.568) -- 0:00:27 896500 -- (-2160.791) (-2160.620) (-2156.346) [-2156.715] * [-2154.750] (-2157.360) (-2162.701) (-2160.072) -- 0:00:27 897000 -- (-2154.892) (-2155.060) (-2159.729) [-2159.261] * [-2159.308] (-2158.688) (-2153.853) (-2158.037) -- 0:00:27 897500 -- (-2160.978) [-2161.676] (-2163.574) (-2154.141) * [-2150.272] (-2160.045) (-2162.605) (-2161.033) -- 0:00:27 898000 -- (-2159.788) [-2167.204] (-2160.045) (-2151.657) * [-2159.446] (-2162.078) (-2158.002) (-2159.949) -- 0:00:27 898500 -- [-2158.024] (-2152.462) (-2159.984) (-2156.478) * [-2158.387] (-2163.544) (-2152.380) (-2155.372) -- 0:00:26 899000 -- (-2160.154) (-2154.069) (-2163.628) [-2157.054] * (-2153.614) (-2153.499) (-2157.492) [-2155.778] -- 0:00:26 899500 -- [-2160.302] (-2160.727) (-2158.746) (-2158.828) * (-2153.135) (-2155.699) (-2160.115) [-2160.511] -- 0:00:26 900000 -- (-2157.557) [-2157.900] (-2154.540) (-2153.425) * (-2160.937) [-2157.420] (-2156.385) (-2160.601) -- 0:00:26 Average standard deviation of split frequencies: 0.002224 900500 -- (-2157.020) (-2160.383) [-2158.610] (-2152.246) * (-2167.233) (-2152.768) [-2155.701] (-2155.543) -- 0:00:26 901000 -- (-2158.246) (-2155.231) (-2156.704) [-2156.754] * (-2162.319) (-2154.074) (-2162.431) [-2150.070] -- 0:00:26 901500 -- (-2155.391) (-2158.450) (-2158.543) [-2162.985] * [-2155.022] (-2155.233) (-2160.837) (-2157.185) -- 0:00:26 902000 -- (-2158.647) (-2163.192) [-2153.165] (-2158.750) * (-2162.113) [-2150.926] (-2161.297) (-2157.395) -- 0:00:26 902500 -- [-2156.181] (-2163.332) (-2157.305) (-2159.996) * (-2165.095) (-2156.146) [-2159.296] (-2157.184) -- 0:00:25 903000 -- [-2161.452] (-2159.003) (-2162.626) (-2155.716) * (-2158.805) (-2154.553) (-2160.129) [-2157.214] -- 0:00:25 903500 -- (-2159.560) (-2159.728) (-2159.207) [-2159.862] * [-2159.862] (-2154.077) (-2154.213) (-2154.248) -- 0:00:25 904000 -- (-2164.785) (-2155.836) (-2158.601) [-2162.215] * (-2155.086) (-2155.398) [-2157.693] (-2154.380) -- 0:00:25 904500 -- (-2160.883) [-2154.366] (-2156.975) (-2154.100) * (-2157.554) (-2160.215) (-2156.150) [-2161.812] -- 0:00:25 905000 -- [-2159.038] (-2161.142) (-2154.991) (-2154.444) * (-2163.335) (-2171.930) [-2157.648] (-2155.129) -- 0:00:25 Average standard deviation of split frequencies: 0.002211 905500 -- (-2155.732) (-2160.518) (-2158.576) [-2151.768] * [-2156.938] (-2158.905) (-2152.410) (-2159.998) -- 0:00:25 906000 -- (-2159.143) (-2155.420) (-2155.591) [-2160.940] * (-2161.174) (-2159.441) (-2151.923) [-2153.745] -- 0:00:25 906500 -- (-2156.715) (-2163.751) (-2169.664) [-2163.300] * [-2156.504] (-2158.623) (-2151.247) (-2155.378) -- 0:00:24 907000 -- (-2156.084) (-2161.020) (-2162.806) [-2155.848] * [-2152.807] (-2161.215) (-2158.051) (-2158.075) -- 0:00:24 907500 -- (-2157.816) (-2156.492) [-2154.486] (-2158.612) * (-2156.487) (-2160.704) [-2158.852] (-2156.990) -- 0:00:24 908000 -- (-2164.403) (-2163.597) [-2156.460] (-2170.794) * (-2154.696) [-2155.795] (-2158.306) (-2164.629) -- 0:00:24 908500 -- (-2156.722) (-2155.329) [-2153.602] (-2160.823) * (-2162.758) (-2156.124) (-2155.128) [-2158.451] -- 0:00:24 909000 -- (-2158.952) (-2155.985) [-2154.492] (-2164.647) * (-2157.514) (-2163.334) [-2154.713] (-2159.980) -- 0:00:24 909500 -- (-2160.773) (-2157.363) [-2153.444] (-2162.190) * (-2158.285) [-2157.197] (-2154.024) (-2156.209) -- 0:00:24 910000 -- (-2157.059) (-2156.619) [-2153.079] (-2160.441) * [-2152.855] (-2156.314) (-2161.823) (-2156.279) -- 0:00:23 Average standard deviation of split frequencies: 0.002071 910500 -- (-2157.104) (-2156.422) [-2160.147] (-2166.611) * [-2159.451] (-2154.666) (-2154.076) (-2152.047) -- 0:00:23 911000 -- [-2155.022] (-2156.422) (-2156.645) (-2170.554) * (-2159.190) [-2158.268] (-2155.104) (-2153.611) -- 0:00:23 911500 -- (-2156.091) [-2152.247] (-2154.951) (-2167.505) * (-2154.578) [-2161.921] (-2157.330) (-2161.224) -- 0:00:23 912000 -- (-2159.656) [-2160.389] (-2156.387) (-2159.409) * [-2158.354] (-2162.600) (-2157.745) (-2152.813) -- 0:00:23 912500 -- [-2151.422] (-2153.222) (-2155.324) (-2157.654) * (-2165.790) (-2160.805) [-2162.234] (-2160.716) -- 0:00:23 913000 -- (-2159.679) [-2157.864] (-2155.474) (-2160.054) * (-2160.617) (-2161.867) [-2159.454] (-2156.265) -- 0:00:23 913500 -- (-2154.192) (-2159.613) [-2161.324] (-2156.323) * [-2154.288] (-2160.026) (-2153.474) (-2161.712) -- 0:00:23 914000 -- (-2153.690) (-2161.051) (-2162.173) [-2152.735] * (-2153.250) (-2161.939) (-2160.358) [-2161.254] -- 0:00:22 914500 -- (-2157.525) (-2158.746) [-2157.218] (-2156.809) * (-2158.652) (-2162.677) [-2153.173] (-2157.530) -- 0:00:22 915000 -- [-2159.657] (-2157.772) (-2158.471) (-2159.861) * [-2161.918] (-2155.737) (-2155.405) (-2154.189) -- 0:00:22 Average standard deviation of split frequencies: 0.002059 915500 -- (-2154.556) [-2156.064] (-2154.870) (-2153.630) * (-2159.979) (-2158.846) [-2155.863] (-2158.728) -- 0:00:22 916000 -- (-2156.304) (-2160.401) [-2155.914] (-2150.644) * (-2154.945) (-2161.165) [-2154.150] (-2152.659) -- 0:00:22 916500 -- [-2155.921] (-2160.095) (-2158.848) (-2161.516) * (-2163.709) (-2155.212) [-2151.117] (-2151.772) -- 0:00:22 917000 -- (-2154.673) (-2156.904) [-2153.659] (-2154.092) * (-2161.017) (-2158.875) [-2153.620] (-2160.963) -- 0:00:22 917500 -- (-2151.863) (-2163.422) (-2155.279) [-2150.768] * [-2154.394] (-2161.511) (-2154.275) (-2164.110) -- 0:00:21 918000 -- [-2152.366] (-2163.260) (-2158.165) (-2151.833) * (-2156.956) (-2159.045) [-2152.651] (-2151.555) -- 0:00:21 918500 -- [-2155.450] (-2154.935) (-2157.597) (-2151.173) * (-2158.363) (-2162.199) (-2159.644) [-2158.677] -- 0:00:21 919000 -- (-2161.946) (-2164.910) [-2155.795] (-2158.554) * [-2156.684] (-2157.168) (-2167.427) (-2159.850) -- 0:00:21 919500 -- [-2156.750] (-2155.397) (-2152.380) (-2159.099) * (-2156.582) (-2162.452) (-2160.935) [-2155.687] -- 0:00:21 920000 -- (-2157.421) (-2156.215) (-2154.980) [-2155.417] * (-2158.106) (-2159.138) (-2161.212) [-2156.574] -- 0:00:21 Average standard deviation of split frequencies: 0.002048 920500 -- [-2155.341] (-2155.883) (-2156.986) (-2162.393) * (-2158.490) [-2158.727] (-2159.814) (-2156.503) -- 0:00:21 921000 -- [-2156.006] (-2161.083) (-2149.245) (-2163.780) * (-2159.596) (-2158.016) (-2158.962) [-2153.917] -- 0:00:21 921500 -- (-2157.463) [-2161.039] (-2160.092) (-2166.007) * (-2152.101) (-2169.697) (-2159.619) [-2160.628] -- 0:00:20 922000 -- (-2163.305) [-2159.696] (-2158.481) (-2157.745) * (-2154.909) [-2157.520] (-2154.556) (-2157.927) -- 0:00:20 922500 -- (-2156.721) [-2149.511] (-2158.335) (-2161.581) * (-2161.944) [-2156.118] (-2153.979) (-2160.083) -- 0:00:20 923000 -- (-2156.265) [-2154.318] (-2162.653) (-2159.453) * (-2155.912) (-2156.578) (-2163.861) [-2159.357] -- 0:00:20 923500 -- (-2161.060) [-2154.701] (-2166.831) (-2162.515) * (-2164.920) (-2155.170) (-2158.682) [-2153.159] -- 0:00:20 924000 -- (-2166.463) (-2158.624) [-2160.847] (-2160.027) * (-2161.968) (-2158.274) [-2155.031] (-2159.318) -- 0:00:20 924500 -- (-2163.177) [-2153.293] (-2163.655) (-2160.791) * [-2159.313] (-2161.968) (-2158.182) (-2158.081) -- 0:00:20 925000 -- [-2155.586] (-2159.809) (-2151.054) (-2157.900) * (-2156.685) (-2157.574) [-2156.257] (-2160.676) -- 0:00:19 Average standard deviation of split frequencies: 0.002036 925500 -- [-2161.895] (-2157.445) (-2155.334) (-2155.245) * (-2155.267) (-2152.019) [-2159.344] (-2160.988) -- 0:00:19 926000 -- (-2157.359) (-2152.419) [-2154.634] (-2155.611) * (-2165.513) (-2159.053) [-2152.822] (-2151.287) -- 0:00:19 926500 -- [-2154.766] (-2157.265) (-2160.131) (-2157.833) * [-2154.069] (-2164.636) (-2156.387) (-2160.307) -- 0:00:19 927000 -- (-2160.257) (-2157.991) [-2154.550] (-2155.669) * (-2159.957) (-2166.483) [-2155.556] (-2156.117) -- 0:00:19 927500 -- (-2154.406) (-2162.849) [-2157.545] (-2155.849) * (-2158.988) (-2157.196) [-2155.198] (-2155.943) -- 0:00:19 928000 -- (-2154.620) (-2158.914) (-2158.306) [-2153.141] * (-2152.212) (-2156.045) (-2158.025) [-2159.610] -- 0:00:19 928500 -- (-2162.043) (-2158.401) [-2151.384] (-2157.634) * (-2155.098) [-2158.221] (-2153.751) (-2162.262) -- 0:00:19 929000 -- [-2154.886] (-2157.946) (-2158.918) (-2157.818) * [-2152.746] (-2162.491) (-2157.198) (-2156.174) -- 0:00:18 929500 -- [-2158.123] (-2157.207) (-2158.972) (-2156.646) * [-2159.270] (-2152.352) (-2156.358) (-2150.781) -- 0:00:18 930000 -- (-2156.702) (-2164.244) [-2163.228] (-2157.157) * (-2170.463) (-2154.091) (-2157.591) [-2160.843] -- 0:00:18 Average standard deviation of split frequencies: 0.002153 930500 -- (-2153.909) (-2162.218) (-2156.131) [-2157.595] * (-2160.072) (-2156.981) (-2162.480) [-2157.079] -- 0:00:18 931000 -- (-2159.040) [-2160.416] (-2162.940) (-2161.259) * (-2160.378) (-2155.354) (-2154.060) [-2153.036] -- 0:00:18 931500 -- (-2158.099) (-2160.464) [-2155.129] (-2156.060) * [-2152.566] (-2160.887) (-2156.443) (-2162.685) -- 0:00:18 932000 -- (-2163.705) (-2158.492) [-2152.770] (-2156.452) * (-2158.704) (-2158.209) (-2162.621) [-2156.240] -- 0:00:18 932500 -- [-2157.276] (-2153.304) (-2152.999) (-2154.378) * (-2163.138) (-2161.734) [-2157.042] (-2156.951) -- 0:00:17 933000 -- (-2154.941) [-2153.387] (-2156.856) (-2157.220) * (-2152.727) (-2157.242) (-2155.082) [-2161.717] -- 0:00:17 933500 -- [-2152.504] (-2157.149) (-2159.771) (-2162.110) * (-2159.473) (-2160.724) [-2152.419] (-2161.916) -- 0:00:17 934000 -- (-2157.049) (-2158.947) (-2160.710) [-2153.943] * (-2160.511) (-2154.982) (-2154.007) [-2151.904] -- 0:00:17 934500 -- (-2154.726) (-2165.646) [-2153.924] (-2156.549) * (-2158.915) (-2164.708) [-2158.481] (-2156.439) -- 0:00:17 935000 -- (-2156.942) (-2169.311) (-2153.740) [-2151.988] * (-2158.254) (-2160.606) (-2160.191) [-2154.666] -- 0:00:17 Average standard deviation of split frequencies: 0.001889 935500 -- (-2153.516) [-2156.539] (-2152.954) (-2151.512) * [-2161.220] (-2156.973) (-2162.516) (-2158.353) -- 0:00:17 936000 -- (-2157.348) (-2160.474) (-2164.455) [-2155.686] * (-2158.599) [-2153.901] (-2160.524) (-2163.793) -- 0:00:17 936500 -- (-2158.199) [-2162.717] (-2159.734) (-2153.895) * (-2159.564) [-2153.509] (-2169.506) (-2156.245) -- 0:00:16 937000 -- (-2154.982) (-2155.842) (-2162.052) [-2152.734] * (-2161.203) [-2153.000] (-2163.686) (-2173.384) -- 0:00:16 937500 -- (-2158.794) (-2159.517) (-2161.564) [-2159.762] * (-2160.036) [-2153.362] (-2159.806) (-2157.294) -- 0:00:16 938000 -- (-2163.545) (-2162.020) (-2162.173) [-2158.779] * [-2155.291] (-2158.460) (-2153.381) (-2157.540) -- 0:00:16 938500 -- (-2158.021) (-2161.747) (-2164.890) [-2160.254] * (-2154.544) (-2157.753) [-2156.385] (-2163.372) -- 0:00:16 939000 -- (-2163.877) (-2155.371) (-2167.242) [-2154.418] * (-2155.107) [-2155.694] (-2158.473) (-2160.347) -- 0:00:16 939500 -- [-2155.227] (-2154.176) (-2153.842) (-2157.980) * (-2155.083) (-2154.468) [-2155.372] (-2161.004) -- 0:00:16 940000 -- [-2158.033] (-2156.594) (-2159.329) (-2157.108) * [-2155.595] (-2160.795) (-2158.503) (-2154.405) -- 0:00:15 Average standard deviation of split frequencies: 0.001754 940500 -- [-2156.313] (-2153.342) (-2158.597) (-2155.182) * (-2154.817) (-2157.919) (-2160.885) [-2156.485] -- 0:00:15 941000 -- (-2159.115) (-2157.567) [-2160.993] (-2164.651) * (-2155.773) (-2160.866) [-2154.675] (-2158.868) -- 0:00:15 941500 -- (-2151.329) (-2158.937) (-2159.263) [-2155.749] * (-2154.878) (-2159.510) (-2158.669) [-2155.628] -- 0:00:15 942000 -- (-2153.991) (-2163.314) (-2153.496) [-2152.284] * [-2154.298] (-2158.937) (-2156.788) (-2153.057) -- 0:00:15 942500 -- (-2154.697) (-2159.367) (-2153.928) [-2158.329] * (-2159.932) (-2154.761) (-2161.517) [-2161.964] -- 0:00:15 943000 -- (-2154.499) (-2165.595) [-2157.070] (-2155.265) * [-2158.645] (-2154.492) (-2165.583) (-2165.093) -- 0:00:15 943500 -- (-2154.898) (-2161.160) (-2159.667) [-2158.716] * (-2157.742) [-2152.257] (-2158.716) (-2158.661) -- 0:00:15 944000 -- (-2150.125) [-2166.466] (-2155.791) (-2160.729) * (-2157.730) (-2163.449) [-2155.260] (-2156.220) -- 0:00:14 944500 -- (-2152.778) [-2164.595] (-2155.362) (-2155.826) * (-2157.399) [-2156.378] (-2153.209) (-2161.038) -- 0:00:14 945000 -- (-2157.979) (-2161.917) [-2158.066] (-2159.819) * [-2157.086] (-2160.205) (-2157.536) (-2160.871) -- 0:00:14 Average standard deviation of split frequencies: 0.001620 945500 -- (-2154.507) (-2158.123) (-2156.022) [-2157.098] * (-2154.462) [-2154.832] (-2153.345) (-2167.992) -- 0:00:14 946000 -- [-2159.401] (-2155.370) (-2157.762) (-2163.577) * (-2156.039) (-2159.716) (-2161.072) [-2155.100] -- 0:00:14 946500 -- (-2154.559) (-2155.478) (-2153.650) [-2154.365] * (-2155.103) (-2158.753) [-2157.061] (-2165.209) -- 0:00:14 947000 -- (-2158.976) (-2160.209) (-2162.040) [-2154.253] * (-2158.582) (-2156.121) (-2157.991) [-2155.005] -- 0:00:14 947500 -- (-2158.970) (-2157.096) (-2153.257) [-2154.769] * (-2160.313) [-2152.142] (-2158.759) (-2156.006) -- 0:00:13 948000 -- (-2162.553) [-2159.121] (-2156.963) (-2152.230) * (-2158.337) [-2150.803] (-2158.023) (-2160.846) -- 0:00:13 948500 -- (-2156.265) (-2159.819) (-2160.255) [-2152.275] * (-2158.663) [-2154.120] (-2162.432) (-2164.357) -- 0:00:13 949000 -- (-2163.259) [-2158.744] (-2152.608) (-2153.792) * (-2156.744) (-2160.191) (-2157.141) [-2156.321] -- 0:00:13 949500 -- (-2152.660) [-2158.751] (-2157.402) (-2163.581) * (-2157.124) (-2154.229) [-2159.715] (-2166.487) -- 0:00:13 950000 -- (-2158.528) (-2159.472) (-2159.523) [-2156.006] * (-2158.924) (-2158.336) (-2158.865) [-2157.314] -- 0:00:13 Average standard deviation of split frequencies: 0.001612 950500 -- (-2153.164) (-2159.180) (-2154.348) [-2160.597] * (-2168.684) (-2155.358) (-2154.540) [-2156.963] -- 0:00:13 951000 -- (-2160.536) (-2156.857) [-2151.198] (-2158.390) * (-2159.122) (-2157.314) [-2155.190] (-2162.715) -- 0:00:13 951500 -- [-2156.023] (-2156.622) (-2157.256) (-2157.446) * (-2156.335) (-2154.093) [-2155.375] (-2163.993) -- 0:00:12 952000 -- (-2159.806) [-2159.731] (-2156.493) (-2163.169) * [-2159.691] (-2157.697) (-2154.286) (-2160.431) -- 0:00:12 952500 -- [-2155.363] (-2159.247) (-2154.931) (-2157.667) * [-2159.205] (-2161.850) (-2155.507) (-2150.938) -- 0:00:12 953000 -- (-2159.150) [-2162.130] (-2153.926) (-2162.951) * (-2158.490) [-2156.463] (-2158.106) (-2151.635) -- 0:00:12 953500 -- (-2159.900) (-2167.836) [-2154.484] (-2152.540) * [-2160.643] (-2155.325) (-2154.660) (-2155.554) -- 0:00:12 954000 -- (-2158.652) (-2160.422) [-2156.025] (-2150.258) * [-2162.524] (-2155.689) (-2158.803) (-2156.747) -- 0:00:12 954500 -- (-2156.032) (-2158.972) (-2160.883) [-2150.244] * (-2159.589) (-2158.571) (-2152.557) [-2157.989] -- 0:00:12 955000 -- (-2162.046) (-2160.448) (-2170.787) [-2155.514] * (-2156.945) (-2163.212) (-2160.363) [-2154.448] -- 0:00:11 Average standard deviation of split frequencies: 0.001603 955500 -- [-2153.552] (-2156.398) (-2170.680) (-2158.070) * (-2159.316) (-2157.524) (-2159.115) [-2152.818] -- 0:00:11 956000 -- [-2155.111] (-2151.577) (-2157.490) (-2160.543) * [-2158.531] (-2165.718) (-2161.702) (-2161.902) -- 0:00:11 956500 -- (-2157.832) (-2154.654) [-2155.948] (-2153.531) * (-2155.049) (-2158.693) [-2151.936] (-2167.723) -- 0:00:11 957000 -- [-2156.790] (-2158.388) (-2157.172) (-2159.092) * (-2156.042) (-2157.799) (-2151.887) [-2157.732] -- 0:00:11 957500 -- (-2157.371) (-2162.580) (-2157.413) [-2154.950] * (-2160.081) (-2162.978) [-2154.251] (-2153.104) -- 0:00:11 958000 -- (-2153.699) (-2153.720) (-2160.305) [-2152.403] * [-2153.923] (-2156.813) (-2157.687) (-2157.451) -- 0:00:11 958500 -- (-2153.775) (-2153.610) (-2152.179) [-2158.780] * (-2161.670) [-2154.002] (-2161.629) (-2156.101) -- 0:00:11 959000 -- (-2164.887) [-2155.128] (-2162.144) (-2161.162) * (-2157.812) (-2151.746) (-2164.969) [-2161.568] -- 0:00:10 959500 -- (-2171.755) [-2156.645] (-2162.056) (-2156.938) * (-2160.703) (-2158.229) [-2158.693] (-2162.543) -- 0:00:10 960000 -- [-2155.999] (-2159.215) (-2155.425) (-2151.816) * [-2155.931] (-2159.412) (-2157.345) (-2155.466) -- 0:00:10 Average standard deviation of split frequencies: 0.001595 960500 -- [-2151.903] (-2154.040) (-2159.202) (-2157.429) * (-2159.147) (-2160.748) (-2161.943) [-2156.247] -- 0:00:10 961000 -- [-2153.366] (-2152.668) (-2152.625) (-2162.077) * (-2153.342) (-2155.907) (-2154.734) [-2153.213] -- 0:00:10 961500 -- [-2149.868] (-2155.867) (-2157.611) (-2154.725) * (-2155.610) [-2154.352] (-2163.765) (-2155.354) -- 0:00:10 962000 -- (-2154.636) [-2148.859] (-2161.662) (-2153.378) * (-2153.833) (-2155.199) (-2167.736) [-2152.105] -- 0:00:10 962500 -- (-2160.936) (-2156.541) (-2159.600) [-2152.314] * (-2167.711) [-2155.371] (-2153.215) (-2153.053) -- 0:00:09 963000 -- (-2162.567) (-2153.002) [-2154.274] (-2162.898) * (-2156.554) (-2157.857) [-2152.750] (-2159.408) -- 0:00:09 963500 -- (-2159.434) (-2156.507) [-2156.855] (-2159.759) * (-2156.111) (-2164.654) [-2158.570] (-2154.448) -- 0:00:09 964000 -- (-2156.253) (-2162.062) (-2155.093) [-2156.956] * (-2158.857) (-2152.722) (-2156.675) [-2154.498] -- 0:00:09 964500 -- (-2157.506) (-2162.817) (-2156.226) [-2159.690] * [-2156.755] (-2156.478) (-2159.388) (-2158.573) -- 0:00:09 965000 -- (-2157.373) (-2151.043) [-2158.133] (-2159.816) * (-2154.237) (-2155.848) (-2156.791) [-2155.952] -- 0:00:09 Average standard deviation of split frequencies: 0.001586 965500 -- [-2155.251] (-2166.017) (-2160.406) (-2155.895) * (-2158.521) (-2158.458) (-2163.812) [-2156.706] -- 0:00:09 966000 -- [-2154.112] (-2156.199) (-2156.159) (-2153.984) * (-2159.949) (-2160.636) (-2167.265) [-2152.101] -- 0:00:09 966500 -- (-2158.914) (-2157.925) (-2157.502) [-2156.263] * [-2156.547] (-2159.136) (-2158.492) (-2160.693) -- 0:00:08 967000 -- (-2154.355) (-2156.588) [-2155.331] (-2156.684) * (-2153.991) (-2153.368) [-2153.569] (-2153.874) -- 0:00:08 967500 -- (-2163.409) (-2155.487) (-2155.401) [-2161.272] * [-2160.959] (-2160.167) (-2154.777) (-2160.031) -- 0:00:08 968000 -- [-2157.391] (-2153.095) (-2155.008) (-2158.145) * (-2163.188) (-2155.704) (-2158.424) [-2164.219] -- 0:00:08 968500 -- (-2155.975) (-2159.716) (-2160.268) [-2156.314] * (-2160.533) (-2157.330) (-2158.827) [-2158.770] -- 0:00:08 969000 -- [-2156.168] (-2160.771) (-2163.854) (-2153.735) * [-2155.583] (-2163.280) (-2164.808) (-2161.937) -- 0:00:08 969500 -- (-2155.674) [-2155.530] (-2163.134) (-2162.231) * [-2155.313] (-2170.130) (-2161.629) (-2159.812) -- 0:00:08 970000 -- (-2158.863) [-2160.154] (-2161.766) (-2160.993) * [-2156.891] (-2164.376) (-2161.749) (-2151.149) -- 0:00:07 Average standard deviation of split frequencies: 0.001457 970500 -- [-2156.576] (-2163.701) (-2164.174) (-2163.394) * [-2156.516] (-2159.453) (-2163.874) (-2156.743) -- 0:00:07 971000 -- [-2155.445] (-2166.807) (-2153.282) (-2153.162) * [-2157.623] (-2154.902) (-2175.293) (-2161.767) -- 0:00:07 971500 -- [-2158.090] (-2156.154) (-2153.451) (-2157.912) * (-2158.071) (-2155.253) (-2168.040) [-2153.325] -- 0:00:07 972000 -- (-2156.616) (-2156.390) [-2151.195] (-2153.073) * (-2162.548) (-2156.436) (-2160.865) [-2153.379] -- 0:00:07 972500 -- (-2159.750) (-2157.434) (-2164.896) [-2153.635] * (-2164.175) (-2154.824) [-2158.948] (-2160.655) -- 0:00:07 973000 -- (-2163.113) [-2153.349] (-2160.600) (-2156.297) * (-2162.109) (-2163.959) [-2154.232] (-2156.877) -- 0:00:07 973500 -- (-2154.096) (-2154.626) (-2168.307) [-2155.907] * (-2157.519) [-2155.131] (-2154.725) (-2155.326) -- 0:00:07 974000 -- (-2156.039) (-2158.324) [-2159.116] (-2159.708) * (-2157.836) (-2154.074) (-2156.477) [-2154.973] -- 0:00:06 974500 -- [-2159.308] (-2158.819) (-2158.520) (-2158.681) * (-2160.921) [-2154.224] (-2156.996) (-2161.890) -- 0:00:06 975000 -- (-2162.418) (-2154.323) (-2159.731) [-2156.661] * (-2157.065) [-2152.703] (-2160.823) (-2160.795) -- 0:00:06 Average standard deviation of split frequencies: 0.001449 975500 -- (-2158.686) (-2162.906) (-2161.373) [-2158.373] * [-2154.718] (-2153.622) (-2159.693) (-2154.189) -- 0:00:06 976000 -- [-2153.414] (-2159.569) (-2156.639) (-2159.032) * (-2157.908) (-2158.626) (-2158.900) [-2158.966] -- 0:00:06 976500 -- [-2154.782] (-2164.134) (-2159.205) (-2156.307) * (-2163.269) [-2154.215] (-2154.272) (-2160.957) -- 0:00:06 977000 -- (-2152.201) [-2154.987] (-2162.267) (-2156.444) * (-2176.141) (-2157.041) [-2152.074] (-2155.701) -- 0:00:06 977500 -- [-2154.302] (-2160.245) (-2160.509) (-2158.220) * (-2161.587) (-2154.138) [-2153.277] (-2168.258) -- 0:00:05 978000 -- [-2161.610] (-2156.062) (-2159.211) (-2157.279) * (-2160.176) (-2161.902) (-2155.550) [-2154.151] -- 0:00:05 978500 -- [-2154.760] (-2151.376) (-2155.417) (-2169.357) * (-2155.826) (-2155.956) (-2161.807) [-2165.692] -- 0:00:05 979000 -- (-2156.697) (-2157.061) [-2157.313] (-2161.425) * (-2158.354) (-2157.887) [-2159.535] (-2158.697) -- 0:00:05 979500 -- (-2154.495) [-2153.823] (-2152.935) (-2155.999) * (-2155.485) (-2161.231) [-2156.673] (-2157.289) -- 0:00:05 980000 -- [-2158.883] (-2153.092) (-2161.190) (-2156.144) * (-2154.695) (-2159.659) (-2155.479) [-2155.194] -- 0:00:05 Average standard deviation of split frequencies: 0.001442 980500 -- (-2156.464) (-2154.917) [-2158.329] (-2161.989) * (-2152.859) (-2160.928) (-2156.868) [-2157.920] -- 0:00:05 981000 -- [-2155.499] (-2159.810) (-2161.712) (-2158.124) * (-2155.587) (-2157.249) [-2158.829] (-2151.679) -- 0:00:05 981500 -- [-2155.922] (-2160.207) (-2161.257) (-2155.448) * (-2162.493) (-2153.913) (-2156.543) [-2152.260] -- 0:00:04 982000 -- (-2151.788) (-2155.475) (-2156.352) [-2156.696] * (-2156.070) (-2163.185) (-2157.828) [-2158.955] -- 0:00:04 982500 -- (-2153.373) (-2154.777) (-2156.374) [-2154.478] * (-2158.321) [-2162.541] (-2157.533) (-2154.839) -- 0:00:04 983000 -- (-2152.148) [-2159.211] (-2159.808) (-2163.186) * (-2153.437) (-2156.979) (-2154.858) [-2151.696] -- 0:00:04 983500 -- [-2160.403] (-2163.734) (-2153.639) (-2161.828) * (-2168.179) (-2159.543) [-2155.646] (-2151.069) -- 0:00:04 984000 -- [-2160.827] (-2159.828) (-2156.339) (-2160.440) * (-2155.450) (-2155.916) [-2153.730] (-2152.941) -- 0:00:04 984500 -- [-2158.589] (-2154.681) (-2154.077) (-2159.552) * [-2158.674] (-2152.345) (-2158.529) (-2158.034) -- 0:00:04 985000 -- (-2158.989) [-2151.358] (-2154.184) (-2161.418) * [-2163.130] (-2158.668) (-2161.483) (-2152.709) -- 0:00:03 Average standard deviation of split frequencies: 0.001315 985500 -- [-2161.617] (-2154.111) (-2156.152) (-2154.905) * (-2160.614) [-2155.642] (-2165.897) (-2155.647) -- 0:00:03 986000 -- (-2156.761) [-2152.918] (-2163.008) (-2153.290) * [-2155.904] (-2156.985) (-2158.205) (-2161.643) -- 0:00:03 986500 -- (-2156.022) [-2153.030] (-2160.175) (-2154.640) * (-2155.562) (-2155.729) [-2162.227] (-2157.399) -- 0:00:03 987000 -- (-2156.414) (-2157.693) (-2154.062) [-2154.928] * (-2157.573) [-2160.388] (-2160.622) (-2158.021) -- 0:00:03 987500 -- (-2167.552) [-2160.591] (-2156.648) (-2150.442) * [-2156.488] (-2157.868) (-2154.189) (-2164.213) -- 0:00:03 988000 -- (-2157.538) (-2154.306) [-2157.517] (-2156.759) * (-2156.036) [-2153.043] (-2156.142) (-2163.674) -- 0:00:03 988500 -- (-2170.273) (-2162.008) [-2153.336] (-2155.636) * (-2155.544) [-2155.507] (-2160.639) (-2155.840) -- 0:00:03 989000 -- [-2159.581] (-2157.059) (-2157.401) (-2156.404) * (-2160.170) (-2159.212) (-2156.050) [-2156.994] -- 0:00:02 989500 -- [-2157.823] (-2164.044) (-2158.591) (-2165.513) * (-2156.127) (-2162.095) (-2154.091) [-2154.475] -- 0:00:02 990000 -- [-2155.587] (-2160.286) (-2150.898) (-2158.617) * (-2154.313) (-2160.393) [-2157.264] (-2155.514) -- 0:00:02 Average standard deviation of split frequencies: 0.001309 990500 -- (-2160.096) (-2155.812) (-2158.623) [-2159.363] * (-2154.716) (-2161.102) (-2163.216) [-2156.069] -- 0:00:02 991000 -- (-2155.648) [-2152.487] (-2157.706) (-2160.882) * [-2159.546] (-2157.532) (-2162.979) (-2156.286) -- 0:00:02 991500 -- [-2154.915] (-2156.924) (-2163.887) (-2153.845) * (-2156.113) (-2157.434) (-2155.746) [-2157.227] -- 0:00:02 992000 -- [-2154.224] (-2156.421) (-2158.953) (-2156.284) * [-2162.046] (-2159.861) (-2158.595) (-2155.642) -- 0:00:02 992500 -- (-2162.968) (-2164.099) [-2155.178] (-2157.013) * (-2158.042) (-2154.237) (-2158.502) [-2155.614] -- 0:00:01 993000 -- (-2156.949) [-2155.111] (-2158.917) (-2164.262) * (-2158.192) [-2160.785] (-2157.499) (-2154.154) -- 0:00:01 993500 -- (-2157.896) [-2155.784] (-2154.393) (-2163.914) * (-2163.610) (-2161.123) (-2157.430) [-2157.572] -- 0:00:01 994000 -- [-2162.784] (-2157.162) (-2160.926) (-2164.021) * (-2155.294) (-2156.993) [-2161.187] (-2156.054) -- 0:00:01 994500 -- [-2162.746] (-2155.525) (-2156.240) (-2157.525) * (-2162.652) (-2158.834) (-2160.053) [-2155.698] -- 0:00:01 995000 -- (-2163.347) [-2156.107] (-2156.396) (-2165.165) * (-2152.265) (-2162.920) (-2155.768) [-2157.386] -- 0:00:01 Average standard deviation of split frequencies: 0.001302 995500 -- [-2157.989] (-2153.222) (-2153.594) (-2158.565) * (-2153.964) (-2164.975) (-2163.907) [-2156.913] -- 0:00:01 996000 -- (-2156.505) (-2157.135) (-2155.167) [-2157.718] * (-2152.288) (-2162.830) [-2155.530] (-2155.035) -- 0:00:01 996500 -- [-2156.585] (-2156.309) (-2160.569) (-2159.867) * [-2159.440] (-2155.443) (-2157.208) (-2161.495) -- 0:00:00 997000 -- [-2157.065] (-2155.549) (-2158.144) (-2152.145) * (-2160.448) (-2156.216) [-2156.240] (-2163.373) -- 0:00:00 997500 -- (-2155.271) [-2154.389] (-2157.499) (-2163.893) * (-2150.231) (-2161.116) [-2154.649] (-2164.083) -- 0:00:00 998000 -- (-2156.697) (-2155.498) (-2160.611) [-2156.190] * (-2156.109) [-2154.104] (-2158.128) (-2161.187) -- 0:00:00 998500 -- (-2159.064) (-2157.237) [-2152.658] (-2158.563) * (-2158.596) [-2151.149] (-2162.329) (-2161.583) -- 0:00:00 999000 -- [-2157.183] (-2154.359) (-2156.246) (-2159.201) * [-2153.711] (-2153.407) (-2167.297) (-2159.507) -- 0:00:00 999500 -- (-2155.341) (-2158.804) [-2154.081] (-2153.083) * (-2158.645) [-2159.106] (-2161.256) (-2160.938) -- 0:00:00 1000000 -- [-2152.347] (-2154.331) (-2162.315) (-2170.258) * [-2158.499] (-2155.438) (-2158.094) (-2156.837) -- 0:00:00 Average standard deviation of split frequencies: 0.001295 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -2152.346505 -- 17.428751 Chain 1 -- -2152.346505 -- 17.428751 Chain 2 -- -2154.331113 -- 9.789539 Chain 2 -- -2154.331110 -- 9.789539 Chain 3 -- -2162.314802 -- 16.823296 Chain 3 -- -2162.314802 -- 16.823296 Chain 4 -- -2170.258113 -- 18.373454 Chain 4 -- -2170.258113 -- 18.373454 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -2158.499387 -- 16.732304 Chain 1 -- -2158.499387 -- 16.732304 Chain 2 -- -2155.438348 -- 15.825724 Chain 2 -- -2155.438348 -- 15.825724 Chain 3 -- -2158.094020 -- 15.686731 Chain 3 -- -2158.094021 -- 15.686731 Chain 4 -- -2156.837306 -- 16.129000 Chain 4 -- -2156.837306 -- 16.129000 Analysis completed in 4 mins 26 seconds Analysis used 265.73 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -2147.50 Likelihood of best state for "cold" chain of run 2 was -2147.50 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 50.1 % ( 38 %) Dirichlet(Revmat{all}) 64.6 % ( 50 %) Slider(Revmat{all}) 26.0 % ( 16 %) Dirichlet(Pi{all}) 27.4 % ( 29 %) Slider(Pi{all}) 63.2 % ( 40 %) Multiplier(Alpha{1,2}) 47.8 % ( 24 %) Multiplier(Alpha{3}) 68.9 % ( 40 %) Slider(Pinvar{all}) 5.3 % ( 4 %) ExtSPR(Tau{all},V{all}) 2.7 % ( 0 %) ExtTBR(Tau{all},V{all}) 10.6 % ( 8 %) NNI(Tau{all},V{all}) 18.6 % ( 16 %) ParsSPR(Tau{all},V{all}) 26.2 % ( 24 %) Multiplier(V{all}) 29.6 % ( 34 %) Nodeslider(V{all}) 25.2 % ( 30 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 50.8 % ( 44 %) Dirichlet(Revmat{all}) 65.5 % ( 40 %) Slider(Revmat{all}) 25.9 % ( 24 %) Dirichlet(Pi{all}) 27.2 % ( 28 %) Slider(Pi{all}) 62.7 % ( 31 %) Multiplier(Alpha{1,2}) 47.7 % ( 20 %) Multiplier(Alpha{3}) 69.2 % ( 39 %) Slider(Pinvar{all}) 5.4 % ( 6 %) ExtSPR(Tau{all},V{all}) 2.7 % ( 2 %) ExtTBR(Tau{all},V{all}) 10.6 % ( 13 %) NNI(Tau{all},V{all}) 18.1 % ( 23 %) ParsSPR(Tau{all},V{all}) 26.2 % ( 26 %) Multiplier(V{all}) 29.6 % ( 28 %) Nodeslider(V{all}) 25.0 % ( 20 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.83 0.67 0.54 2 | 166782 0.84 0.70 3 | 167284 166722 0.85 4 | 166066 166507 166639 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.83 0.67 0.55 2 | 166176 0.84 0.70 3 | 166767 166745 0.85 4 | 166886 166470 166956 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -2154.67 | 1 | | 1 | | * 1 | | 1 2 1 2 | | 1 1 1 2 22 22 1 1 1 11 2 2 2 | | 2 2 1 2 1 2 21 11 | | 2 1 2 1 2 2 | | 1 1 *1121 2 2 * 2 2 * 1 | | 2 22 1 1 21 2 22 1 2 2111| |1 2 1 2 1 1 21 2 2 21 1 1 2 22 | | 2 1 1 1 1 2 2 2 2 1 2 2| | 2 2 1 2 1 2 1 1 2 | |2 | | 1 * 1 | | 1 1 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2157.81 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2153.04 -2162.57 2 -2153.23 -2164.02 -------------------------------------- TOTAL -2153.13 -2163.54 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.363298 0.001699 0.282528 0.440339 0.359998 1347.72 1363.39 1.000 r(A<->C){all} 0.116209 0.000749 0.064635 0.168813 0.113978 875.24 964.77 1.000 r(A<->G){all} 0.251020 0.001768 0.172238 0.333771 0.249345 802.50 1018.88 1.000 r(A<->T){all} 0.125457 0.001396 0.058475 0.200894 0.122553 806.53 858.02 1.001 r(C<->G){all} 0.082257 0.000387 0.048748 0.123125 0.080879 882.14 1072.08 1.000 r(C<->T){all} 0.351604 0.002375 0.259605 0.445596 0.350490 807.02 868.24 1.000 r(G<->T){all} 0.073452 0.000589 0.029195 0.122947 0.071255 1046.75 1120.89 1.001 pi(A){all} 0.231370 0.000185 0.204037 0.256641 0.231128 1004.72 1135.56 1.000 pi(C){all} 0.290933 0.000216 0.263910 0.320248 0.290691 1105.09 1120.03 1.000 pi(G){all} 0.294326 0.000205 0.266290 0.321828 0.294243 950.83 1030.82 1.000 pi(T){all} 0.183370 0.000154 0.159241 0.208771 0.183356 1132.82 1164.72 1.000 alpha{1,2} 0.070323 0.002448 0.000105 0.158017 0.062174 1147.42 1161.71 1.001 alpha{3} 2.143051 0.614045 0.741540 3.603230 2.035914 1396.58 1415.10 1.000 pinvar{all} 0.197464 0.009161 0.000826 0.357295 0.196234 1004.40 1116.07 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .**... 8 -- ...*** 9 -- ...**. 10 -- ...*.* ------------ Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 3002 1.000000 0.000000 1.000000 1.000000 2 8 3002 1.000000 0.000000 1.000000 1.000000 2 9 1493 0.497335 0.003298 0.495003 0.499667 2 10 1434 0.477682 0.001884 0.476349 0.479014 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.038676 0.000085 0.021046 0.056546 0.037952 1.000 2 length{all}[2] 0.014506 0.000024 0.005595 0.023587 0.013890 1.000 2 length{all}[3] 0.007295 0.000013 0.001145 0.014209 0.006751 1.000 2 length{all}[4] 0.031927 0.000091 0.014376 0.051145 0.031210 1.000 2 length{all}[5] 0.039812 0.000089 0.022345 0.059018 0.039106 1.001 2 length{all}[6] 0.152487 0.000765 0.101010 0.204960 0.149721 1.000 2 length{all}[7] 0.019898 0.000044 0.008391 0.033557 0.019141 1.000 2 length{all}[8] 0.046017 0.000153 0.021794 0.069367 0.045261 1.001 2 length{all}[9] 0.013299 0.000055 0.000842 0.026854 0.012251 1.001 2 length{all}[10] 0.012401 0.000051 0.000011 0.025775 0.011270 0.999 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.001295 Maximum standard deviation of split frequencies = 0.003298 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.001 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | | /------------------------------------ C4 (4) | | |----------------100----------------+------------------------------------ C5 (5) + | | \------------------------------------ C6 (6) | | /------------------------------------ C2 (2) \----------------100----------------+ \------------------------------------ C3 (3) Phylogram (based on average branch lengths): /-------------- C1 (1) | | /----------- C4 (4) | | |----------------+-------------- C5 (5) + | | \------------------------------------------------------- C6 (6) | | /----- C2 (2) \------+ \--- C3 (3) |-----------------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (3 trees sampled): 50 % credible set contains 2 trees 90 % credible set contains 2 trees 95 % credible set contains 2 trees 99 % credible set contains 3 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 6 ls = 873 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sites with gaps or missing data are removed. 9 ambiguity characters in seq. 1 9 ambiguity characters in seq. 2 9 ambiguity characters in seq. 3 15 ambiguity characters in seq. 4 18 ambiguity characters in seq. 5 15 ambiguity characters in seq. 6 6 sites are removed. 266 267 268 289 290 291 codon 263: TCC TCC TCC TCT TCC AGC codon 264: AGC AGC AGC AGC AGC TCC Sequences read.. Counting site patterns.. 0:00 159 patterns at 285 / 285 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 155184 bytes for conP 21624 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, (4, 5, 6), (2, 3)); MP score: 172 232776 bytes for conP, adjusted 0.075048 0.081158 0.086092 0.100111 0.254734 0.040332 0.031775 0.014361 0.300000 1.300000 ntime & nrate & np: 8 2 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 10 lnL0 = -2238.295687 Iterating by ming2 Initial: fx= 2238.295687 x= 0.07505 0.08116 0.08609 0.10011 0.25473 0.04033 0.03177 0.01436 0.30000 1.30000 1 h-m-p 0.0000 0.0029 262.7539 ++++YYCCCCC 2182.624934 6 0.0020 29 | 0/10 2 h-m-p 0.0001 0.0003 806.9555 +YYYCCC 2164.003867 5 0.0003 50 | 0/10 3 h-m-p 0.0000 0.0002 1634.6536 CCCCC 2159.864902 4 0.0000 71 | 0/10 4 h-m-p 0.0001 0.0007 323.1453 +YYCCCC 2146.020963 5 0.0005 93 | 0/10 5 h-m-p 0.0000 0.0002 1083.8035 YCYCCC 2138.510250 5 0.0001 114 | 0/10 6 h-m-p 0.0001 0.0007 190.1114 YCYCCC 2134.623297 5 0.0004 135 | 0/10 7 h-m-p 0.0002 0.0023 395.1811 +YCYYYYYYYY 2067.723726 10 0.0019 160 | 0/10 8 h-m-p 0.0000 0.0002 943.0720 YCCCCC 2066.143861 5 0.0000 182 | 0/10 9 h-m-p 0.0011 0.0053 14.9501 CYC 2066.107628 2 0.0003 198 | 0/10 10 h-m-p 0.0019 0.2101 1.9968 +YCCC 2065.294711 3 0.0175 217 | 0/10 11 h-m-p 0.0048 0.0301 7.2593 +YYYC 2047.084375 3 0.0178 234 | 0/10 12 h-m-p 1.0091 5.0455 0.1170 CYCCC 2040.605088 4 0.7504 254 | 0/10 13 h-m-p 0.7763 3.8814 0.0764 CCCC 2036.424089 3 1.0567 283 | 0/10 14 h-m-p 0.9448 6.0811 0.0854 CCC 2034.856622 2 1.1236 310 | 0/10 15 h-m-p 1.2740 8.0000 0.0753 +YCCC 2033.130592 3 3.8527 339 | 0/10 16 h-m-p 1.6000 8.0000 0.0841 CYCC 2032.267660 3 2.0225 367 | 0/10 17 h-m-p 1.6000 8.0000 0.0832 CCC 2031.845826 2 1.3963 394 | 0/10 18 h-m-p 1.6000 8.0000 0.0391 CC 2031.706464 1 1.7015 419 | 0/10 19 h-m-p 1.6000 8.0000 0.0088 C 2031.692998 0 1.5269 442 | 0/10 20 h-m-p 1.6000 8.0000 0.0012 C 2031.691411 0 1.4868 465 | 0/10 21 h-m-p 1.6000 8.0000 0.0010 Y 2031.691339 0 1.2601 488 | 0/10 22 h-m-p 1.6000 8.0000 0.0002 C 2031.691329 0 1.9229 511 | 0/10 23 h-m-p 1.6000 8.0000 0.0000 C 2031.691328 0 1.5504 534 | 0/10 24 h-m-p 0.6813 8.0000 0.0001 Y 2031.691327 0 1.4895 557 | 0/10 25 h-m-p 1.6000 8.0000 0.0000 C 2031.691327 0 1.5351 580 | 0/10 26 h-m-p 0.8489 8.0000 0.0000 Y 2031.691327 0 1.7760 603 | 0/10 27 h-m-p 1.6000 8.0000 0.0000 C 2031.691327 0 1.6000 626 | 0/10 28 h-m-p 1.6000 8.0000 0.0000 Y 2031.691327 0 0.2708 649 | 0/10 29 h-m-p 0.3426 8.0000 0.0000 ---------------.. | 0/10 30 h-m-p 0.0160 8.0000 0.0002 ------------- | 0/10 31 h-m-p 0.0160 8.0000 0.0002 ------------- Out.. lnL = -2031.691327 754 lfun, 754 eigenQcodon, 6032 P(t) Time used: 0:03 Model 1: NearlyNeutral TREE # 1 (1, (4, 5, 6), (2, 3)); MP score: 172 0.075048 0.081158 0.086092 0.100111 0.254734 0.040332 0.031775 0.014361 2.122147 0.786608 0.239734 ntime & nrate & np: 8 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 8.319344 np = 11 lnL0 = -2046.974690 Iterating by ming2 Initial: fx= 2046.974690 x= 0.07505 0.08116 0.08609 0.10011 0.25473 0.04033 0.03177 0.01436 2.12215 0.78661 0.23973 1 h-m-p 0.0000 0.0015 201.8772 +++YCCYYC 2009.445281 5 0.0012 38 | 0/11 2 h-m-p 0.0000 0.0002 302.7166 CYCCC 2007.821958 4 0.0001 70 | 0/11 3 h-m-p 0.0004 0.0031 48.1404 CCCC 2007.250245 3 0.0005 101 | 0/11 4 h-m-p 0.0008 0.0042 26.0181 CYC 2007.185963 2 0.0002 129 | 0/11 5 h-m-p 0.0003 0.0080 18.1018 CCC 2007.124109 2 0.0005 158 | 0/11 6 h-m-p 0.0005 0.0236 19.9572 CCC 2007.052188 2 0.0007 187 | 0/11 7 h-m-p 0.0040 0.0932 3.6052 YC 2007.016948 1 0.0024 213 | 0/11 8 h-m-p 0.0008 0.0314 11.3180 +C 2006.851461 0 0.0030 239 | 0/11 9 h-m-p 0.0006 0.0203 61.4176 +CCC 2006.185242 2 0.0023 269 | 0/11 10 h-m-p 0.0007 0.0069 208.0118 +YCCC 2004.037150 3 0.0019 300 | 0/11 11 h-m-p 0.0010 0.0048 73.8491 YCCC 2003.875925 3 0.0004 330 | 0/11 12 h-m-p 0.0171 1.3992 1.8854 ++YYCC 2002.596034 3 0.2386 361 | 0/11 13 h-m-p 1.6000 8.0000 0.1758 YC 2002.437094 1 0.6416 387 | 0/11 14 h-m-p 1.6000 8.0000 0.0359 YC 2002.429670 1 0.7474 413 | 0/11 15 h-m-p 1.6000 8.0000 0.0006 YC 2002.429370 1 0.7621 439 | 0/11 16 h-m-p 0.3671 8.0000 0.0012 Y 2002.429331 0 0.7189 464 | 0/11 17 h-m-p 1.6000 8.0000 0.0000 Y 2002.429330 0 0.8436 489 | 0/11 18 h-m-p 1.0203 8.0000 0.0000 Y 2002.429330 0 0.6895 514 | 0/11 19 h-m-p 1.6000 8.0000 0.0000 Y 2002.429330 0 0.8308 539 | 0/11 20 h-m-p 1.3088 8.0000 0.0000 Y 2002.429330 0 0.7615 564 | 0/11 21 h-m-p 1.6000 8.0000 0.0000 Y 2002.429330 0 0.3065 589 Out.. lnL = -2002.429330 590 lfun, 1770 eigenQcodon, 9440 P(t) Time used: 0:06 Model 2: PositiveSelection TREE # 1 (1, (4, 5, 6), (2, 3)); MP score: 172 initial w for M2:NSpselection reset. 0.075048 0.081158 0.086092 0.100111 0.254734 0.040332 0.031775 0.014361 2.199744 1.301606 0.304419 0.499282 2.199788 ntime & nrate & np: 8 3 13 Bounds (np=13): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 4.678105 np = 13 lnL0 = -2097.622047 Iterating by ming2 Initial: fx= 2097.622047 x= 0.07505 0.08116 0.08609 0.10011 0.25473 0.04033 0.03177 0.01436 2.19974 1.30161 0.30442 0.49928 2.19979 1 h-m-p 0.0000 0.0058 131.9314 +++YYCCC 2091.989841 4 0.0008 40 | 0/13 2 h-m-p 0.0001 0.0005 351.3267 +YYCYCCC 2080.958628 6 0.0004 79 | 0/13 3 h-m-p 0.0000 0.0002 1714.8238 ++ 2047.741867 m 0.0002 108 | 1/13 4 h-m-p 0.0002 0.0010 127.6667 YCCC 2047.270503 3 0.0002 142 | 1/13 5 h-m-p 0.0003 0.0019 65.2916 YCCC 2046.381723 3 0.0007 175 | 1/13 6 h-m-p 0.0004 0.0041 97.5129 +YCCC 2044.422739 3 0.0012 209 | 1/13 7 h-m-p 0.0007 0.0033 133.3108 CYCCC 2042.076813 4 0.0011 244 | 1/13 8 h-m-p 0.0013 0.0066 56.5290 CCCCC 2040.560038 4 0.0019 280 | 0/13 9 h-m-p 0.0004 0.0025 256.2628 YCCCC 2039.719841 4 0.0002 315 | 0/13 10 h-m-p 0.0002 0.0052 219.9852 +CYCCC 2034.697428 4 0.0016 352 | 0/13 11 h-m-p 0.0010 0.0048 40.5790 YYYC 2034.232885 3 0.0009 384 | 0/13 12 h-m-p 0.0031 0.2232 11.7151 ++YCCCCC 2013.707263 5 0.1101 424 | 0/13 13 h-m-p 0.1801 0.9003 3.6034 CYCCCC 2008.910379 5 0.3358 462 | 0/13 14 h-m-p 0.2338 1.1689 1.6848 YCCC 2005.359321 3 0.5828 496 | 0/13 15 h-m-p 0.1748 0.8742 1.2340 +YC 2004.262051 1 0.4557 527 | 0/13 16 h-m-p 0.3118 4.2631 1.8040 CYC 2003.234030 2 0.3764 559 | 0/13 17 h-m-p 1.3609 6.8045 0.0899 YCC 2002.779450 2 0.9360 591 | 0/13 18 h-m-p 0.3485 8.0000 0.2414 +YC 2002.598432 1 0.9009 622 | 0/13 19 h-m-p 0.7178 3.5891 0.2573 CCCC 2002.430449 3 1.2136 657 | 0/13 20 h-m-p 0.9139 8.0000 0.3417 CC 2002.242969 1 1.0851 688 | 0/13 21 h-m-p 1.2758 6.3792 0.2798 CCC 2002.165850 2 1.3739 721 | 0/13 22 h-m-p 1.6000 8.0000 0.0264 YC 2002.159259 1 1.1830 751 | 0/13 23 h-m-p 1.3240 8.0000 0.0236 CC 2002.155522 1 2.0231 782 | 0/13 24 h-m-p 1.6000 8.0000 0.0289 YC 2002.144201 1 3.2149 812 | 0/13 25 h-m-p 1.6000 8.0000 0.0407 CC 2002.139883 1 1.8801 843 | 0/13 26 h-m-p 1.6000 8.0000 0.0166 YC 2002.138747 1 1.1663 873 | 0/13 27 h-m-p 0.6516 8.0000 0.0297 YC 2002.138213 1 1.6068 903 | 0/13 28 h-m-p 1.6000 8.0000 0.0184 ++ 2002.134981 m 8.0000 932 | 0/13 29 h-m-p 0.5541 8.0000 0.2661 +YCY 2002.127708 2 1.6668 965 | 0/13 30 h-m-p 1.6000 8.0000 0.2219 CY 2002.120821 1 1.5181 996 | 0/13 31 h-m-p 1.6000 8.0000 0.0480 YC 