--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Mon Dec 05 12:35:12 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/367/Reep1-PE/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2153.04 -2164.37 2 -2153.40 -2164.03 -------------------------------------- TOTAL -2153.20 -2164.21 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.363418 0.001861 0.283375 0.450777 0.360409 1285.16 1393.08 1.000 r(A<->C){all} 0.115627 0.000766 0.065770 0.173174 0.113733 807.76 833.12 1.000 r(A<->G){all} 0.251008 0.001740 0.171186 0.332182 0.247931 733.45 822.18 1.000 r(A<->T){all} 0.127527 0.001423 0.053400 0.197582 0.125618 829.78 831.18 1.002 r(C<->G){all} 0.081823 0.000416 0.041279 0.119534 0.080294 1059.46 1150.73 1.000 r(C<->T){all} 0.351152 0.002242 0.264134 0.451767 0.348859 826.57 888.74 1.001 r(G<->T){all} 0.072863 0.000596 0.025833 0.119734 0.071162 918.13 924.29 1.000 pi(A){all} 0.231014 0.000178 0.204743 0.256543 0.230715 1060.68 1123.89 1.000 pi(C){all} 0.290926 0.000216 0.261929 0.318381 0.290978 1213.42 1267.66 1.000 pi(G){all} 0.294921 0.000208 0.266537 0.322883 0.294676 1319.56 1340.53 1.000 pi(T){all} 0.183139 0.000152 0.159347 0.207566 0.182859 1155.97 1328.49 1.000 alpha{1,2} 0.070619 0.002386 0.000126 0.159606 0.063830 1188.12 1249.26 1.000 alpha{3} 2.109833 0.636378 0.798454 3.665272 1.974045 1382.83 1441.92 1.001 pinvar{all} 0.197111 0.009192 0.000239 0.359693 0.194418 1004.28 1042.20 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1999.536754 Model 2: PositiveSelection -1999.17541 Model 0: one-ratio -2025.125189 Model 3: discrete -1999.17541 Model 7: beta -2000.602722 Model 8: beta&w>1 -1999.189626 Model 0 vs 1 51.176870000000235 Model 2 vs 1 0.7226879999998346 Model 8 vs 7 2.826191999999992
>C1 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELYRGQDTMDSTENWLPRASSLSSIESYTETIYEPRTET KRLVIREVSEEAEFDDDPLGDAGAARLRDMPVRKAQPRRAASTAKAAGKR GQKHNDIEGARSSSSSSNVIRSRRKLREPTPDVDVENY >C2 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTDT RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKTQPRRAATTAKATDKR GQKQNDMKGAKSSSNTINVIRSRRKLREPTPDVDVETY >C3 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTET RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKAQPRRAASTAKAAGKR GQKQNDVEGAKSSSSTINVIRSRRKLREPTPDVDVETY >C4 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSANELSRDQDMMDSTDNWLPRASSLSSIESYTETIYEPRAET RRLVIREVSEEVEHEDEPLGDAGAARLRDLPVRKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSSSVIRSRRKLRDPTPDVDVENYoo >C5 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTTPSGD GRGLQNSHSANELSRGQDVMDSTDNWLPRASSLSSIESYAETIYEPRAET RRLIIREVREEVEQEDEPLGDAGAARLRDLPARKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSNVIRSRRKLRDPTPDVDVENYooo >C6 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGQ GRGLQNSHSADELYRGQDTMDSTDNWLPRASSLSSIDSYTENIYEPRAET RRLVIREVSEEVEQEDEPTGDAGAARLRDLPVRKAQPRRAAGTARTGGKR GQKNNDTEAAAGSSTNVIRSRRKLRDPTPDVDVENYoo CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=291 C1 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC C2 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC C3 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC C4 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC C5 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC C6 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC ************************************************** C1 IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE C2 IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE C3 IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE C4 IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE C5 IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE C6 IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE ************************************************** C1 QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH C2 QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH C3 QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH C4 QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH C5 QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTTPSGD C6 QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGQ *********************************************:***. C1 GRGLQNSHSADELYRGQDTMDSTENWLPRASSLSSIESYTETIYEPRTET C2 GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTDT C3 GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTET C4 GRGLQNSHSANELSRDQDMMDSTDNWLPRASSLSSIESYTETIYEPRAET C5 GRGLQNSHSANELSRGQDVMDSTDNWLPRASSLSSIESYAETIYEPRAET C6 GRGLQNSHSADELYRGQDTMDSTDNWLPRASSLSSIDSYTENIYEPRAET **********:** *.** ****:************:**:*.*****::* C1 KRLVIREVSEEAEFDDDPLGDAGAARLRDMPVRKAQPRRAASTAKAAGKR C2 RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKTQPRRAATTAKATDKR C3 RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKAQPRRAASTAKAAGKR C4 RRLVIREVSEEVEHEDEPLGDAGAARLRDLPVRKAQPRRAAGTARAAGKR C5 RRLIIREVREEVEQEDEPLGDAGAARLRDLPARKAQPRRAAGTARAAGKR C6 RRLVIREVSEEVEQEDEPTGDAGAARLRDLPVRKAQPRRAAGTARTGGKR :**:**** **.* :*:* *******:**:*.**:****** **:: .** C1 GQKHNDIEGARSSSSSSNVIRSRRKLREPTPDVDVENY--- C2 GQKQNDMKGAKSSSNTINVIRSRRKLREPTPDVDVETY--- C3 GQKQNDVEGAKSSSSTINVIRSRRKLREPTPDVDVETY--- C4 GQKNNDMEAAGSSSSS--VIRSRRKLRDPTPDVDVENYoo- C5 GQKNNDMEAAGSSSN---VIRSRRKLRDPTPDVDVENYooo C6 GQKNNDTEAAAGSSTN--VIRSRRKLRDPTPDVDVENYoo- ***:** :.* .**. *********:********.* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 288 type PROTEIN Struct Unchecked Input File /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 288 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9036] Library Relaxation: Multi_proc [72] Relaxation Summary: [9036]--->[9001] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/367/Reep1-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.349 Mb, Max= 30.709 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELYRGQDTMDSTENWLPRASSLSSIESYTETIYEPRTET KRLVIREVSEEAEFDDDPLGDAGAARLRDMPVRKAQPRRAASTAKAAGKR GQKHNDIEGARSSSSSSNVIRSRRKLREPTPDVDVENY--- >C2 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTDT RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKTQPRRAATTAKATDKR GQKQNDMKGAKSSSNTINVIRSRRKLREPTPDVDVETY--- >C3 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTET RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKAQPRRAASTAKAAGKR GQKQNDVEGAKSSSSTINVIRSRRKLREPTPDVDVETY--- >C4 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSANELSRDQDMMDSTDNWLPRASSLSSIESYTETIYEPRAET