2002.119276 1 0.6799 1026 | 0/13 32 h-m-p 0.1431 8.0000 0.2282 ++YCC 2002.115769 2 1.6554 1060 | 0/13 33 h-m-p 1.6000 8.0000 0.1763 YC 2002.111495 1 3.0300 1090 | 0/13 34 h-m-p 1.6000 8.0000 0.0841 YC 2002.110076 1 0.8818 1120 | 0/13 35 h-m-p 0.1820 8.0000 0.4077 +CCC 2002.108056 2 1.3224 1154 | 0/13 36 h-m-p 1.6000 8.0000 0.2483 CC 2002.106879 1 1.9306 1185 | 0/13 37 h-m-p 1.6000 8.0000 0.1943 C 2002.105892 0 1.6000 1214 | 0/13 38 h-m-p 0.5734 8.0000 0.5422 CC 2002.105415 1 0.8558 1245 | 0/13 39 h-m-p 1.3831 8.0000 0.3355 C 2002.104975 0 1.6473 1274 | 0/13 40 h-m-p 1.6000 8.0000 0.2367 YC 2002.104615 1 2.6925 1304 | 0/13 41 h-m-p 1.6000 8.0000 0.3365 YC 2002.104441 1 2.4950 1334 | 0/13 42 h-m-p 1.6000 8.0000 0.2937 C 2002.104369 0 1.8828 1363 | 0/13 43 h-m-p 1.0193 8.0000 0.5425 C 2002.104331 0 1.1691 1392 | 0/13 44 h-m-p 1.6000 8.0000 0.3814 C 2002.104309 0 1.6000 1421 | 0/13 45 h-m-p 1.4138 8.0000 0.4316 Y 2002.104294 0 2.6781 1450 | 0/13 46 h-m-p 1.6000 8.0000 0.3295 C 2002.104289 0 1.8191 1479 | 0/13 47 h-m-p 1.6000 8.0000 0.3386 Y 2002.104286 0 3.5318 1508 | 0/13 48 h-m-p 1.6000 8.0000 0.3453 C 2002.104286 0 1.8899 1537 | 0/13 49 h-m-p 1.6000 8.0000 0.3355 Y 2002.104285 0 3.3870 1566 | 0/13 50 h-m-p 1.6000 8.0000 0.3534 C 2002.104285 0 1.9766 1595 | 0/13 51 h-m-p 1.6000 8.0000 0.3309 Y 2002.104285 0 3.0711 1624 | 0/13 52 h-m-p 1.6000 8.0000 0.3558 C 2002.104285 0 2.1829 1653 | 0/13 53 h-m-p 1.6000 8.0000 0.3340 Y 2002.104285 0 2.7879 1682 | 0/13 54 h-m-p 1.6000 8.0000 0.5601 Y 2002.104285 0 3.2269 1711 | 0/13 55 h-m-p 1.6000 8.0000 0.3158 C 2002.104285 0 1.6000 1740 | 0/13 56 h-m-p 1.6000 8.0000 0.0703 Y 2002.104285 0 0.9926 1769 | 0/13 57 h-m-p 0.0039 1.9303 41.3987 --Y 2002.104285 0 0.0001 1800 | 0/13 58 h-m-p 1.6000 8.0000 0.0003 Y 2002.104285 0 3.5217 1829 | 0/13 59 h-m-p 0.0952 8.0000 0.0105 ---C 2002.104285 0 0.0004 1861 | 0/13 60 h-m-p 1.0289 8.0000 0.0000 C 2002.104285 0 0.2537 1890 | 0/13 61 h-m-p 0.0697 8.0000 0.0000 ------------Y 2002.104285 0 0.0000 1931 Out.. lnL = -2002.104285 1932 lfun, 7728 eigenQcodon, 46368 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2011.768739 S = -1908.995331 -94.129241 Calculating f(w|X), posterior probabilities of site classes. did 10 / 159 patterns 0:23 did 20 / 159 patterns 0:23 did 30 / 159 patterns 0:23 did 40 / 159 patterns 0:23 did 50 / 159 patterns 0:23 did 60 / 159 patterns 0:23 did 70 / 159 patterns 0:23 did 80 / 159 patterns 0:23 did 90 / 159 patterns 0:23 did 100 / 159 patterns 0:23 did 110 / 159 patterns 0:23 did 120 / 159 patterns 0:23 did 130 / 159 patterns 0:24 did 140 / 159 patterns 0:24 did 150 / 159 patterns 0:24 did 159 / 159 patterns 0:24 Time used: 0:24 Model 3: discrete TREE # 1 (1, (4, 5, 6), (2, 3)); MP score: 172 0.075048 0.081158 0.086092 0.100111 0.254734 0.040332 0.031775 0.014361 2.241422 0.981222 0.001362 0.061670 0.138222 0.207388 ntime & nrate & np: 8 4 14 Bounds (np=14): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 14.493942 np = 14 lnL0 = -2027.094203 Iterating by ming2 Initial: fx= 2027.094203 x= 0.07505 0.08116 0.08609 0.10011 0.25473 0.04033 0.03177 0.01436 2.24142 0.98122 0.00136 0.06167 0.13822 0.20739 1 h-m-p 0.0000 0.0006 141.8764 +++ 2017.510967 m 0.0006 34 | 1/14 2 h-m-p 0.0002 0.0010 351.6415 YYCCC 2016.731575 4 0.0001 71 | 1/14 3 h-m-p 0.0001 0.0014 146.1422 +YYCCC 2014.364146 4 0.0005 108 | 1/14 4 h-m-p 0.0003 0.0018 265.2927 YYC 2012.155166 2 0.0003 140 | 1/14 5 h-m-p 0.0005 0.0025 198.8562 CYCCC 2010.670210 4 0.0003 177 | 1/14 6 h-m-p 0.0009 0.0047 68.5930 CCCCC 2009.105949 4 0.0012 215 | 1/14 7 h-m-p 0.0002 0.0010 188.9960 +CCC 2006.252450 2 0.0008 250 | 1/14 8 h-m-p 0.0003 0.0013 33.6970 CC 2006.145147 1 0.0003 282 | 0/14 9 h-m-p 0.0003 0.0018 31.3548 YCCC 2006.079954 3 0.0002 317 | 0/14 10 h-m-p 0.0008 0.0038 7.4166 +YC 2006.022161 1 0.0023 350 | 0/14 11 h-m-p 0.0013 0.0065 5.2620 YC 2006.016411 1 0.0005 382 | 0/14 12 h-m-p 0.0080 4.0092 3.4873 ++CCC 2005.447917 2 0.1111 419 | 0/14 13 h-m-p 0.1908 0.9542 0.6702 ++ 2003.823155 m 0.9542 450 | 1/14 14 h-m-p 1.6000 8.0000 0.3565 CCC 2003.555033 2 0.5714 485 | 1/14 15 h-m-p 0.3471 4.1798 0.5870 YYC 2003.362712 2 0.2881 517 | 1/14 16 h-m-p 0.5145 8.0000 0.3287 YC 2002.903324 1 1.2196 548 | 0/14 17 h-m-p 0.0047 0.1260 84.8607 CYC 2002.816024 2 0.0014 581 | 0/14 18 h-m-p 0.5697 8.0000 0.2084 +CC 2002.272107 1 2.1844 615 | 0/14 19 h-m-p 1.6000 8.0000 0.1225 CYC 2002.133316 2 1.4032 649 | 0/14 20 h-m-p 1.1198 8.0000 0.1535 YCC 2002.109696 2 0.8721 683 | 0/14 21 h-m-p 1.6000 8.0000 0.0163 YC 2002.105748 1 1.2250 715 | 0/14 22 h-m-p 1.6000 8.0000 0.0051 CC 2002.105144 1 1.3036 748 | 0/14 23 h-m-p 1.3111 8.0000 0.0050 +YC 2002.104426 1 3.8306 781 | 0/14 24 h-m-p 1.6000 8.0000 0.0043 C 2002.104288 0 1.5773 812 | 0/14 25 h-m-p 1.6000 8.0000 0.0009 Y 2002.104285 0 1.0785 843 | 0/14 26 h-m-p 1.6000 8.0000 0.0003 Y 2002.104285 0 0.8778 874 | 0/14 27 h-m-p 1.6000 8.0000 0.0000 Y 2002.104285 0 1.1063 905 | 0/14 28 h-m-p 1.6000 8.0000 0.0000 C 2002.104285 0 0.5170 936 | 0/14 29 h-m-p 0.8579 8.0000 0.0000 -C 2002.104285 0 0.0748 968 | 0/14 30 h-m-p 0.0773 8.0000 0.0000 -----------C 2002.104285 0 0.0000 1010 Out.. lnL = -2002.104285 1011 lfun, 4044 eigenQcodon, 24264 P(t) Time used: 0:32 Model 7: beta TREE # 1 (1, (4, 5, 6), (2, 3)); MP score: 172 0.075048 0.081158 0.086092 0.100111 0.254734 0.040332 0.031775 0.014361 2.241421 1.097086 1.859473 ntime & nrate & np: 8 1 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 8.492550 np = 11 lnL0 = -2046.332578 Iterating by ming2 Initial: fx= 2046.332578 x= 0.07505 0.08116 0.08609 0.10011 0.25473 0.04033 0.03177 0.01436 2.24142 1.09709 1.85947 1 h-m-p 0.0000 0.0048 94.1357 +++YCCC 2044.593901 3 0.0004 35 | 0/11 2 h-m-p 0.0001 0.0004 103.3652 CYCCC 2044.024655 4 0.0002 67 | 0/11 3 h-m-p 0.0001 0.0009 152.4221 YCCC 2043.150582 3 0.0002 97 | 0/11 4 h-m-p 0.0002 0.0016 182.2841 +YYYC 2040.295852 3 0.0007 126 | 0/11 5 h-m-p 0.0001 0.0012 922.3223 + QuantileBeta(0.15, 0.00500, 2.35357) = 1.097586e-160 2000 rounds YYYYCYCYCC 2023.972528 10 0.0007 165 | 0/11 6 h-m-p 0.0003 0.0017 240.3857 CYCCCC 2021.203186 5 0.0005 199 | 0/11 7 h-m-p 0.0007 0.0037 40.4629 YCCC 2020.979015 3 0.0004 229 | 0/11 8 h-m-p 0.0016 0.0277 10.6427 YCCC 2020.787903 3 0.0031 259 | 0/11 9 h-m-p 0.0004 0.0297 93.7424 ++CYCCCC 2015.081724 5 0.0102 295 | 0/11 10 h-m-p 0.0006 0.0030 132.1759 YYCC 2014.741952 3 0.0005 324 | 0/11 11 h-m-p 0.0434 1.6510 1.4240 +CCCCC 2013.791415 4 0.2879 358 | 0/11 12 h-m-p 0.4722 3.0266 0.8684 CCC 2011.596802 2 0.5999 387 | 0/11 13 h-m-p 0.5535 2.7674 0.8739 CYCYC 2009.941036 4 1.2202 419 | 0/11 14 h-m-p 0.2237 1.1187 1.5780 +YYCYCCC 2006.533481 6 0.7500 454 | 0/11 15 h-m-p 0.0756 0.3779 1.5464 CYCCC 2006.243246 4 0.1131 486 | 0/11 16 h-m-p 0.2020 1.0102 0.2081 CCCCC 2005.308819 4 0.2265 519 | 0/11 17 h-m-p 0.1080 2.8092 0.4363 +YCCC 2004.306192 3 0.3187 550 | 0/11 18 h-m-p 1.3333 6.6663 0.0536 CCCCC 2003.675189 4 1.7606 583 | 0/11 19 h-m-p 1.6000 8.0000 0.0417 YCC 2003.611971 2 1.2741 611 | 0/11 20 h-m-p 1.6000 8.0000 0.0077 YC 2003.608045 1 0.8825 637 | 0/11 21 h-m-p 1.6000 8.0000 0.0024 YC 2003.607861 1 1.0185 663 | 0/11 22 h-m-p 1.6000 8.0000 0.0005 Y 2003.607857 0 1.0326 688 | 0/11 23 h-m-p 1.6000 8.0000 0.0000 Y 2003.607857 0 1.0488 713 | 0/11 24 h-m-p 1.6000 8.0000 0.0000 Y 2003.607857 0 0.9222 738 | 0/11 25 h-m-p 1.6000 8.0000 0.0000 Y 2003.607857 0 0.2955 763 | 0/11 26 h-m-p 0.3894 8.0000 0.0000 Y 2003.607857 0 0.3894 788 | 0/11 27 h-m-p 0.6626 8.0000 0.0000 -----C 2003.607857 0 0.0002 818 Out.. lnL = -2003.607857 819 lfun, 9009 eigenQcodon, 65520 P(t) Time used: 0:56 Model 8: beta&w>1 TREE # 1 (1, (4, 5, 6), (2, 3)); MP score: 172 initial w for M8:NSbetaw>1 reset. 0.075048 0.081158 0.086092 0.100111 0.254734 0.040332 0.031775 0.014361 2.182212 0.900000 0.702842 1.818396 2.798628 ntime & nrate & np: 8 2 13 Bounds (np=13): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 6.875438 np = 13 lnL0 = -2042.193683 Iterating by ming2 Initial: fx= 2042.193683 x= 0.07505 0.08116 0.08609 0.10011 0.25473 0.04033 0.03177 0.01436 2.18221 0.90000 0.70284 1.81840 2.79863 1 h-m-p 0.0000 0.0005 256.9397 +++ 2032.136272 m 0.0005 32 | 0/13 2 h-m-p 0.0000 0.0000 111.5576 h-m-p: 0.00000000e+00 0.00000000e+00 1.11557575e+02 2032.136272 .. | 0/13 3 h-m-p 0.0000 0.0002 233.3053 ++YYYYC 2027.330614 4 0.0002 93 | 0/13 4 h-m-p 0.0002 0.0009 111.9607 CCCC 2026.265136 3 0.0002 128 | 0/13 5 h-m-p 0.0001 0.0007 120.7568 +YCCC 2024.414974 3 0.0004 163 | 0/13 6 h-m-p 0.0002 0.0027 223.8286 +YYCCC 2019.980213 4 0.0007 199 | 0/13 7 h-m-p 0.0002 0.0009 563.9503 YCYCCC 2009.616542 5 0.0005 236 | 0/13 8 h-m-p 0.0002 0.0011 227.7545 YCC 2008.825779 2 0.0002 268 | 0/13 9 h-m-p 0.0008 0.0041 26.4485 CC 2008.759697 1 0.0002 299 | 0/13 10 h-m-p 0.0009 0.1148 6.7520 ++YCCC 2008.507062 3 0.0096 335 | 0/13 11 h-m-p 0.0007 0.0069 90.1710 YCC 2008.372425 2 0.0004 367 | 0/13 12 h-m-p 0.0011 0.0513 34.3533 +YCCC 2007.591943 3 0.0069 402 | 0/13 13 h-m-p 0.0005 0.0058 480.0680 CYC 2006.767119 2 0.0005 434 | 0/13 14 h-m-p 0.1355 0.9466 1.8747 +CYCCC 2003.761517 4 0.6004 471 | 0/13 15 h-m-p 0.5373 2.6863 0.9787 YCCC 2003.301116 3 0.2929 505 | 0/13 16 h-m-p 0.5924 3.3839 0.4839 YCY 2003.040313 2 0.3328 537 | 0/13 17 h-m-p 0.3227 1.6352 0.4991 YCCC 2002.786010 3 0.5851 571 | 0/13 18 h-m-p 1.6000 8.0000 0.0968 CCC 2002.618077 2 1.2730 604 | 0/13 19 h-m-p 0.8701 4.6232 0.1417 CCC 2002.578838 2 0.9841 637 | 0/13 20 h-m-p 1.6000 8.0000 0.0206 CC 2002.568195 1 1.3908 668 | 0/13 21 h-m-p 0.9213 8.0000 0.0311 +YC 2002.561779 1 2.6405 699 | 0/13 22 h-m-p 1.6000 8.0000 0.0283 +CC 2002.552442 1 5.6306 731 | 0/13 23 h-m-p 1.3718 8.0000 0.1162 ++ 2002.481344 m 8.0000 760 | 0/13 24 h-m-p 0.7990 8.0000 1.1637 +CCC 2002.365479 2 2.9742 794 | 0/13 25 h-m-p 1.6000 8.0000 0.8183 CC 2002.316289 1 1.8788 825 | 0/13 26 h-m-p 0.9497 8.0000 1.6188 YC 2002.283192 1 1.6954 855 | 0/13 27 