RRLVIREVSEEVEHEDEPLGDAGAARLRDLPVRKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSSS--VIRSRRKLRDPTPDVDVENYoo- >C5 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTTPSGD GRGLQNSHSANELSRGQDVMDSTDNWLPRASSLSSIESYAETIYEPRAET RRLIIREVREEVEQEDEPLGDAGAARLRDLPARKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSN---VIRSRRKLRDPTPDVDVENYooo >C6 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGQ GRGLQNSHSADELYRGQDTMDSTDNWLPRASSLSSIDSYTENIYEPRAET RRLVIREVSEEVEQEDEPTGDAGAARLRDLPVRKAQPRRAAGTARTGGKR GQKNNDTEAAAGSSTN--VIRSRRKLRDPTPDVDVENYoo- FORMAT of file /tmp/tmp9049493423439453479aln Not Supported[FATAL:T-COFFEE] >C1 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELYRGQDTMDSTENWLPRASSLSSIESYTETIYEPRTET KRLVIREVSEEAEFDDDPLGDAGAARLRDMPVRKAQPRRAASTAKAAGKR GQKHNDIEGARSSSSSSNVIRSRRKLREPTPDVDVENY--- >C2 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTDT RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKTQPRRAATTAKATDKR GQKQNDMKGAKSSSNTINVIRSRRKLREPTPDVDVETY--- >C3 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTET RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKAQPRRAASTAKAAGKR GQKQNDVEGAKSSSSTINVIRSRRKLREPTPDVDVETY--- >C4 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSANELSRDQDMMDSTDNWLPRASSLSSIESYTETIYEPRAET RRLVIREVSEEVEHEDEPLGDAGAARLRDLPVRKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSSS--VIRSRRKLRDPTPDVDVENYoo- >C5 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTTPSGD GRGLQNSHSANELSRGQDVMDSTDNWLPRASSLSSIESYAETIYEPRAET RRLIIREVREEVEQEDEPLGDAGAARLRDLPARKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSN---VIRSRRKLRDPTPDVDVENYooo >C6 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGQ GRGLQNSHSADELYRGQDTMDSTDNWLPRASSLSSIDSYTENIYEPRAET RRLVIREVSEEVEQEDEPTGDAGAARLRDLPVRKAQPRRAAGTARTGGKR GQKNNDTEAAAGSSTN--VIRSRRKLRDPTPDVDVENYoo- input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:291 S:98 BS:291 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 92.71 C1 C2 92.71 TOP 1 0 92.71 C2 C1 92.71 BOT 0 2 95.14 C1 C3 95.14 TOP 2 0 95.14 C3 C1 95.14 BOT 0 3 93.36 C1 C4 93.36 TOP 3 0 93.36 C4 C1 93.36 BOT 0 4 91.23 C1 C5 91.23 TOP 4 0 91.23 C5 C1 91.23 BOT 0 5 91.61 C1 C6 91.61 TOP 5 0 91.61 C6 C1 91.61 BOT 1 2 97.22 C2 C3 97.22 TOP 2 1 97.22 C3 C2 97.22 BOT 1 3 91.61 C2 C4 91.61 TOP 3 1 91.61 C4 C2 91.61 BOT 1 4 91.23 C2 C5 91.23 TOP 4 1 91.23 C5 C2 91.23 BOT 1 5 90.21 C2 C6 90.21 TOP 5 1 90.21 C6 C2 90.21 BOT 2 3 93.36 C3 C4 93.36 TOP 3 2 93.36 C4 C3 93.36 BOT 2 4 92.28 C3 C5 92.28 TOP 4 2 92.28 C5 C3 92.28 BOT 2 5 91.61 C3 C6 91.61 TOP 5 2 91.61 C6 C3 91.61 BOT 3 4 96.52 C4 C5 96.52 TOP 4 3 96.52 C5 C4 96.52 BOT 3 5 94.44 C4 C6 94.44 TOP 5 3 94.44 C6 C4 94.44 BOT 4 5 93.73 C5 C6 93.73 TOP 5 4 93.73 C6 C5 93.73 AVG 0 C1 * 92.81 AVG 1 C2 * 92.60 AVG 2 C3 * 93.92 AVG 3 C4 * 93.86 AVG 4 C5 * 93.00 AVG 5 C6 * 92.32 TOT TOT * 93.08 CLUSTAL W (1.83) multiple sequence alignment C1 ATGATCAGCAGCCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT C2 ATGATCAGCAGCCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT C3 ATGATCAGCAGCCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT C4 ATGATCAGCAGTCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT C5 ATGATCAGCAGTCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT C6 ATGATCAGCAGCCTGTTCTCGCGGCTTATCATATTGTTCTGCGGCACCCT *********** ***** ***********.******************** C1 GTACCCGGCATATGCCTCATACAAGGCCGTCAGGACCAAGGATGTCAAGG C2 GTACCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG C3 GTACCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG C4 GTATCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG C5 GTACCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG C6 GTACCCGGCCTACGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG *** *****.** *****.******************************* C1 AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACCTGC C2 AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACATGC C3 AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACATGC C4 AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACCTGC C5 AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTTACCTGC C6 AATATGTAAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACCTGC *******:*********************************** **.*** C1 ATAGAAACATTCACGGACATATTTATCTCCTGGCTACCGTTCTACTACGA C2 ATAGAAACATTCACGGACATATTCATCTCCTGGCTGCCGTTCTACTACGA C3 ATAGAAACATTCACGGACATATTCATCTCCTGGCTGCCGTTCTACTACGA C4 ATAGAAACATTCACGGACATATTCATTTCCTGGCTGCCGTTCTACTACGA C5 ATAGAAACATTCACGGATATATTCATCTCCTGGCTGCCGTTCTACTACGA C6 ATCGAAACATTCACGGACATCTTCATCTCCTGGCTGCCGTTCTACTACGA **.************** **.** ** ********.************** C1 GGTGAAGGTGGCCCTGGTGTTCTGGCTCCTCTCGCCGGCCACAAAGGGCA C2 GGTGAAGGTGGCCCTGGTGTTCTGGCTTCTCTCGCCGGCCACAAAGGGCA C3 GGTGAAGGTGGCCCTGGTGTTCTGGCTCCTCTCGCCGGCCACAAAGGGCA C4 GGTGAAGGTGGCCCTGGTGTTTTGGCTCCTCTCGCCGGCCACAAAGGGCA C5 GGTGAAGGTGGCCCTGGTGTTCTGGCTCCTCTCGCCGGCCACAAAGGGCA C6 GGTGAAGGTGGCCCTGGTCTTCTGGCTCCTCTCGCCGGCCACTAAGGGCA ****************** ** ***** **************:******* C1 GTTCGACTTTGTATCGCAAATTCGTGCATCCTATGTTGACGCGCCACGAA C2 GTTCGACTTTGTATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA C3 GTTCGACTTTATATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA C4 GTTCGACTTTGTATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA C5 GTTCGACTTTGTATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA C6 GTTCGACGCTGTATCGCAAGTTCGTGCACCCCATGTTGACGCGCCACGAA ******* *.********.******** ** ****************** C1 CAGGAGATCGACGAGTACGTGAATCAGGCCAAAGAGCGCGGCTATTCGGC C2 CAGGAGATCGACGAGTACGTGAATCAGGCCAAAGAGCGGGGCTATTCGGC C3 CAGGAGATCGACGAGTACGTGAATCAGGCCAAAGAGCGGGGCTATTCGGC C4 CAGGAGATCGACGAGTACGTGAACCAGGCCAAAGAGCGGGGCTATTCGGC C5 CAGGAGATCGACGAGTACGTAAATCAGGCCAAAGAGCGGGGCTATTCGGC C6 CAGGAGATCGACGAGTACGTGAACCAGGCCAAGGAGCGGGGCTATTCGGC ********************.** ********.***** *********** C1 GGTCCTGCAGCTGGGCTCCAAGGGAGTAAACTATGCCACCAATGTCCTCA C2 GGTGCTGCAGCTGGGCTCCAAGGGAGTAAACTATGCCACCAATGTCCTCA C3 GGTGCTGCAGCTGGGCTCCAAGGGAGTAAACTATGCCACCAATGTCCTCA C4 GGTCCTGCAGCTGGGCTCCAAGGGAGTAAACTACGCCACCAATGTCCTCA C5 GGTCCTGCAGCTGGGTTCGAAGGGAGTAAACTATGCCACCAATGTCCTCA C6 GGTCCTGCAGCTGGGCTCCAAGGGAGTCAACTATGCCACCAATGTGCTCA *** *********** ** ********.***** *********** **** C1 TGCAGACGGCCATCAAGACCTACGCGCTGACTACGGCGCCATCTGGCCAT C2 TGCAGACGGCCATCAAGACCTACGCGCTGACCACGGCACCATCTGGCCAT C3 TGCAGACGGCCATCAAGACCTACGCGCTGACCACGGCACCATCTGGCCAT C4 TGCAGACGGCCATCAAGACCTATGCGCTGACCACGGCGCCATCTGGCCAT C5 TGCAGACGGCCATCAAGACCTATGCGCTGACCACAACGCCATCTGGCGAT C6 TGCAGACGGCCATCAAGACCTATGCGCTGACCACGGCTCCATCGGGCCAG ********************** ******** **..* ***** *** * C1 GGACGCGGCCTGCAAAACTCCCATTCGGCCGATGAGCTGTACAGGGGCCA C2 GGACGCGGCCTGCAGAACTCCCATTCGGCCGATGAGCTGTTCCGGGGCCA C3 GGACGCGGCCTGCAGAACTCCCATTCGGCCGATGAGCTGTTCCGGGGCCA C4 GGACGCGGCCTGCAGAACTCCCATTCCGCGAATGAGCTGTCCCGGGACCA C5 GGACGCGGCCTGCAAAACTCCCATTCGGCCAATGAGCTGTCCCGGGGTCA C6 GGACGTGGCCTGCAGAACTCCCATTCGGCGGACGAGCTGTACCGGGGCCA ***** ********.*********** ** .* ******* *.***. ** C1 GGATACGATGGACAGCACGGAAAACTGGCTGCCGCGAGCCAGTTCCTTGA C2 GGACACAATGGACAGCACGGACAATTGGCTGCCGCGGGCCAGTTCCTTGA C3 GGACACAATGGACAGCACGGACAATTGGCTGCCGCGGGCCAGTTCCTTGA C4 GGACATGATGGACAGCACGGACAACTGGCTGCCGAGGGCCAGTTCCCTGA C5 GGACGTGATGGACAGCACGGACAACTGGCTGCCGAGGGCCAGTTCCCTGA C6 GGACACGATGGACAGCACGGACAACTGGCTGCCGCGGGCCAGTTCCCTGA *** . .**************.** *********.*.********* *** C1 GCAGCATCGAGAGCTACACAGAGACGATCTACGAGCCGAGGACCGAGACC C2 GCAGCATCGAGAGCTACACGGAGACGATCTACGAGCCGAGGACCGACACC C3 GCAGCATCGAGAGCTACACGGAGACGATCTACGAGCCGAGGACCGAGACC C4 GCAGCATCGAGAGCTACACGGAGACGATCTACGAGCCGAGAGCCGAGACC C5 GCAGCATCGAGAGCTACGCGGAGACGATCTATGAGCCGAGGGCCGAGACC C6 GCAGCATCGACAGCTATACGGAGAACATCTACGAGCCGAGGGCCGAGACC ********** ***** .*.****. ***** ********..**** *** C1 AAGCGACTGGTTATTCGAGAGGTTAGCGAGGAGGCGGAGTTCGATGATGA C2 AGGCGACTGATTATTCGAGAGGTTAGCGAGGAAGCGGAGCTCGATGATGA C3 AGGCGACTGATTATTCGAGAGGTTAGCGAGGAGGCGGAGCTCGATGATGA C4 AGGCGACTGGTTATTCGGGAGGTCAGCGAGGAGGTGGAGCACGAAGATGA C5 AGGCGACTGATTATTCGAGAGGTTAGAGAGGAGGTGGAGCAGGAAGATGA C6 AGGCGCCTGGTCATCCGTGAGGTGTCCGAGGAGGTTGAGCAGGAAGATGA *.***.***.* ** ** ***** : .*****.* *** : **:***** C1 TCCCCTGGGCGATGCCGGAGCAGCCCGTCTCCGGGACATGCCCGTCCGGA C2 GCCCCTGGGCGATGCCGGAGCAGCCCGTATCCGGGACTTGCCCGTCCGGA C3 GCCCCTGGGCGATGCCGGGGCAGCCCGTATCCGGGACTTGCCCGTCCGGA C4 GCCCCTGGGCGATGCCGGAGCAGCACGTCTCCGAGACTTGCCTGTCCGGA C5 GCCCCTGGGCGATGCCGGAGCAGCACGTCTACGAGACTTGCCTGCTCGGA C6 GCCCACGGGTGATGCCGGAGCAGCCAGGCTGCGGGACCTGCCGGTCCGGA ***. *** ********.*****..* .* **.*** **** * **** C1 AGGCACAACCACGTCGGGCTGCTAGCACTGCCAAGGCTGCAGGCAAACGC C2 AGACACAACCACGTCGTGCTGCTACCACTGCCAAGGCTACAGACAAACGC C3 AGGCACAACCACGTCGTGCTGCCAGCACTGCCAAGGCTGCAGGCAAACGC C4 AGGCTCAGCCACGTCGTGCCGCAGGTACCGCCAGAGCTGCGGGCAAACGT C5 AGGCTCAACCACGTCGTGCTGCAGGCACCGCCAGAGCTGCAGGCAAGCGC C6 AGGCGCAGCCACGTCGCGCCGCAGGCACCGCCAGAACTGGAGGCAAACGT **.* **.******** ** ** . ** ****...**. .*.***.** C1 GGCCAGAAACACAACGATATTGAGGGCGCCAGGAGCTCCAGCAGCTCCAG C2 GGCCAGAAACAGAACGATATGAAGGGAGCCAAGAGCTCCAGCAACACCAT C3 GGCCAGAAACAGAACGATGTGGAGGGAGCCAAGAGCTCCAGCAGCACCAT C4 GGCCAGAAAAACAACGATATGGAGGCCGCCGGAAGCTCTAGCTCCAGT-- C5 GGCCAGAAAAACAACGATATGGAGGCCGCCGGCAGCTCCAGCAAT----- C6 GGCCAGAAAAACAACGATACAGAAGCCGCCGCCGGCAGCTCCACCAAT-- *********.* ******. .*.* .***. .**: : *: C1 CAATGTGATCCGCTCCCGCCGCAAGCTGCGCGAACCCACGCCCGATGTGG C2 CAATGTGATCCGCTCCCGCCGCAAGCTGCGCGAACCCACGCCCGATGTGG C3 CAATGTGATCCGCTCCCGCCGCAAGCTGCGCGAACCCACGCCCGATGTGG C4 ----GTGATCCGCTCCCGGCGCAAGCTGCGCGATCCCACACCCGATGTGG C5 ----GTGATCCGCTCCCGGCGCAAGTTGCGCGATCCCACGCCCGATGTGG C6 ----GTGATCCGGTCGCGCCGCAAGCTGCGCGATCCCACGCCCGATGTGG ******** ** ** ****** *******:*****.********** C1 ATGTGGAAAACTAC--------- C2 ATGTGGAAACCTAC--------- C3 ATGTGGAAACCTAC--------- C4 ATGTGGAAAACTAC--------- C5 ATGTGGAAAACTAC--------- C6 ACGTGGAGAACTAC--------- * *****.*.**** >C1 ATGATCAGCAGCCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTACCCGGCATATGCCTCATACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACCTGC ATAGAAACATTCACGGACATATTTATCTCCTGGCTACCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTCTGGCTCCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTGTATCGCAAATTCGTGCATCCTATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAATCAGGCCAAAGAGCGCGGCTATTCGGC GGTCCTGCAGCTGGGCTCCAAGGGAGTAAACTATGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTACGCGCTGACTACGGCGCCATCTGGCCAT GGACGCGGCCTGCAAAACTCCCATTCGGCCGATGAGCTGTACAGGGGCCA GGATACGATGGACAGCACGGAAAACTGGCTGCCGCGAGCCAGTTCCTTGA GCAGCATCGAGAGCTACACAGAGACGATCTACGAGCCGAGGACCGAGACC AAGCGACTGGTTATTCGAGAGGTTAGCGAGGAGGCGGAGTTCGATGATGA TCCCCTGGGCGATGCCGGAGCAGCCCGTCTCCGGGACATGCCCGTCCGGA AGGCACAACCACGTCGGGCTGCTAGCACTGCCAAGGCTGCAGGCAAACGC GGCCAGAAACACAACGATATTGAGGGCGCCAGGAGCTCCAGCAGCTCCAG CAATGTGATCCGCTCCCGCCGCAAGCTGCGCGAACCCACGCCCGATGTGG ATGTGGAAAACTAC--------- >C2 ATGATCAGCAGCCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTACCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACATGC ATAGAAACATTCACGGACATATTCATCTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTCTGGCTTCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTGTATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAATCAGGCCAAAGAGCGGGGCTATTCGGC GGTGCTGCAGCTGGGCTCCAAGGGAGTAAACTATGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTACGCGCTGACCACGGCACCATCTGGCCAT GGACGCGGCCTGCAGAACTCCCATTCGGCCGATGAGCTGTTCCGGGGCCA GGACACAATGGACAGCACGGACAATTGGCTGCCGCGGGCCAGTTCCTTGA GCAGCATCGAGAGCTACACGGAGACGATCTACGAGCCGAGGACCGACACC AGGCGACTGATTATTCGAGAGGTTAGCGAGGAAGCGGAGCTCGATGATGA GCCCCTGGGCGATGCCGGAGCAGCCCGTATCCGGGACTTGCCCGTCCGGA AGACACAACCACGTCGTGCTGCTACCACTGCCAAGGCTACAGACAAACGC GGCCAGAAACAGAACGATATGAAGGGAGCCAAGAGCTCCAGCAACACCAT CAATGTGATCCGCTCCCGCCGCAAGCTGCGCGAACCCACGCCCGATGTGG ATGTGGAAACCTAC--------- >C3 ATGATCAGCAGCCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTACCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACATGC ATAGAAACATTCACGGACATATTCATCTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTCTGGCTCCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTATATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAATCAGGCCAAAGAGCGGGGCTATTCGGC GGTGCTGCAGCTGGGCTCCAAGGGAGTAAACTATGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTACGCGCTGACCACGGCACCATCTGGCCAT GGACGCGGCCTGCAGAACTCCCATTCGGCCGATGAGCTGTTCCGGGGCCA GGACACAATGGACAGCACGGACAATTGGCTGCCGCGGGCCAGTTCCTTGA GCAGCATCGAGAGCTACACGGAGACGATCTACGAGCCGAGGACCGAGACC AGGCGACTGATTATTCGAGAGGTTAGCGAGGAGGCGGAGCTCGATGATGA GCCCCTGGGCGATGCCGGGGCAGCCCGTATCCGGGACTTGCCCGTCCGGA AGGCACAACCACGTCGTGCTGCCAGCACTGCCAAGGCTGCAGGCAAACGC GGCCAGAAACAGAACGATGTGGAGGGAGCCAAGAGCTCCAGCAGCACCAT CAATGTGATCCGCTCCCGCCGCAAGCTGCGCGAACCCACGCCCGATGTGG ATGTGGAAACCTAC--------- >C4 ATGATCAGCAGTCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTATCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACCTGC ATAGAAACATTCACGGACATATTCATTTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTTTGGCTCCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTGTATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAACCAGGCCAAAGAGCGGGGCTATTCGGC