h-m-p 1.2500 8.0000 2.1956 YCC 2002.243454 2 2.2791 887 | 0/13 28 h-m-p 1.6000 8.0000 2.5554 CCC 2002.213836 2 2.1713 920 | 0/13 29 h-m-p 1.5075 8.0000 3.6806 YCC 2002.191179 2 2.4637 952 | 0/13 30 h-m-p 1.6000 8.0000 4.6552 YCC 2002.171962 2 3.1689 984 | 0/13 31 h-m-p 1.6000 8.0000 6.5893 YC 2002.159303 1 2.9779 1014 | 0/13 32 h-m-p 0.6926 3.4630 9.5575 +YC 2002.150420 1 3.0478 1045 | 0/13 33 h-m-p 0.0583 0.2916 13.6091 ++ 2002.149191 m 0.2916 1074 | 1/13 34 h-m-p 0.0485 8.0000 3.5906 --------------.. | 1/13 35 h-m-p 0.0000 0.0076 3.1681 +YC 2002.148632 1 0.0001 1145 | 1/13 36 h-m-p 0.0001 0.0424 2.3869 C 2002.148386 0 0.0001 1173 | 1/13 37 h-m-p 0.0003 0.0638 1.1554 C 2002.148272 0 0.0002 1201 | 1/13 38 h-m-p 0.0011 0.5622 0.3082 C 2002.148255 0 0.0004 1229 | 1/13 39 h-m-p 0.0016 0.8196 0.2388 Y 2002.148240 0 0.0008 1257 | 1/13 40 h-m-p 0.0075 3.7264 0.5791 YC 2002.147606 1 0.0157 1286 | 1/13 41 h-m-p 0.0005 0.2012 16.9374 +YC 2002.143275 1 0.0037 1316 | 1/13 42 h-m-p 0.0011 0.0596 55.8108 YC 2002.139893 1 0.0009 1345 | 1/13 43 h-m-p 0.0051 0.2767 9.5661 YC 2002.139294 1 0.0009 1374 | 1/13 44 h-m-p 0.0011 0.3393 8.0154 C 2002.138668 0 0.0012 1402 | 1/13 45 h-m-p 0.0119 1.9154 0.7786 ++CC 2002.126801 1 0.2427 1434 | 1/13 46 h-m-p 1.4952 8.0000 0.1264 -CC 2002.126210 1 0.1186 1465 | 1/13 47 h-m-p 1.6000 8.0000 0.0023 Y 2002.126170 0 1.0200 1493 | 1/13 48 h-m-p 1.6000 8.0000 0.0008 Y 2002.126170 0 1.0139 1521 | 1/13 49 h-m-p 1.6000 8.0000 0.0000 Y 2002.126170 0 0.9944 1549 | 1/13 50 h-m-p 1.6000 8.0000 0.0000 C 2002.126170 0 0.3690 1577 Out.. lnL = -2002.126170 1578 lfun, 18936 eigenQcodon, 138864 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2012.155190 S = -1909.012280 -95.281433 Calculating f(w|X), posterior probabilities of site classes. did 10 / 159 patterns 1:46 did 20 / 159 patterns 1:46 did 30 / 159 patterns 1:47 did 40 / 159 patterns 1:47 did 50 / 159 patterns 1:47 did 60 / 159 patterns 1:47 did 70 / 159 patterns 1:47 did 80 / 159 patterns 1:48 did 90 / 159 patterns 1:48 did 100 / 159 patterns 1:48 did 110 / 159 patterns 1:48 did 120 / 159 patterns 1:48 did 130 / 159 patterns 1:49 did 140 / 159 patterns 1:49 did 150 / 159 patterns 1:49 did 159 / 159 patterns 1:49 Time used: 1:49 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=291 D_melanogaster_Reep1-PG MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC D_sechellia_Reep1-PG MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC D_simulans_Reep1-PG MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC D_yakuba_Reep1-PG MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC D_erecta_Reep1-PG MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC D_biarmipes_Reep1-PG MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC ************************************************** D_melanogaster_Reep1-PG IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE D_sechellia_Reep1-PG IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE D_simulans_Reep1-PG IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE D_yakuba_Reep1-PG IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE D_erecta_Reep1-PG IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE D_biarmipes_Reep1-PG IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE ************************************************** D_melanogaster_Reep1-PG QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH D_sechellia_Reep1-PG QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH D_simulans_Reep1-PG QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH D_yakuba_Reep1-PG QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH D_erecta_Reep1-PG QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTTPSGD D_biarmipes_Reep1-PG QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGQ *********************************************:***. D_melanogaster_Reep1-PG GRGLQNSHSADELYRGQDTMDSTENWLPRASSLSSIESYTETIYEPRTET D_sechellia_Reep1-PG GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTDT D_simulans_Reep1-PG GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTET D_yakuba_Reep1-PG GRGLQNSHSANELSRDQDMMDSTDNWLPRASSLSSIESYTETIYEPRAET D_erecta_Reep1-PG GRGLQNSHSANELSRGQDVMDSTDNWLPRASSLSSIESYAETIYEPRAET D_biarmipes_Reep1-PG GRGLQNSHSADELYRGQDTMDSTDNWLPRASSLSSIDSYTENIYEPRAET **********:** *.** ****:************:**:*.*****::* D_melanogaster_Reep1-PG KRLVIREVSEEAEFDDDPLGDAGAARLRDMPVRKAQPRRAASTAKAAGKR D_sechellia_Reep1-PG RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKTQPRRAATTAKATDKR D_simulans_Reep1-PG RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKAQPRRAASTAKAAGKR D_yakuba_Reep1-PG RRLVIREVSEEVEHEDEPLGDAGAARLRDLPVRKAQPRRAAGTARAAGKR D_erecta_Reep1-PG RRLIIREVREEVEQEDEPLGDAGAARLRDLPARKAQPRRAAGTARAAGKR D_biarmipes_Reep1-PG RRLVIREVSEEVEQEDEPTGDAGAARLRDLPVRKAQPRRAAGTARTGGKR :**:**** **.* :*:* *******:**:*.**:****** **:: .** D_melanogaster_Reep1-PG GQKHNDIEGARSSSSSSNVIRSRRKLREPTPDVDVENY--- D_sechellia_Reep1-PG GQKQNDMKGAKSSSNTINVIRSRRKLREPTPDVDVETY--- D_simulans_Reep1-PG GQKQNDVEGAKSSSSTINVIRSRRKLREPTPDVDVETY--- D_yakuba_Reep1-PG GQKNNDMEAAGSSSSS--VIRSRRKLRDPTPDVDVENYoo- D_erecta_Reep1-PG GQKNNDMEAAGSSSN---VIRSRRKLRDPTPDVDVENYooo D_biarmipes_Reep1-PG GQKNNDTEAAAGSSTN--VIRSRRKLRDPTPDVDVENYoo- ***:** :.* .**. *********:********.*
>D_melanogaster_Reep1-PG ATGATCAGCAGCCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTACCCGGCATATGCCTCATACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACCTGC ATAGAAACATTCACGGACATATTTATCTCCTGGCTACCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTCTGGCTCCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTGTATCGCAAATTCGTGCATCCTATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAATCAGGCCAAAGAGCGCGGCTATTCGGC GGTCCTGCAGCTGGGCTCCAAGGGAGTAAACTATGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTACGCGCTGACTACGGCGCCATCTGGCCAT GGACGCGGCCTGCAAAACTCCCATTCGGCCGATGAGCTGTACAGGGGCCA GGATACGATGGACAGCACGGAAAACTGGCTGCCGCGAGCCAGTTCCTTGA GCAGCATCGAGAGCTACACAGAGACGATCTACGAGCCGAGGACCGAGACC AAGCGACTGGTTATTCGAGAGGTTAGCGAGGAGGCGGAGTTCGATGATGA TCCCCTGGGCGATGCCGGAGCAGCCCGTCTCCGGGACATGCCCGTCCGGA AGGCACAACCACGTCGGGCTGCTAGCACTGCCAAGGCTGCAGGCAAACGC GGCCAGAAACACAACGATATTGAGGGCGCCAGGAGCTCCAGCAGCTCCAG CAATGTGATCCGCTCCCGCCGCAAGCTGCGCGAACCCACGCCCGATGTGG ATGTGGAAAACTAC--------- >D_sechellia_Reep1-PG ATGATCAGCAGCCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTACCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACATGC ATAGAAACATTCACGGACATATTCATCTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTCTGGCTTCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTGTATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAATCAGGCCAAAGAGCGGGGCTATTCGGC GGTGCTGCAGCTGGGCTCCAAGGGAGTAAACTATGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTACGCGCTGACCACGGCACCATCTGGCCAT GGACGCGGCCTGCAGAACTCCCATTCGGCCGATGAGCTGTTCCGGGGCCA GGACACAATGGACAGCACGGACAATTGGCTGCCGCGGGCCAGTTCCTTGA GCAGCATCGAGAGCTACACGGAGACGATCTACGAGCCGAGGACCGACACC AGGCGACTGATTATTCGAGAGGTTAGCGAGGAAGCGGAGCTCGATGATGA GCCCCTGGGCGATGCCGGAGCAGCCCGTATCCGGGACTTGCCCGTCCGGA AGACACAACCACGTCGTGCTGCTACCACTGCCAAGGCTACAGACAAACGC GGCCAGAAACAGAACGATATGAAGGGAGCCAAGAGCTCCAGCAACACCAT CAATGTGATCCGCTCCCGCCGCAAGCTGCGCGAACCCACGCCCGATGTGG ATGTGGAAACCTAC--------- >D_simulans_Reep1-PG ATGATCAGCAGCCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTACCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACATGC ATAGAAACATTCACGGACATATTCATCTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTCTGGCTCCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTATATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAATCAGGCCAAAGAGCGGGGCTATTCGGC GGTGCTGCAGCTGGGCTCCAAGGGAGTAAACTATGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTACGCGCTGACCACGGCACCATCTGGCCAT GGACGCGGCCTGCAGAACTCCCATTCGGCCGATGAGCTGTTCCGGGGCCA GGACACAATGGACAGCACGGACAATTGGCTGCCGCGGGCCAGTTCCTTGA GCAGCATCGAGAGCTACACGGAGACGATCTACGAGCCGAGGACCGAGACC AGGCGACTGATTATTCGAGAGGTTAGCGAGGAGGCGGAGCTCGATGATGA GCCCCTGGGCGATGCCGGGGCAGCCCGTATCCGGGACTTGCCCGTCCGGA AGGCACAACCACGTCGTGCTGCCAGCACTGCCAAGGCTGCAGGCAAACGC GGCCAGAAACAGAACGATGTGGAGGGAGCCAAGAGCTCCAGCAGCACCAT CAATGTGATCCGCTCCCGCCGCAAGCTGCGCGAACCCACGCCCGATGTGG ATGTGGAAACCTAC--------- >D_yakuba_Reep1-PG ATGATCAGCAGTCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTATCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACCTGC ATAGAAACATTCACGGACATATTCATTTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTTTGGCTCCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTGTATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAACCAGGCCAAAGAGCGGGGCTATTCGGC GGTCCTGCAGCTGGGCTCCAAGGGAGTAAACTACGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTATGCGCTGACCACGGCGCCATCTGGCCAT GGACGCGGCCTGCAGAACTCCCATTCCGCGAATGAGCTGTCCCGGGACCA GGACATGATGGACAGCACGGACAACTGGCTGCCGAGGGCCAGTTCCCTGA GCAGCATCGAGAGCTACACGGAGACGATCTACGAGCCGAGAGCCGAGACC AGGCGACTGGTTATTCGGGAGGTCAGCGAGGAGGTGGAGCACGAAGATGA GCCCCTGGGCGATGCCGGAGCAGCACGTCTCCGAGACTTGCCTGTCCGGA AGGCTCAGCCACGTCGTGCCGCAGGTACCGCCAGAGCTGCGGGCAAACGT GGCCAGAAAAACAACGATATGGAGGCCGCCGGAAGCTCTAGCTCCAGT-- ----GTGATCCGCTCCCGGCGCAAGCTGCGCGATCCCACACCCGATGTGG ATGTGGAAAACTAC--------- >D_erecta_Reep1-PG ATGATCAGCAGTCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTACCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTTACCTGC ATAGAAACATTCACGGATATATTCATCTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTCTGGCTCCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTGTATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTAAATCAGGCCAAAGAGCGGGGCTATTCGGC GGTCCTGCAGCTGGGTTCGAAGGGAGTAAACTATGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTATGCGCTGACCACAACGCCATCTGGCGAT GGACGCGGCCTGCAAAACTCCCATTCGGCCAATGAGCTGTCCCGGGGTCA GGACGTGATGGACAGCACGGACAACTGGCTGCCGAGGGCCAGTTCCCTGA GCAGCATCGAGAGCTACGCGGAGACGATCTATGAGCCGAGGGCCGAGACC AGGCGACTGATTATTCGAGAGGTTAGAGAGGAGGTGGAGCAGGAAGATGA GCCCCTGGGCGATGCCGGAGCAGCACGTCTACGAGACTTGCCTGCTCGGA AGGCTCAACCACGTCGTGCTGCAGGCACCGCCAGAGCTGCAGGCAAGCGC GGCCAGAAAAACAACGATATGGAGGCCGCCGGCAGCTCCAGCAAT----- ----GTGATCCGCTCCCGGCGCAAGTTGCGCGATCCCACGCCCGATGTGG ATGTGGAAAACTAC--------- >D_biarmipes_Reep1-PG ATGATCAGCAGCCTGTTCTCGCGGCTTATCATATTGTTCTGCGGCACCCT GTACCCGGCCTACGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTAAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACCTGC ATCGAAACATTCACGGACATCTTCATCTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTCTTCTGGCTCCTCTCGCCGGCCACTAAGGGCA GTTCGACGCTGTATCGCAAGTTCGTGCACCCCATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAACCAGGCCAAGGAGCGGGGCTATTCGGC GGTCCTGCAGCTGGGCTCCAAGGGAGTCAACTATGCCACCAATGTGCTCA TGCAGACGGCCATCAAGACCTATGCGCTGACCACGGCTCCATCGGGCCAG GGACGTGGCCTGCAGAACTCCCATTCGGCGGACGAGCTGTACCGGGGCCA GGACACGATGGACAGCACGGACAACTGGCTGCCGCGGGCCAGTTCCCTGA GCAGCATCGACAGCTATACGGAGAACATCTACGAGCCGAGGGCCGAGACC AGGCGCCTGGTCATCCGTGAGGTGTCCGAGGAGGTTGAGCAGGAAGATGA GCCCACGGGTGATGCCGGAGCAGCCAGGCTGCGGGACCTGCCGGTCCGGA AGGCGCAGCCACGTCGCGCCGCAGGCACCGCCAGAACTGGAGGCAAACGT GGCCAGAAAAACAACGATACAGAAGCCGCCGCCGGCAGCTCCACCAAT-- ----GTGATCCGGTCGCGCCGCAAGCTGCGCGATCCCACGCCCGATGTGG ACGTGGAGAACTAC---------