GGTCCTGCAGCTGGGCTCCAAGGGAGTAAACTACGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTATGCGCTGACCACGGCGCCATCTGGCCAT GGACGCGGCCTGCAGAACTCCCATTCCGCGAATGAGCTGTCCCGGGACCA GGACATGATGGACAGCACGGACAACTGGCTGCCGAGGGCCAGTTCCCTGA GCAGCATCGAGAGCTACACGGAGACGATCTACGAGCCGAGAGCCGAGACC AGGCGACTGGTTATTCGGGAGGTCAGCGAGGAGGTGGAGCACGAAGATGA GCCCCTGGGCGATGCCGGAGCAGCACGTCTCCGAGACTTGCCTGTCCGGA AGGCTCAGCCACGTCGTGCCGCAGGTACCGCCAGAGCTGCGGGCAAACGT GGCCAGAAAAACAACGATATGGAGGCCGCCGGAAGCTCTAGCTCCAGT-- ----GTGATCCGCTCCCGGCGCAAGCTGCGCGATCCCACACCCGATGTGG ATGTGGAAAACTAC--------- >C5 ATGATCAGCAGTCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTACCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTTACCTGC ATAGAAACATTCACGGATATATTCATCTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTCTGGCTCCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTGTATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTAAATCAGGCCAAAGAGCGGGGCTATTCGGC GGTCCTGCAGCTGGGTTCGAAGGGAGTAAACTATGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTATGCGCTGACCACAACGCCATCTGGCGAT GGACGCGGCCTGCAAAACTCCCATTCGGCCAATGAGCTGTCCCGGGGTCA GGACGTGATGGACAGCACGGACAACTGGCTGCCGAGGGCCAGTTCCCTGA GCAGCATCGAGAGCTACGCGGAGACGATCTATGAGCCGAGGGCCGAGACC AGGCGACTGATTATTCGAGAGGTTAGAGAGGAGGTGGAGCAGGAAGATGA GCCCCTGGGCGATGCCGGAGCAGCACGTCTACGAGACTTGCCTGCTCGGA AGGCTCAACCACGTCGTGCTGCAGGCACCGCCAGAGCTGCAGGCAAGCGC GGCCAGAAAAACAACGATATGGAGGCCGCCGGCAGCTCCAGCAAT----- ----GTGATCCGCTCCCGGCGCAAGTTGCGCGATCCCACGCCCGATGTGG ATGTGGAAAACTAC--------- >C6 ATGATCAGCAGCCTGTTCTCGCGGCTTATCATATTGTTCTGCGGCACCCT GTACCCGGCCTACGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTAAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACCTGC ATCGAAACATTCACGGACATCTTCATCTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTCTTCTGGCTCCTCTCGCCGGCCACTAAGGGCA GTTCGACGCTGTATCGCAAGTTCGTGCACCCCATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAACCAGGCCAAGGAGCGGGGCTATTCGGC GGTCCTGCAGCTGGGCTCCAAGGGAGTCAACTATGCCACCAATGTGCTCA TGCAGACGGCCATCAAGACCTATGCGCTGACCACGGCTCCATCGGGCCAG GGACGTGGCCTGCAGAACTCCCATTCGGCGGACGAGCTGTACCGGGGCCA GGACACGATGGACAGCACGGACAACTGGCTGCCGCGGGCCAGTTCCCTGA GCAGCATCGACAGCTATACGGAGAACATCTACGAGCCGAGGGCCGAGACC AGGCGCCTGGTCATCCGTGAGGTGTCCGAGGAGGTTGAGCAGGAAGATGA GCCCACGGGTGATGCCGGAGCAGCCAGGCTGCGGGACCTGCCGGTCCGGA AGGCGCAGCCACGTCGCGCCGCAGGCACCGCCAGAACTGGAGGCAAACGT GGCCAGAAAAACAACGATACAGAAGCCGCCGCCGGCAGCTCCACCAAT-- ----GTGATCCGGTCGCGCCGCAAGCTGCGCGATCCCACGCCCGATGTGG ACGTGGAGAACTAC--------- >C1 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELYRGQDTMDSTENWLPRASSLSSIESYTETIYEPRTET KRLVIREVSEEAEFDDDPLGDAGAARLRDMPVRKAQPRRAASTAKAAGKR GQKHNDIEGARSSSSSSNVIRSRRKLREPTPDVDVENY >C2 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTDT RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKTQPRRAATTAKATDKR GQKQNDMKGAKSSSNTINVIRSRRKLREPTPDVDVETY >C3 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTET RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKAQPRRAASTAKAAGKR GQKQNDVEGAKSSSSTINVIRSRRKLREPTPDVDVETY >C4 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSANELSRDQDMMDSTDNWLPRASSLSSIESYTETIYEPRAET RRLVIREVSEEVEHEDEPLGDAGAARLRDLPVRKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSSSooVIRSRRKLRDPTPDVDVENY >C5 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTTPSGD GRGLQNSHSANELSRGQDVMDSTDNWLPRASSLSSIESYAETIYEPRAET RRLIIREVREEVEQEDEPLGDAGAARLRDLPARKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSNoooVIRSRRKLRDPTPDVDVENY >C6 MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGQ GRGLQNSHSADELYRGQDTMDSTDNWLPRASSLSSIDSYTENIYEPRAET RRLVIREVSEEVEQEDEPTGDAGAARLRDLPVRKAQPRRAAGTARTGGKR GQKNNDTEAAAGSSTNooVIRSRRKLRDPTPDVDVENY MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 873 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1480940931 Setting output file names to "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1586126431 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 3433527865 Seed = 511729753 Swapseed = 1480940931 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 30 unique site patterns Division 2 has 26 unique site patterns Division 3 has 69 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2641.647157 -- -24.965149 Chain 2 -- -2650.938431 -- -24.965149 Chain 3 -- -2572.603009 -- -24.965149 Chain 4 -- -2701.732243 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2689.675860 -- -24.965149 Chain 2 -- -2630.385487 -- -24.965149 Chain 3 -- -2692.997825 -- -24.965149 Chain 4 -- -2660.091957 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2641.647] (-2650.938) (-2572.603) (-2701.732) * [-2689.676] (-2630.385) (-2692.998) (-2660.092) 500 -- (-2191.052) (-2184.322) (-2192.000) [-2188.029] * [-2177.304] (-2195.589) (-2185.486) (-2188.916) -- 0:00:00 1000 -- (-2177.492) [-2176.831] (-2189.058) (-2180.126) * [-2167.836] (-2185.813) (-2188.207) (-2186.509) -- 0:00:00 1500 -- (-2182.567) (-2172.347) (-2182.183) [-2161.855] * [-2165.245] (-2180.808) (-2175.926) (-2183.332) -- 0:00:00 2000 -- (-2170.845) (-2163.673) (-2176.596) [-2166.320] * (-2166.262) [-2166.815] (-2167.995) (-2175.845) -- 0:00:00 2500 -- (-2166.425) (-2165.007) [-2156.581] (-2158.265) * [-2156.439] (-2160.718) (-2163.709) (-2165.350) -- 0:00:00 3000 -- (-2161.597) (-2156.400) [-2153.230] (-2154.954) * [-2158.609] (-2159.048) (-2159.169) (-2180.080) -- 0:05:32 3500 -- (-2154.348) (-2155.014) (-2154.818) [-2151.308] * (-2156.935) (-2158.865) [-2155.838] (-2164.293) -- 0:04:44 4000 -- (-2158.490) (-2156.646) [-2155.794] (-2158.858) * [-2151.570] (-2158.546) (-2156.150) (-2155.668) -- 0:04:09 4500 -- [-2154.418] (-2164.535) (-2152.847) (-2153.643) * (-2153.890) (-2156.746) [-2159.134] (-2161.825) -- 0:03:41 5000 -- (-2154.040) (-2162.322) [-2156.211] (-2157.143) * [-2153.869] (-2158.223) (-2152.546) (-2154.316) -- 0:03:19 Average standard deviation of split frequencies: 0.039284 5500 -- (-2158.865) [-2165.214] (-2156.461) (-2156.935) * (-2157.460) (-2163.219) (-2159.613) [-2156.607] -- 0:03:00 6000 -- (-2163.815) [-2153.514] (-2159.043) (-2154.373) * (-2155.719) (-2159.077) [-2153.661] (-2152.610) -- 0:02:45 6500 -- [-2158.026] (-2156.189) (-2160.934) (-2155.264) * (-2153.920) [-2157.361] (-2160.446) (-2158.047) -- 0:05:05 7000 -- (-2155.401) (-2158.335) [-2156.102] (-2153.190) * (-2152.805) [-2153.264] (-2162.902) (-2160.124) -- 0:04:43 7500 -- (-2157.183) [-2155.332] (-2153.352) (-2157.986) * [-2155.487] (-2159.353) (-2163.490) (-2166.799) -- 