>D_melanogaster_Reep1-PG MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELYRGQDTMDSTENWLPRASSLSSIESYTETIYEPRTET KRLVIREVSEEAEFDDDPLGDAGAARLRDMPVRKAQPRRAASTAKAAGKR GQKHNDIEGARSSSSSSNVIRSRRKLREPTPDVDVENY >D_sechellia_Reep1-PG MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTDT RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKTQPRRAATTAKATDKR GQKQNDMKGAKSSSNTINVIRSRRKLREPTPDVDVETY >D_simulans_Reep1-PG MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTET RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKAQPRRAASTAKAAGKR GQKQNDVEGAKSSSSTINVIRSRRKLREPTPDVDVETY >D_yakuba_Reep1-PG MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSANELSRDQDMMDSTDNWLPRASSLSSIESYTETIYEPRAET RRLVIREVSEEVEHEDEPLGDAGAARLRDLPVRKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSSS--VIRSRRKLRDPTPDVDVENY >D_erecta_Reep1-PG MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTTPSGD GRGLQNSHSANELSRGQDVMDSTDNWLPRASSLSSIESYAETIYEPRAET RRLIIREVREEVEQEDEPLGDAGAARLRDLPARKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSN---VIRSRRKLRDPTPDVDVENY >D_biarmipes_Reep1-PG MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGQ GRGLQNSHSADELYRGQDTMDSTDNWLPRASSLSSIDSYTENIYEPRAET RRLVIREVSEEVEQEDEPTGDAGAARLRDLPVRKAQPRRAAGTARTGGKR GQKNNDTEAAAGSSTN--VIRSRRKLRDPTPDVDVENY
#NEXUS [ID: 3029658123] begin taxa; dimensions ntax=6; taxlabels D_melanogaster_Reep1-PG D_sechellia_Reep1-PG D_simulans_Reep1-PG D_yakuba_Reep1-PG D_erecta_Reep1-PG D_biarmipes_Reep1-PG ; end; begin trees; translate 1 D_melanogaster_Reep1-PG, 2 D_sechellia_Reep1-PG, 3 D_simulans_Reep1-PG, 4 D_yakuba_Reep1-PG, 5 D_erecta_Reep1-PG, 6 D_biarmipes_Reep1-PG ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.03795193,(4:0.03120983,5:0.03910559,6:0.1497212)1.000:0.04526134,(2:0.01389011,3:0.006750928)1.000:0.01914144); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.03795193,(4:0.03120983,5:0.03910559,6:0.1497212):0.04526134,(2:0.01389011,3:0.006750928):0.01914144); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2153.04 -2162.57 2 -2153.23 -2164.02 -------------------------------------- TOTAL -2153.13 -2163.54 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/367/Reep1-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.363298 0.001699 0.282528 0.440339 0.359998 1347.72 1363.39 1.000 r(A<->C){all} 0.116209 0.000749 0.064635 0.168813 0.113978 875.24 964.77 1.000 r(A<->G){all} 0.251020 0.001768 0.172238 0.333771 0.249345 802.50 1018.88 1.000 r(A<->T){all} 0.125457 0.001396 0.058475 0.200894 0.122553 806.53 858.02 1.001 r(C<->G){all} 0.082257 0.000387 0.048748 0.123125 0.080879 882.14 1072.08 1.000 r(C<->T){all} 0.351604 0.002375 0.259605 0.445596 0.350490 807.02 868.24 1.000 r(G<->T){all} 0.073452 0.000589 0.029195 0.122947 0.071255 1046.75 1120.89 1.001 pi(A){all} 0.231370 0.000185 0.204037 0.256641 0.231128 1004.72 1135.56 1.000 pi(C){all} 0.290933 0.000216 0.263910 0.320248 0.290691 1105.09 1120.03 1.000 pi(G){all} 0.294326 0.000205 0.266290 0.321828 0.294243 950.83 1030.82 1.000 pi(T){all} 0.183370 0.000154 0.159241 0.208771 0.183356 1132.82 1164.72 1.000 alpha{1,2} 0.070323 0.002448 0.000105 0.158017 0.062174 1147.42 1161.71 1.001 alpha{3} 2.143051 0.614045 0.741540 3.603230 2.035914 1396.58 1415.10 1.000 pinvar{all} 0.197464 0.009161 0.000826 0.357295 0.196234 1004.40 1116.07 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/367/Reep1-PG/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 285 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 4 3 3 4 4 2 | Ser TCT 1 1 1 2 1 0 | Tyr TAT 5 5 5 6 7 6 | Cys TGT 0 0 0 0 0 0 TTC 7 8 8 6 6 8 | TCC 6 7 7 9 7 7 | TAC 11 10 10 9 8 10 | TGC 2 2 2 2 2 2 Leu TTA 0 0 1 0 0 0 | TCA 1 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 4 5 4 4 5 2 | TCG 5 5 5 4 6 7 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 1 2 1 1 1 1 | Pro CCT 1 0 0 1 1 0 | His CAT 3 3 3 3 2 1 | Arg CGT 2 3 3 4 3 4 CTC 4 3 4 4 3 3 | CCC 4 4 4 3 3 4 | CAC 2 1 1 2 1 2 | CGC 9 8 8 6 7 7 CTA 1 0 0 0 1 0 | CCA 2 2 2 2 2 2 | Gln CAA 2 1 1 0 2 0 | CGA 3 2 2 2 3 0 CTG 12 13 13 14 13 16 | CCG 5 6 6 6 6 6 | CAG 6 8 8 8 7 10 | CGG 4 6 6 6 5 7 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 3 3 3 3 3 1 | Thr ACT 3 2 2 1 1 2 | Asn AAT 2 3 3 2 4 1 | Ser AGT 2 2 2 3 3 2 ATC 7 8 8 6 7 11 | ACC 7 9 8 8 8 9 | AAC 5 4 3 7 6 8 | AGC 11 9 11 8 7 7 ATA 4 4 4 4 4 1 | ACA 3 6 4 3 3 2 | Lys AAA 5 5 5 5 4 3 | Arg AGA 0 0 0 2 2 1 Met ATG 7 7 6 8 7 6 | ACG 8 8 8 7 7 10 | AAG 11 12 11 9 10 11 | AGG 4 3 3 3 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 3 2 2 2 2 1 | Ala GCT 3 3 2 2 4 1 | Asp GAT 10 8 8 7 9 6 | Gly GGT 0 0 0 1 2 1 GTC 6 5 5 7 5 8 | GCC 13 14 15 15 15 17 | GAC 4 8 6 7 5 9 | GGC 11 9 10 9 10 11 GTA 1 1 1 1 2 1 | GCA 5 3 5 4 5 3 | Glu GAA 6 6 5 5 5 5 | GGA 3 4 3 4 3 4 GTG 8 9 10 9 9 9 | GCG 4 3 3 5 3 4 | GAG 14 12 15 15 15 14 | GGG 0 0 1 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: D_melanogaster_Reep1-PG position 1: T:0.17895 C:0.21404 A:0.28772 G:0.31930 position 2: T:0.25263 C:0.24912 A:0.30175 G:0.19649 position 3: T:0.15088 C:0.38246 A:0.12632 G:0.34035 Average T:0.19415 C:0.28187 A:0.23860 G:0.28538 #2: D_sechellia_Reep1-PG position 1: T:0.17895 C:0.21754 A:0.29825 G:0.30526 position 2: T:0.25614 C:0.25614 A:0.30175 G:0.18596 position 3: T:0.14035 C:0.38246 A:0.11930 G:0.35789 Average T:0.19181 C:0.28538 A:0.23977 G:0.28304 #3: D_simulans_Reep1-PG position 1: T:0.17895 C:0.21754 A:0.28421 G:0.31930 position 2: T:0.25614 C:0.25263 A:0.29474 G:0.19649 position 3: T:0.13333 C:0.38596 A:0.11579 G:0.36491 Average T:0.18947 C:0.28538 A:0.23158 G:0.29357 #4: D_yakuba_Reep1-PG position 1: T:0.17895 C:0.21754 A:0.27719 G:0.32632 position 2: T:0.25614 C:0.25263 A:0.29825 G:0.19298 position 3: T:0.14737 C:0.37895 A:0.11228 G:0.36140 Average T:0.19415 C:0.28304 A:0.22924 G:0.29357 #5: D_erecta_Reep1-PG position 1: T:0.17895 C:0.21053 A:0.28070 G:0.32982 position 2: T:0.25263 C:0.25263 A:0.29825 G:0.19649 position 3: T:0.16491 C:0.35088 A:0.12632 G:0.35789 Average T:0.19883 C:0.27135 A:0.23509 G:0.29474 #6: D_biarmipes_Reep1-PG position 1: T:0.17193 C:0.22105 A:0.27719 G:0.32982 position 2: T:0.24561 C:0.25965 A:0.30175 G:0.19298 position 3: T:0.10175 C:0.43158 A:0.07719 G:0.38947 Average T:0.17310 C:0.30409 A:0.21871 G:0.30409 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 20 | Ser S TCT 6 | Tyr Y TAT 34 | Cys C TGT 0 TTC 43 | TCC 43 | TAC 58 | TGC 12 Leu L TTA 1 | TCA 1 | *** * TAA 0 | *** * TGA 0 TTG 24 | TCG 32 | TAG 0 | Trp W TGG 30 ------------------------------------------------------------------------------ Leu L CTT 7 | Pro P CCT 3 | His H CAT 15 | Arg R CGT 19 CTC 21 | CCC 22 | CAC 9 | CGC 45 CTA 2 | CCA 12 | Gln Q CAA 6 | CGA 12 CTG 81 | CCG 35 | CAG 47 | CGG 34 ------------------------------------------------------------------------------ Ile I ATT 16 | Thr T ACT 11 | Asn N AAT 15 | Ser S AGT 14 ATC 47 | ACC 49 | AAC 33 | AGC 53 ATA 21 | ACA 21 | Lys K AAA 27 | Arg R AGA 5 Met M ATG 41 | ACG 48 | AAG 64 | AGG 21 ------------------------------------------------------------------------------ Val V GTT 12 | Ala A GCT 15 | Asp D GAT 48 | Gly G GGT 4 GTC 36 | GCC 89 | GAC 39 | GGC 60 GTA 7 | GCA 25 | Glu E GAA 32 | GGA 21 GTG 54 | GCG 22 | GAG 85 | GGG 1 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.17778 C:0.21637 A:0.28421 G:0.32164 position 2: T:0.25322 C:0.25380 A:0.29942 G:0.19357 position 3: T:0.13977 C:0.38538 A:0.11287 G:0.36199 Average T:0.19025 C:0.28519 A:0.23216 G:0.29240 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_Reep1-PG D_sechellia_Reep1-PG 0.2738 (0.0299 0.1092) D_simulans_Reep1-PG 0.1667 (0.0195 0.1173) 0.5097 (0.0125 0.0245) D_yakuba_Reep1-PG 0.1430 (0.0347 0.2431) 0.2117 (0.0437 0.2066) 0.1730 (0.0356 0.2059) D_erecta_Reep1-PG 0.2123 (0.0445 0.2098) 0.2572 (0.0484 0.1883) 0.2232 (0.0419 0.1877) 0.1003 (0.0172 0.1716) D_biarmipes_Reep1-PG 0.1471 (0.0551 0.3748) 0.1969 (0.0672 0.3415) 0.1701 (0.0583 0.3428) 0.1159 (0.0382 0.3294) 0.1182 (0.0456 0.3857) Model 0: one-ratio TREE # 1: (1, (4, 5, 6), (2, 3)); MP score: 172 check convergence.. lnL(ntime: 8 np: 10): -2031.691327 +0.000000 7..1 7..8 8..4 8..5 8..6 7..9 9..2 9..3 0.074387 0.107656 0.074226 0.090405 0.287708 0.042303 0.032720 0.013801 2.122147 0.123340 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.72321 (1: 0.074387, (4: 0.074226, 5: 0.090405, 6: 0.287708): 0.107656, (2: 0.032720, 3: 0.013801): 0.042303); (D_melanogaster_Reep1-PG: 0.074387, (D_yakuba_Reep1-PG: 0.074226, D_erecta_Reep1-PG: 0.090405, D_biarmipes_Reep1-PG: 0.287708): 0.107656, (D_sechellia_Reep1-PG: 0.032720, D_simulans_Reep1-PG: 0.013801): 0.042303); Detailed output identifying parameters kappa (ts/tv) = 2.12215 omega (dN/dS) = 0.12334 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.074 679.9 175.1 0.1233 0.0101 0.0819 6.9 14.3 7..8 0.108 679.9 175.1 0.1233 0.0146 0.1185 9.9 20.7 8..4 