0:04:24 8000 -- [-2156.948] (-2153.206) (-2163.599) (-2159.469) * (-2156.341) [-2162.292] (-2165.559) (-2159.106) -- 0:04:08 8500 -- [-2154.252] (-2159.001) (-2154.080) (-2153.696) * (-2163.511) (-2155.961) (-2162.731) [-2160.564] -- 0:03:53 9000 -- (-2154.136) (-2154.695) [-2153.555] (-2157.062) * (-2157.223) (-2155.145) [-2158.650] (-2160.345) -- 0:03:40 9500 -- (-2151.933) (-2160.340) (-2156.622) [-2156.685] * [-2165.465] (-2161.430) (-2156.171) (-2162.564) -- 0:03:28 10000 -- (-2159.034) [-2158.671] (-2158.965) (-2154.726) * (-2159.175) [-2153.256] (-2159.407) (-2159.051) -- 0:03:18 Average standard deviation of split frequencies: 0.000000 10500 -- (-2161.490) (-2152.068) [-2158.822] (-2163.452) * [-2153.208] (-2156.910) (-2155.486) (-2167.478) -- 0:04:42 11000 -- (-2161.939) [-2155.898] (-2154.645) (-2158.350) * (-2166.702) (-2159.139) (-2156.397) [-2160.229] -- 0:04:29 11500 -- (-2161.558) [-2152.175] (-2164.948) (-2163.449) * [-2154.807] (-2156.681) (-2167.740) (-2160.034) -- 0:04:17 12000 -- (-2159.535) [-2156.984] (-2153.211) (-2157.672) * (-2158.761) (-2155.936) (-2154.340) [-2151.561] -- 0:04:07 12500 -- (-2166.186) [-2155.676] (-2154.853) (-2156.388) * (-2152.331) (-2157.185) [-2153.775] (-2152.952) -- 0:03:57 13000 -- [-2160.603] (-2157.548) (-2157.221) (-2162.590) * [-2155.742] (-2156.457) (-2161.207) (-2155.339) -- 0:03:47 13500 -- (-2162.094) (-2164.927) (-2155.385) [-2157.903] * (-2159.875) (-2167.535) (-2154.049) [-2156.545] -- 0:03:39 14000 -- (-2156.755) [-2160.472] (-2161.958) (-2158.155) * [-2155.074] (-2154.937) (-2163.002) (-2158.017) -- 0:03:31 14500 -- (-2161.393) [-2154.551] (-2156.022) (-2160.240) * (-2155.259) [-2155.040] (-2157.710) (-2152.091) -- 0:04:31 15000 -- (-2153.413) [-2151.874] (-2159.503) (-2156.485) * [-2158.663] (-2155.945) (-2159.021) (-2160.262) -- 0:04:22 Average standard deviation of split frequencies: 0.014731 15500 -- (-2160.952) [-2152.347] (-2165.994) (-2154.001) * [-2155.240] (-2163.939) (-2158.864) (-2162.087) -- 0:04:14 16000 -- (-2167.191) (-2155.402) (-2154.387) [-2154.287] * (-2161.639) [-2154.351] (-2158.102) (-2157.636) -- 0:04:06 16500 -- (-2160.897) (-2164.153) (-2154.779) [-2155.567] * (-2157.847) (-2151.876) (-2159.666) [-2154.608] -- 0:03:58 17000 -- (-2163.299) (-2155.458) (-2158.257) [-2153.341] * (-2155.300) [-2152.087] (-2155.159) (-2157.190) -- 0:03:51 17500 -- (-2162.869) (-2153.014) [-2161.124] (-2159.944) * (-2164.129) (-2157.532) [-2154.588] (-2155.651) -- 0:03:44 18000 -- (-2156.670) (-2156.886) [-2157.050] (-2153.966) * (-2157.129) [-2158.259] (-2156.134) (-2158.748) -- 0:04:32 18500 -- (-2164.163) (-2153.174) [-2158.428] (-2161.163) * (-2155.851) (-2154.417) (-2158.108) [-2155.512] -- 0:04:25 19000 -- [-2157.988] (-2155.344) (-2158.457) (-2158.921) * (-2160.447) [-2158.863] (-2157.107) (-2150.696) -- 0:04:18 19500 -- (-2161.335) (-2155.540) (-2154.950) [-2152.347] * [-2158.270] (-2154.290) (-2157.194) (-2158.639) -- 0:04:11 20000 -- (-2153.344) (-2156.060) (-2159.341) [-2157.176] * [-2155.138] (-2156.020) (-2163.758) (-2161.712) -- 0:04:05 Average standard deviation of split frequencies: 0.045620 20500 -- (-2155.957) (-2156.509) [-2152.962] (-2157.162) * (-2156.735) [-2157.713] (-2163.163) (-2161.840) -- 0:03:58 21000 -- (-2163.924) (-2157.623) [-2155.656] (-2158.126) * (-2158.803) [-2153.419] (-2161.284) (-2153.108) -- 0:03:53 21500 -- (-2153.275) (-2165.051) (-2157.300) [-2157.283] * (-2154.707) [-2157.432] (-2164.607) (-2157.474) -- 0:03:47 22000 -- (-2156.830) (-2166.173) [-2153.827] (-2157.410) * (-2158.637) (-2160.430) [-2159.413] (-2153.011) -- 0:04:26 22500 -- (-2158.474) (-2166.702) [-2156.579] (-2155.584) * (-2163.426) (-2155.258) [-2156.619] (-2158.300) -- 0:04:20 23000 -- [-2153.806] (-2164.065) (-2153.848) (-2156.933) * (-2161.366) (-2160.718) (-2154.831) [-2154.475] -- 0:04:14 23500 -- (-2155.664) (-2166.581) (-2162.719) [-2153.699] * (-2160.102) [-2157.980] (-2155.898) (-2160.498) -- 0:04:09 24000 -- [-2157.798] (-2163.420) (-2154.958) (-2161.611) * [-2158.155] (-2161.204) (-2157.486) (-2159.392) -- 0:04:04 24500 -- (-2159.849) [-2158.281] (-2155.233) (-2157.933) * (-2157.264) (-2157.836) (-2161.790) [-2158.484] -- 0:03:58 25000 -- [-2158.852] (-2159.676) (-2154.917) (-2164.234) * (-2157.360) (-2156.848) (-2164.459) [-2157.098] -- 0:03:54 Average standard deviation of split frequencies: 0.054393 25500 -- (-2159.932) (-2157.766) [-2156.445] (-2151.790) * (-2155.719) [-2162.346] (-2163.790) (-2163.622) -- 0:04:27 26000 -- (-2157.733) (-2159.435) [-2158.150] (-2165.313) * (-2163.375) (-2155.741) (-2157.648) [-2154.091] -- 0:04:22 26500 -- (-2155.858) (-2155.776) (-2157.472) [-2157.848] * (-2166.442) (-2157.554) (-2159.807) [-2161.644] -- 0:04:17 27000 -- (-2158.328) (-2158.126) (-2157.338) [-2158.719] * (-2150.745) (-2161.014) [-2154.736] (-2160.574) -- 0:04:12 27500 -- (-2158.591) (-2157.258) [-2152.795] (-2155.873) * (-2157.841) (-2157.635) (-2154.532) [-2153.280] -- 0:04:07 28000 -- (-2154.435) [-2152.903] (-2156.767) (-2155.416) * (-2155.557) (-2155.438) (-2161.776) [-2153.125] -- 0:04:03 28500 -- (-2154.755) (-2160.910) (-2154.308) [-2153.985] * (-2155.472) [-2154.204] (-2157.836) (-2155.936) -- 0:03:58 29000 -- [-2159.672] (-2159.007) (-2160.532) (-2155.406) * (-2161.328) (-2158.144) (-2158.923) [-2154.881] -- 0:03:54 29500 -- (-2153.786) (-2163.615) (-2160.295) [-2152.923] * [-2162.617] (-2156.589) (-2160.882) (-2160.227) -- 0:04:23 30000 -- [-2160.947] (-2153.880) (-2155.891) (-2154.581) * (-2154.232) [-2153.847] (-2163.202) (-2162.893) -- 0:04:18 Average standard deviation of split frequencies: 0.011529 30500 -- (-2155.619) (-2161.548) (-2152.845) [-2160.468] * (-2158.712) [-2154.471] (-2157.846) (-2157.274) -- 0:04:14 31000 -- (-2162.355) (-2164.392) (-2154.187) [-2154.297] * (-2154.500) [-2158.032] (-2157.547) (-2157.303) -- 0:04:10 31500 -- (-2155.531) (-2158.304) [-2156.801] (-2163.808) * (-2153.207) (-2165.355) [-2152.960] (-2158.330) -- 0:04:05 32000 -- (-2163.591) (-2161.142) [-2153.023] (-2161.120) * (-2150.601) [-2153.949] (-2162.857) (-2155.474) -- 0:04:02 32500 -- (-2158.349) (-2159.205) [-2153.377] (-2158.561) * [-2161.508] (-2153.508) (-2164.146) (-2153.732) -- 0:03:58 33000 -- (-2164.541) (-2156.774) [-2151.808] (-2157.712) * (-2162.031) (-2154.110) (-2158.647) [-2157.010] -- 0:03:54 33500 -- [-2154.639] (-2157.514) (-2162.403) (-2156.953) * (-2153.044) [-2152.087] (-2164.098) (-2159.077) -- 0:04:19 34000 -- (-2155.201) [-2157.687] (-2159.528) (-2154.965) * [-2154.741] (-2152.380) (-2157.190) (-2158.091) -- 0:04:15 34500 -- [-2155.518] (-2156.838) (-2163.370) (-2162.075) * (-2157.336) (-2157.797) [-2150.529] (-2158.141) -- 0:04:11 35000 -- [-2159.705] (-2159.764) (-2153.923) (-2158.827) * [-2156.874] (-2160.032) (-2156.227) (-2154.705) -- 0:04:08 Average standard deviation of split frequencies: 0.022915 35500 -- (-2155.691) (-2155.373) [-2156.903] (-2153.658) * [-2157.939] (-2158.669) (-2161.296) (-2156.556) -- 0:04:04 36000 -- (-2161.093) (-2154.165) (-2157.001) [-2151.339] * (-2151.925) [-2155.691] (-2168.506) (-2151.769) -- 0:04:01 36500 -- (-2160.698) [-2156.799] (-2153.507) (-2150.012) * (-2161.756) (-2158.278) (-2159.088) [-2153.749] -- 0:03:57 37000 -- [-2163.438] (-2156.861) (-2157.229) (-2160.111) * (-2157.000) [-2164.589] (-2168.286) (-2153.245) -- 0:04:20 37500 -- (-2163.758) [-2162.039] (-2168.740) (-2159.680) * (-2157.914) (-2170.248) (-2162.129) [-2156.038] -- 0:04:16 38000 -- (-2163.482) (-2163.116) (-2157.704) [-2162.852] * (-2158.196) (-2161.551) (-2173.992) [-2154.309] -- 0:04:13 38500 -- (-2164.320) (-2164.617) [-2160.775] (-2156.021) * (-2160.361) (-2159.046) (-2161.435) [-2152.490] -- 0:04:09 39000 -- (-2160.043) (-2159.836) (-2152.387) [-2156.347] * (-2155.352) [-2164.660] (-2155.803) (-2155.728) -- 0:04:06 39500 -- (-2164.539) [-2156.342] (-2160.503) (-2155.420) * (-2155.995) [-2156.451] (-2156.864) (-2157.633) -- 0:04:03 40000 -- (-2152.041) [-2152.563] (-2161.968) (-2159.433) * [-2152.123] (-2164.016) (-2155.020) (-2156.609) -- 0:04:00 Average standard deviation of split frequencies: 0.017388 40500 -- [-2155.182] (-2161.125) (-2157.271) (-2159.903) * (-2157.728) (-2160.101) [-2156.875] (-2158.534) -- 0:03:56 41000 -- (-2157.695) (-2161.067) [-2155.585] (-2157.534) * (-2155.003) (-2165.634) (-2153.463) [-2161.235] -- 0:04:17 41500 -- (-2165.213) (-2155.063) (-2158.836) [-2159.996] * (-2155.772) (-2163.782) (-2158.599) [-2161.151] -- 0:04:14 42000 -- [-2159.189] (-2153.013) (-2158.144) (-2161.517) * (-2161.181) [-2152.260] (-2158.592) (-2158.697) -- 0:04:10 42500 -- (-2159.340) (-2155.276) [-2160.455] (-2159.483) * (-2152.535) [-2158.394] (-2155.766) (-2157.678) -- 0:04:07 43000 -- (-2167.282) [-2151.624] (-2153.077) (-2157.681) * [-2160.361] (-2153.274) (-2159.324) (-2159.499) -- 0:04:04 43500 -- (-2153.845) [-2152.399] (-2158.858) (-2160.198) * (-2161.761) [-2163.222] (-2161.312) (-2167.674) -- 0:04:01 44000 -- (-2153.968) (-2155.078) [-2159.922] (-2158.496) * [-2158.063] (-2154.543) (-2156.744) (-2157.309) -- 0:03:59 44500 -- (-2154.718) [-2156.859] (-2158.116) (-2158.268) * (-2164.716) [-2153.716] (-2155.525) (-2154.457) -- 0:04:17 45000 -- [-2153.425] (-2156.896) (-2164.168) (-2166.450) * (-2165.489) [-2164.925] (-2162.095) (-2161.166) -- 0:04:14 Average standard deviation of split frequencies: 0.010248 45500 -- (-2156.162) [-2155.127] (-2157.968) (-2163.748) * (-2151.079) (-2159.465) [-2163.851] (-2160.511) -- 0:04:11 46000 -- (-2154.637) (-2156.003) [-2157.191] (-2158.838) * [-2155.479] (-2161.416) (-2153.357) (-2164.930) -- 0:04:08 46500 -- (-2151.516) (-2157.596) [-2155.478] (-2167.243) * (-2159.369) (-2158.254) (-2155.045) [-2156.633] -- 0:04:06 47000 -- (-2152.386) (-2155.765) [-2164.391] (-2153.159) * (-2160.633) (-2162.869) (-2157.481) [-2156.222] -- 0:04:03 47500 -- (-2154.492) [-2151.127] (-2157.253) (-2151.146) * (-2154.365) [-2154.578] (-2159.866) (-2162.430) -- 0:04:00 48000 -- (-2159.557) [-2159.644] (-2160.384) (-2153.329) * (-2157.341) [-2153.359] (-2157.931) (-2154.806) -- 0:03:58 48500 -- (-2155.478) (-2157.156) [-2159.039] (-2158.232) * (-2165.806) (-2160.196) [-2155.061] (-2158.457) -- 0:04:15 49000 -- (-2153.547) (-2157.104) (-2155.303) [-2156.245] * (-2159.149) (-2158.486) (-2163.783) [-2159.646] -- 0:04:12 49500 -- [-2152.641] (-2157.545) (-2159.583) (-2157.697) * (-2156.384) [-2155.034] (-2161.732) (-2153.802) -- 0:04:09 50000 -- (-2154.547) [-2152.557] (-2157.665) (-2153.503) * [-2153.250] (-2156.382) (-2159.723) (-2156.122) -- 0:04:06 Average standard deviation of split frequencies: 0.006978 50500 -- (-2161.592) [-2159.056] (-2155.735) (-2152.418) * (-2153.589) [-2158.449] (-2167.179) (-2158.420) -- 0:04:04 51000 -- (-2155.375) [-2157.210] (-2156.937) (-2156.643) * (-2158.046) [-2157.835] (-2160.662) (-2159.663) -- 0:04:01 51500 -- [-2159.673] (-2166.308) (-2154.428) (-2153.649) * (-2166.729) (-2156.049) [-2159.611] (-2155.308) -- 0:03:59 52000 -- (-2159.734) (-2159.740) (-2161.027) [-2156.372] * (-2154.807) (-2159.287) [-2159.462] (-2154.857) -- 0:03:57 52500 -- (-2155.003) (-2155.380) [-2152.677] (-2157.787) * (-2153.285) [-2154.582] (-2157.772) (-2153.086) -- 0:04:12 53000 -- [-2155.005] (-2158.251) (-2162.538) (-2162.863) * (-2157.037) [-2155.220] (-2150.118) (-2162.806) -- 0:04:10 53500 -- (-2164.418) (-2165.588) [-2159.341] (-2161.837) * (-2156.044) (-2152.571) (-2152.473) [-2164.702] -- 0:04:07 54000 -- [-2155.470] (-2157.832) (-2157.291) (-2158.698) * (-2160.509) (-2155.168) (-2158.041) [-2157.306] -- 0:04:05 54500 -- (-2156.888) (-2156.481) [-2153.010] (-2154.325) * (-2167.951) (-2155.876) (-2159.003) [-2157.958] -- 0:04:02 55000 -- (-2157.165) [-2153.590] (-2160.829) (-2159.515) * (-2161.637) (-2149.721) [-2154.441] (-2154.268) -- 0:04:00 Average standard deviation of split frequencies: 0.010522 55500 -- (-2151.930) [-2153.527] (-2156.577) (-2161.478) * (-2156.649) (-2152.860) [-2154.641] (-2158.500) -- 0:03:58 56000 -- (-2155.689) [-2163.462] (-2151.943) (-2165.833) * (-2155.432) (-2155.206) [-2157.139] (-2157.357) -- 0:04:12 56500 -- (-2154.615) (-2157.662) [-2154.829] (-2166.107) * (-2150.758) (-2154.468) [-2157.300] (-2160.552) -- 0:04:10 57000 -- (-2157.837) (-2156.326) [-2153.876] (-2167.108) * (-2161.485) (-2158.805) [-2158.512] (-2157.447) -- 0:04:08 57500 -- [-2150.523] (-2154.024) (-2152.008) (-2174.464) * [-2157.087] (-2157.312) (-2155.559) (-2154.063) -- 0:04:05 58000 -- (-2157.765) (-2166.846) (-2156.422) [-2156.043] * (-2155.482) (-2158.456) (-2158.233) [-2151.500] -- 0:04:03 58500 -- [-2157.720] (-2156.642) (-2160.578) (-2154.775) * [-2154.524] (-2159.058) (-2167.058) (-2157.759) -- 0:04:01 59000 -- [-2156.497] (-2156.016) (-2157.054) (-2152.613) * (-2156.491) [-2156.959] (-2163.884) (-2159.173) -- 0:03:59 59500 -- (-2158.177) (-2158.533) (-2164.682) [-2155.675] * [-2152.911] (-2153.116) (-2151.974) (-2161.110) -- 0:03:57 60000 -- (-2158.031) [-2161.813] (-2167.507) (-2151.807) * [-2160.327] (-2156.663) (-2158.521) (-2164.460) -- 0:04:10 Average standard deviation of split frequencies: 0.005828 60500 -- (-2156.827) (-2164.574) [-2160.686] (-2159.096) * (-2167.182) [-2155.424] (-2156.883) (-2160.717) -- 0:04:08 61000 -- [-2155.880] (-2156.380) (-2155.188) (-2160.135) * (-2153.379) [-2156.348] (-2154.828) (-2154.370) -- 0:04:06 61500 -- (-2160.134) (-2155.851) (-2161.215) [-2153.365] * (-2154.527) (-2159.572) [-2154.072] (-2159.204) -- 0:04:04 62000 -- (-2161.788) (-2157.400) (-2155.779) [-2155.924] * (-2158.617) (-2157.307) [-2151.076] (-2169.178) -- 0:04:02 62500 -- (-2151.975) (-2155.124) [-2153.958] (-2161.371) * (-2153.645) [-2154.388] (-2163.739) (-2154.123) -- 0:04:00 63000 -- (-2150.210) [-2157.018] (-2156.017) (-2157.111) * (-2151.919) (-2156.773) [-2156.424] (-2158.232) -- 0:03:57 63500 -- (-2155.602) (-2157.802) [-2154.950] (-2153.641) * (-2158.543) (-2157.666) [-2155.265] (-2159.548) -- 0:03:55 64000 -- [-2153.389] (-2159.925) (-2162.853) (-2155.676) * (-2159.960) (-2164.578) (-2153.855) [-2158.569] -- 0:04:08 64500 -- (-2162.676) [-2151.407] (-2155.963) (-2165.661) * (-2155.930) [-2154.790] (-2154.816) (-2156.751) -- 0:04:06 65000 -- (-2163.805) (-2157.858) (-2155.726) [-2156.911] * (-2159.165) (-2156.101) (-2155.793) [-2157.209] -- 0:04:04 Average standard deviation of split frequencies: 0.016071 65500 -- (-2159.882) [-2151.977] (-2156.578) (-2150.990) * [-2159.305] (-2158.579) (-2155.824) (-2156.952) -- 0:04:02 66000 -- [-2155.012] (-2161.565) (-2150.351) (-2158.809) * (-2159.253) (-2158.499) [-2153.114] (-2157.717) -- 0:04:00 66500 -- (-2164.563) (-2162.295) [-2153.259] (-2155.634) * [-2159.903] (-2151.204) (-2153.916) (-2156.208) -- 0:03:58 67000 -- (-2154.984) (-2165.769) (-2156.774) [-2154.457] * (-2159.537) [-2155.246] (-2155.321) (-2154.365) -- 0:03:56 67500 -- (-2155.478) (-2154.327) [-2156.512] (-2153.115) * (-2160.202) (-2163.325) (-2155.764) [-2159.146] -- 0:04:08 68000 -- (-2157.719) [-2152.454] (-2160.760) (-2159.774) * (-2155.680) [-2153.586] (-2154.272) (-2154.817) -- 0:04:06 68500 -- (-2158.249) (-2154.215) (-2158.350) [-2159.685] * [-2155.465] (-2153.660) (-2158.427) (-2158.423) -- 0:04:04 69000 -- [-2150.150] (-2151.478) (-2157.457) (-2160.071) * (-2155.674) (-2157.361) [-2157.053] (-2158.002) -- 0:04:02 69500 -- [-2153.449] (-2152.513) (-2159.691) (-2156.985) * (-2156.633) (-2159.943) [-2152.983] (-2155.177) -- 0:04:00 70000 -- (-2152.817) [-2153.911] (-2158.842) (-2158.339) * (-2157.659) (-2156.245) [-2154.937] (-2159.942) -- 0:03:59 Average standard deviation of split frequencies: 0.005003 70500 -- (-2155.491) (-2160.641) [-2155.374] (-2162.866) * (-2157.829) (-2155.893) [-2161.760] (-2157.223) -- 0:03:57 71000 -- (-2159.777) [-2156.362] (-2154.764) (-2160.223) * (-2157.650) (-2153.031) (-2161.193) [-2161.678] -- 0:03:55 71500 -- (-2165.715) (-2155.682) (-2154.938) [-2159.721] * (-2160.782) [-2159.911] (-2157.887) (-2160.315) -- 0:04:06 72000 -- [-2159.734] (-2156.231) (-2156.208) (-2155.959) * (-2157.284) [-2156.216] (-2150.078) (-2158.736) -- 0:04:04 72500 -- (-2165.557) (-2169.283) [-2153.552] (-2155.335) * [-2159.877] (-2157.146) (-2162.551) (-2158.235) -- 0:04:03 73000 -- (-2157.896) (-2158.996) [-2157.020] (-2162.767) * (-2157.764) (-2153.841) [-2156.292] (-2161.077) -- 0:04:01 73500 -- (-2162.637) (-2159.681) (-2162.353) [-2162.502] * [-2159.694] (-2156.092) (-2160.572) (-2162.270) -- 0:03:59 74000 -- (-2156.861) [-2160.463] (-2160.480) (-2157.915) * (-2165.979) [-2158.437] (-2162.060) (-2155.409) -- 0:03:57 74500 -- [-2156.624] (-2162.828) (-2158.390) (-2157.706) * (-2163.106) (-2153.422) (-2154.127) [-2150.151] -- 0:03:56 75000 -- (-2154.766) (-2158.227) [-2157.463] (-2154.006) * (-2164.269) (-2158.879) (-2156.857) [-2155.424] -- 0:03:54 Average standard deviation of split frequencies: 0.003101 75500 -- (-2154.428) [-2158.458] (-2159.463) (-2155.810) * (-2158.814) [-2156.034] (-2155.693) (-2156.984) -- 0:04:04 76000 -- [-2156.445] (-2167.871) (-2158.621) (-2161.854) * (-2157.629) (-2153.393) (-2159.902) [-2158.188] -- 0:04:03 76500 -- (-2152.323) (-2153.668) [-2156.208] (-2160.286) * (-2154.335) (-2156.284) [-2157.192] (-2155.674) -- 0:04:01 77000 -- [-2152.756] (-2157.414) (-2160.194) (-2155.685) * (-2157.538) (-2153.850) (-2154.479) [-2157.462] -- 0:03:59 77500 -- (-2156.934) (-2153.304) (-2158.012) [-2159.727] * (-2158.536) (-2158.349) (-2157.192) [-2153.468] -- 0:03:58 78000 -- [-2155.166] (-2151.634) (-2158.512) (-2157.114) * (-2155.210) [-2152.570] (-2157.458) (-2158.059) -- 0:03:56 78500 -- (-2154.361) [-2158.350] (-2153.269) (-2158.753) * (-2158.025) [-2163.510] (-2161.381) (-2155.164) -- 0:03:54 79000 -- [-2157.155] (-2156.431) (-2155.540) (-2155.675) * (-2160.791) (-2152.200) [-2152.889] (-2153.812) -- 0:04:04 79500 -- [-2155.971] (-2156.041) (-2157.005) (-2161.363) * (-2158.437) (-2154.565) (-2156.435) [-2162.209] -- 0:04:03 80000 -- (-2156.211) (-2152.787) [-2154.755] (-2164.110) * (-2155.412) (-2160.248) (-2159.525) [-2154.890] -- 0:04:01 Average standard deviation of split frequencies: 0.005844 80500 -- (-2158.125) [-2153.511] (-2156.878) (-2161.768) * [-2159.209] (-2160.796) (-2158.048) (-2158.706) -- 0:03:59 81000 -- [-2155.387] (-2156.813) (-2157.339) (-2158.306) * (-2162.049) [-2151.842] (-2161.504) (-2156.609) -- 0:03:58 81500 -- (-2155.729) (-2154.843) [-2162.917] (-2162.126) * (-2159.502) [-2159.740] (-2162.816) (-2157.892) -- 0:03:56 82000 -- (-2153.645) [-2160.347] (-2163.304) (-2157.738) * (-2159.540) (-2155.876) [-2155.903] (-2151.231) -- 0:03:55 82500 -- (-2153.581) (-2156.497) (-2168.211) [-2154.158] * (-2165.994) (-2154.189) (-2163.511) [-2151.749] -- 0:03:53 83000 -- (-2154.294) [-2158.459] (-2162.722) (-2162.037) * (-2160.902) [-2158.941] (-2161.072) (-2155.280) -- 0:04:03 83500 -- (-2161.151) [-2159.014] (-2159.189) (-2156.681) * (-2155.463) (-2156.679) (-2154.639) [-2158.973] -- 0:04:01 84000 -- [-2155.462] (-2155.651) (-2160.302) (-2156.447) * [-2160.696] (-2158.345) (-2159.500) (-2160.465) -- 0:03:59 84500 -- (-2156.315) (-2158.199) [-2154.815] (-2157.517) * [-2163.048] (-2159.525) (-2153.241) (-2156.457) -- 0:03:58 85000 -- (-2158.255) (-2153.956) [-2161.846] (-2156.451) * (-2162.585) (-2155.245) (-2155.455) [-2162.794] -- 0:03:56 Average standard deviation