0.074 679.9 175.1 0.1233 0.0101 0.0817 6.9 14.3 8..5 0.090 679.9 175.1 0.1233 0.0123 0.0995 8.3 17.4 8..6 0.288 679.9 175.1 0.1233 0.0391 0.3167 26.6 55.4 7..9 0.042 679.9 175.1 0.1233 0.0057 0.0466 3.9 8.2 9..2 0.033 679.9 175.1 0.1233 0.0044 0.0360 3.0 6.3 9..3 0.014 679.9 175.1 0.1233 0.0019 0.0152 1.3 2.7 tree length for dN: 0.0982 tree length for dS: 0.7961 Time used: 0:03 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, (4, 5, 6), (2, 3)); MP score: 172 lnL(ntime: 8 np: 11): -2002.429330 +0.000000 7..1 7..8 8..4 8..5 8..6 7..9 9..2 9..3 0.078465 0.110142 0.077165 0.091260 0.315015 0.041528 0.033303 0.014064 2.199744 0.891271 0.031949 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.76094 (1: 0.078465, (4: 0.077165, 5: 0.091260, 6: 0.315015): 0.110142, (2: 0.033303, 3: 0.014064): 0.041528); (D_melanogaster_Reep1-PG: 0.078465, (D_yakuba_Reep1-PG: 0.077165, D_erecta_Reep1-PG: 0.091260, D_biarmipes_Reep1-PG: 0.315015): 0.110142, (D_sechellia_Reep1-PG: 0.033303, D_simulans_Reep1-PG: 0.014064): 0.041528); Detailed output identifying parameters kappa (ts/tv) = 2.19974 dN/dS (w) for site classes (K=2) p: 0.89127 0.10873 w: 0.03195 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.078 679.3 175.7 0.1372 0.0114 0.0832 7.8 14.6 7..8 0.110 679.3 175.7 0.1372 0.0160 0.1167 10.9 20.5 8..4 0.077 679.3 175.7 0.1372 0.0112 0.0818 7.6 14.4 8..5 0.091 679.3 175.7 0.1372 0.0133 0.0967 9.0 17.0 8..6 0.315 679.3 175.7 0.1372 0.0458 0.3339 31.1 58.7 7..9 0.042 679.3 175.7 0.1372 0.0060 0.0440 4.1 7.7 9..2 0.033 679.3 175.7 0.1372 0.0048 0.0353 3.3 6.2 9..3 0.014 679.3 175.7 0.1372 0.0020 0.0149 1.4 2.6 Time used: 0:06 Model 2: PositiveSelection (3 categories) TREE # 1: (1, (4, 5, 6), (2, 3)); MP score: 172 lnL(ntime: 8 np: 13): -2002.104285 +0.000000 7..1 7..8 8..4 8..5 8..6 7..9 9..2 9..3 0.079345 0.110642 0.078204 0.091365 0.319990 0.041316 0.033469 0.014086 2.241422 0.910700 0.000000 0.038841 1.289521 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.76842 (1: 0.079345, (4: 0.078204, 5: 0.091365, 6: 0.319990): 0.110642, (2: 0.033469, 3: 0.014086): 0.041316); (D_melanogaster_Reep1-PG: 0.079345, (D_yakuba_Reep1-PG: 0.078204, D_erecta_Reep1-PG: 0.091365, D_biarmipes_Reep1-PG: 0.319990): 0.110642, (D_sechellia_Reep1-PG: 0.033469, D_simulans_Reep1-PG: 0.014086): 0.041316); Detailed output identifying parameters kappa (ts/tv) = 2.24142 dN/dS (w) for site classes (K=3) p: 0.91070 0.00000 0.08930 w: 0.03884 1.00000 1.28952 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.079 679.0 176.0 0.1505 0.0122 0.0813 8.3 14.3 7..8 0.111 679.0 176.0 0.1505 0.0171 0.1133 11.6 19.9 8..4 0.078 679.0 176.0 0.1505 0.0121 0.0801 8.2 14.1 8..5 0.091 679.0 176.0 0.1505 0.0141 0.0936 9.6 16.5 8..6 0.320 679.0 176.0 0.1505 0.0493 0.3278 33.5 57.7 7..9 0.041 679.0 176.0 0.1505 0.0064 0.0423 4.3 7.4 9..2 0.033 679.0 176.0 0.1505 0.0052 0.0343 3.5 6.0 9..3 0.014 679.0 176.0 0.1505 0.0022 0.0144 1.5 2.5 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reep1-PG) Pr(w>1) post mean +- SE for w 150 H 0.962* 1.242 161 D 0.944 1.219 164 Y 0.998** 1.287 169 T 0.997** 1.285 204 V 0.976* 1.260 209 S 0.998** 1.287 214 F 1.000** 1.289 219 L 0.950 1.227 242 S 0.895 1.159 246 A 0.534 0.707 247 A 0.979* 1.264 254 H 0.877 1.136 257 I 0.998** 1.287 261 R 0.999** 1.288 263 S 0.950* 1.227 264 S 0.920 1.190 265 S 1.000** 1.289 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reep1-PG) Pr(w>1) post mean +- SE for w 150 H 0.506 1.337 +- 0.661 164 Y 0.601 1.495 +- 0.594 169 T 0.562 1.454 +- 0.588 204 V 0.584 1.456 +- 0.676 209 S 0.578 1.465 +- 0.577 214 F 0.693 1.598 +- 0.622 247 A 0.614 1.496 +- 0.682 257 I 0.589 1.482 +- 0.593 261 R 0.695 1.608 +- 0.642 265 S 0.754 1.668 +- 0.646 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.700 0.266 0.029 0.004 0.001 0.000 0.000 0.000 0.000 0.000 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.019 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.130 0.849 sum of density on p0-p1 = 1.000000 Time used: 0:24 Model 3: discrete (3 categories) TREE # 1: (1, (4, 5, 6), (2, 3)); MP score: 172 lnL(ntime: 8 np: 14): -2002.104285 +0.000000 7..1 7..8 8..4 8..5 8..6 7..9 9..2 9..3 0.079345 0.110642 0.078204 0.091365 0.319990 0.041316 0.033469 0.014086 2.241421 0.313372 0.597328 0.038841 0.038841 1.289521 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.76842 (1: 0.079345, (4: 0.078204, 5: 0.091365, 6: 0.319990): 0.110642, (2: 0.033469, 3: 0.014086): 0.041316); (D_melanogaster_Reep1-PG: 0.079345, (D_yakuba_Reep1-PG: 0.078204, D_erecta_Reep1-PG: 0.091365, D_biarmipes_Reep1-PG: 0.319990): 0.110642, (D_sechellia_Reep1-PG: 0.033469, D_simulans_Reep1-PG: 0.014086): 0.041316); Detailed output identifying parameters kappa (ts/tv) = 2.24142 dN/dS (w) for site classes (K=3) p: 0.31337 0.59733 0.08930 w: 0.03884 0.03884 1.28952 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.079 679.0 176.0 0.1505 0.0122 0.0813 8.3 14.3 7..8 0.111 679.0 176.0 0.1505 0.0171 0.1133 11.6 19.9 8..4 0.078 679.0 176.0 0.1505 0.0121 0.0801 8.2 14.1 8..5 0.091 679.0 176.0 0.1505 0.0141 0.0936 9.6 16.5 8..6 0.320 679.0 176.0 0.1505 0.0493 0.3278 33.5 57.7 7..9 0.041 679.0 176.0 0.1505 0.0064 0.0423 4.3 7.4 9..2 0.033 679.0 176.0 0.1505 0.0052 0.0343 3.5 6.0 9..3 0.014 679.0 176.0 0.1505 0.0022 0.0144 1.5 2.5 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reep1-PG) Pr(w>1) post mean +- SE for w 150 H 0.962* 1.242 161 D 0.944 1.219 164 Y 0.998** 1.287 169 T 0.997** 1.285 204 V 0.976* 1.260 209 S 0.998** 1.287 214 F 1.000** 1.289 219 L 0.950 1.227 242 S 0.895 1.159 246 A 0.534 0.707 247 A 0.979* 1.264 254 H 0.877 1.136 257 I 0.998** 1.287 261 R 0.999** 1.288 263 S 0.950* 1.227 264 S 0.920 1.190 265 S 1.000** 1.289 Time used: 0:32 Model 7: beta (10 categories) TREE # 1: (1, (4, 5, 6), (2, 3)); MP score: 172 lnL(ntime: 8 np: 11): -2003.607857 +0.000000 7..1 7..8 8..4 8..5 8..6 7..9 9..2 9..3 0.077582 0.109390 0.076224 0.091017 0.310733 0.041656 0.033044 0.014042 2.182212 0.065530 0.418620 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.75369 (1: 0.077582, (4: 0.076224, 5: 0.091017, 6: 0.310733): 0.109390, (2: 0.033044, 3: 0.014042): 0.041656); (D_melanogaster_Reep1-PG: 0.077582, (D_yakuba_Reep1-PG: 0.076224, D_erecta_Reep1-PG: 0.091017, D_biarmipes_Reep1-PG: 0.310733): 0.109390, (D_sechellia_Reep1-PG: 0.033044, D_simulans_Reep1-PG: 0.014042): 0.041656); Detailed output identifying parameters kappa (ts/tv) = 2.18221 Parameters in M7 (beta): p = 0.06553 q = 0.41862 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00003 0.00060 0.00765 0.06571 0.36411 0.91911 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.078 679.5 175.5 0.1357 0.0112 0.0826 7.6 14.5 7..8 0.109 679.5 175.5 0.1357 0.0158 0.1164 10.7 20.4 8..4 0.076 679.5 175.5 0.1357 0.0110 0.0811 7.5 14.2 8..5 0.091 679.5 175.5 0.1357 0.0131 0.0969 8.9 17.0 8..6 0.311 679.5 175.5 0.1357 0.0449 0.3307 30.5 58.1 7..9 0.042 679.5 175.5 0.1357 0.0060 0.0443 4.1 7.8 9..2 0.033 679.5 175.5 0.1357 0.0048 0.0352 3.2 6.2 9..3 0.014 679.5 175.5 0.1357 0.0020 0.0149 1.4 2.6 Time used: 0:56 Model 8: beta&w>1 (11 categories) TREE # 1: (1, (4, 5, 6), (2, 3)); MP score: 172 lnL(ntime: 8 np: 13): -2002.126170 +0.000000 7..1 7..8 8..4 8..5 8..6 7..9 9..2 9..3 0.079333 0.110627 0.078199 0.091365 0.319955 0.041322 0.033464 0.014084 2.241179 0.911720 4.122386 99.000000 1.296513 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.76835 (1: 0.079333, (4: 0.078199, 5: 0.091365, 6: 0.319955): 0.110627, (2: 0.033464, 3: 0.014084): 0.041322); (D_melanogaster_Reep1-PG: 0.079333, (D_yakuba_Reep1-PG: 0.078199, D_erecta_Reep1-PG: 0.091365, D_biarmipes_Reep1-PG: 0.319955): 0.110627, (D_sechellia_Reep1-PG: 0.033464, D_simulans_Reep1-PG: 0.014084): 0.041322); Detailed output identifying parameters kappa (ts/tv) = 2.24118 Parameters in M8 (beta&w>1): p0 = 0.91172 p = 4.12239 q = 99.00000 (p1 = 0.08828) w = 1.29651 dN/dS (w) for site classes (K=11) p: 0.09117 0.09117 0.09117 0.09117 0.09117 0.09117 0.09117 0.09117 0.09117 0.09117 0.08828 w: 0.01420 0.02095 0.02588 0.03034 0.03475 0.03941 0.04462 0.05090 0.05951 0.07582 1.29651 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.079 679.0 176.0 0.1506 0.0122 0.0813 8.3 14.3 7..8 0.111 679.0 176.0 0.1506 0.0171 0.1133 11.6 19.9 8..4 0.078 679.0 176.0 0.1506 0.0121 0.0801 8.2 14.1 8..5 0.091 679.0 176.0 0.1506 0.0141 0.0936 9.6 16.5 8..6 0.320 679.0 176.0 0.1506 0.0493 0.3277 33.5 57.7 7..9 0.041 679.0 176.0 0.1506 0.0064 0.0423 4.3 7.4 9..2 0.033 679.0 176.0 0.1506 0.0052 0.0343 3.5 6.0 9..3 0.014 679.0 176.0 0.1506 0.0022 0.0144 1.5 2.5 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reep1-PG) Pr(w>1) post mean +- SE for w 150 H 0.953* 1.239 161 D 0.932 1.212 164 Y 0.996** 1.292 169 T 0.994** 1.290 204 V 0.970* 1.260 209 S 0.996** 1.292 214 F 0.999** 1.296 219 L 0.939 1.220 242 S 0.875 1.141 246 A 0.528 0.707 247 A 0.974* 1.265 254 H 0.854 1.115 257 I 0.996** 1.291 261 R 0.998** 1.294 263 S 0.939 1.221 264 S 0.904 1.177 265 S 1.000** 1.296 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reep1-PG) Pr(w>1) post mean +- SE for w 150 H 0.589 1.229 +- 0.763 161 D 0.506 1.100 +- 0.764 164 Y 0.766 1.501 +- 0.669 169 T 0.710 1.424 +- 0.693 204 V 0.691 1.390 +- 0.749 209 S 0.744 1.468 +- 0.672 214 F 0.876 1.649 +- 0.601 219 L 0.516 1.113 +- 0.754 247 A 0.726 1.442 +- 0.738 257 I 0.749 1.478 +- 0.677 261 R 0.855 1.625 +- 0.628 263 S 0.512 1.105 +- 0.750 265 S 0.918 1.701 +- 0.571 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.001 0.014 0.053 0.117 0.195 0.274 0.346 ws: 0.738 0.245 0.016 0.001 0.000 0.000 0.000 0.000 0.000 0.000 Time used: 1:49
Model 1: NearlyNeutral -2002.42933 Model 2: PositiveSelection -2002.104285 Model 0: one-ratio -2031.691327 Model 3: discrete -2002.104285 Model 7: beta -2003.607857 Model 8: beta&w>1 -2002.12617 Model 0 vs 1 58.52399400000013 Model 2 vs 1 0.6500900000000911 Model 8 vs 7 2.9633739999999307