of split frequencies: 0.010963 85500 -- (-2158.225) (-2156.883) (-2157.714) [-2160.824] * (-2163.720) (-2159.369) (-2158.967) [-2155.647] -- 0:03:55 86000 -- (-2156.964) [-2156.657] (-2156.869) (-2154.883) * [-2159.624] (-2159.360) (-2157.443) (-2157.573) -- 0:03:53 86500 -- (-2155.146) [-2156.957] (-2153.512) (-2158.754) * (-2161.046) (-2159.348) [-2158.685] (-2158.704) -- 0:04:02 87000 -- [-2157.695] (-2159.143) (-2157.972) (-2161.816) * [-2157.952] (-2158.399) (-2160.896) (-2165.213) -- 0:04:01 87500 -- (-2163.248) [-2158.634] (-2157.226) (-2162.510) * (-2155.529) (-2152.796) [-2154.566] (-2165.649) -- 0:03:59 88000 -- (-2151.665) [-2156.169] (-2165.373) (-2171.847) * (-2153.672) (-2164.504) [-2153.815] (-2165.504) -- 0:03:58 88500 -- [-2157.850] (-2155.538) (-2162.630) (-2155.709) * (-2162.196) (-2159.689) [-2161.597] (-2164.709) -- 0:03:56 89000 -- (-2154.775) [-2151.431] (-2155.764) (-2158.892) * (-2155.730) [-2157.950] (-2155.057) (-2164.037) -- 0:03:55 89500 -- (-2162.201) [-2160.468] (-2156.904) (-2156.172) * (-2157.679) (-2167.047) (-2158.050) [-2151.766] -- 0:03:53 90000 -- [-2160.484] (-2166.028) (-2160.938) (-2160.388) * (-2160.275) (-2157.919) (-2153.693) [-2155.498] -- 0:03:52 Average standard deviation of split frequencies: 0.010399 90500 -- (-2156.658) (-2157.139) [-2157.935] (-2166.315) * [-2156.606] (-2158.358) (-2155.063) (-2160.591) -- 0:04:01 91000 -- (-2157.845) (-2159.272) (-2159.031) [-2155.008] * (-2155.904) [-2160.537] (-2153.749) (-2159.518) -- 0:03:59 91500 -- [-2151.053] (-2156.519) (-2157.394) (-2161.974) * (-2160.243) (-2160.139) (-2152.079) [-2155.054] -- 0:03:58 92000 -- (-2165.087) [-2152.044] (-2160.440) (-2156.982) * (-2160.114) (-2158.524) (-2154.666) [-2153.805] -- 0:03:56 92500 -- (-2155.792) (-2157.338) (-2158.992) [-2153.146] * (-2158.133) (-2153.873) [-2160.057] (-2161.020) -- 0:03:55 93000 -- [-2159.623] (-2153.563) (-2151.262) (-2154.750) * (-2155.362) (-2158.498) (-2163.591) [-2156.716] -- 0:03:54 93500 -- (-2159.376) [-2153.602] (-2156.766) (-2155.833) * (-2163.221) [-2152.824] (-2158.441) (-2158.043) -- 0:03:52 94000 -- [-2152.655] (-2158.922) (-2160.620) (-2154.367) * [-2171.913] (-2157.509) (-2167.562) (-2163.582) -- 0:03:51 94500 -- (-2154.801) (-2161.479) (-2160.947) [-2151.743] * (-2153.473) [-2156.363] (-2156.212) (-2158.098) -- 0:03:59 95000 -- (-2157.324) [-2159.240] (-2157.216) (-2156.258) * (-2160.244) (-2153.296) (-2163.875) [-2157.212] -- 0:03:58 Average standard deviation of split frequencies: 0.007366 95500 -- (-2158.197) (-2154.205) [-2159.078] (-2159.914) * (-2156.759) (-2160.063) (-2161.506) [-2152.430] -- 0:03:56 96000 -- (-2159.077) [-2153.675] (-2159.274) (-2161.108) * (-2158.108) (-2155.741) [-2158.157] (-2159.031) -- 0:03:55 96500 -- [-2159.412] (-2155.944) (-2156.592) (-2161.336) * (-2157.985) [-2149.902] (-2159.248) (-2156.899) -- 0:03:54 97000 -- (-2163.562) (-2156.227) [-2157.810] (-2155.683) * (-2156.940) (-2153.951) [-2159.134] (-2157.617) -- 0:03:52 97500 -- (-2157.600) [-2162.130] (-2150.939) (-2164.764) * [-2155.450] (-2152.929) (-2157.511) (-2163.859) -- 0:03:51 98000 -- (-2154.805) [-2160.277] (-2164.233) (-2171.574) * (-2160.169) (-2154.664) (-2152.780) [-2157.582] -- 0:03:59 98500 -- (-2157.829) (-2155.577) [-2160.711] (-2164.878) * (-2162.470) (-2154.988) [-2159.567] (-2155.652) -- 0:03:57 99000 -- (-2163.588) (-2159.280) (-2155.442) [-2156.918] * (-2159.568) [-2157.030] (-2162.630) (-2158.694) -- 0:03:56 99500 -- (-2157.761) (-2154.664) [-2153.160] (-2160.964) * (-2157.829) (-2153.249) (-2173.042) [-2156.895] -- 0:03:55 100000 -- (-2159.405) (-2154.911) [-2155.666] (-2152.407) * (-2157.654) (-2157.755) [-2158.693] (-2157.178) -- 0:03:53 Average standard deviation of split frequencies: 0.004683 100500 -- (-2163.747) [-2154.252] (-2156.461) (-2153.904) * (-2151.317) (-2151.201) (-2155.198) [-2151.668] -- 0:03:52 101000 -- (-2157.200) (-2157.390) [-2154.905] (-2159.430) * (-2155.490) (-2153.125) [-2156.824] (-2157.482) -- 0:03:51 101500 -- [-2153.285] (-2155.101) (-2155.541) (-2162.715) * (-2156.536) (-2158.872) [-2161.799] (-2150.801) -- 0:03:50 102000 -- (-2155.253) (-2154.662) (-2153.248) [-2157.938] * [-2155.936] (-2153.661) (-2156.073) (-2157.035) -- 0:03:57 102500 -- (-2162.391) (-2158.301) (-2157.029) [-2154.191] * [-2156.789] (-2158.496) (-2156.941) (-2154.559) -- 0:03:56 103000 -- (-2156.686) (-2156.070) [-2152.371] (-2157.675) * (-2165.623) (-2158.694) [-2167.206] (-2154.956) -- 0:03:55 103500 -- (-2156.560) (-2160.195) (-2150.250) [-2151.591] * (-2160.155) (-2158.641) (-2156.009) [-2150.813] -- 0:03:53 104000 -- (-2156.849) [-2153.884] (-2153.251) (-2156.156) * (-2152.365) [-2153.052] (-2158.772) (-2160.630) -- 0:03:52 104500 -- (-2159.438) (-2159.139) (-2151.635) [-2156.727] * [-2153.549] (-2163.159) (-2159.136) (-2157.396) -- 0:03:51 105000 -- (-2161.387) (-2164.837) (-2158.072) [-2155.616] * (-2160.181) (-2171.139) [-2155.065] (-2162.504) -- 0:03:50 Average standard deviation of split frequencies: 0.011118 105500 -- (-2161.368) (-2162.485) [-2155.227] (-2170.976) * [-2154.378] (-2163.300) (-2160.180) (-2159.982) -- 0:03:57 106000 -- [-2161.879] (-2164.004) (-2153.583) (-2164.502) * [-2152.346] (-2156.122) (-2160.475) (-2156.908) -- 0:03:56 106500 -- (-2167.796) (-2161.308) (-2151.956) [-2159.510] * [-2153.477] (-2159.299) (-2154.867) (-2155.867) -- 0:03:54 107000 -- (-2162.282) (-2164.255) [-2158.926] (-2162.979) * (-2158.064) [-2159.507] (-2157.366) (-2166.147) -- 0:03:53 107500 -- (-2166.892) [-2157.706] (-2159.036) (-2155.527) * (-2159.343) [-2167.983] (-2163.972) (-2161.272) -- 0:03:52 108000 -- (-2169.373) (-2156.261) [-2151.848] (-2157.352) * (-2165.933) (-2159.166) [-2154.347] (-2157.854) -- 0:03:51 108500 -- (-2164.284) (-2160.667) [-2156.243] (-2159.512) * (-2160.868) (-2165.252) (-2162.648) [-2160.596] -- 0:03:50 109000 -- (-2160.060) (-2160.763) (-2160.393) [-2156.672] * [-2158.076] (-2156.641) (-2154.755) (-2160.848) -- 0:03:48 109500 -- (-2157.591) [-2157.901] (-2156.186) (-2154.676) * [-2154.581] (-2156.619) (-2157.070) (-2157.257) -- 0:03:55 110000 -- (-2159.906) [-2154.133] (-2154.983) (-2154.830) * [-2152.474] (-2155.031) (-2154.112) (-2150.863) -- 0:03:54 Average standard deviation of split frequencies: 0.008519 110500 -- [-2151.954] (-2155.647) (-2164.061) (-2159.606) * [-2155.671] (-2158.380) (-2162.728) (-2159.327) -- 0:03:53 111000 -- (-2156.575) (-2157.284) (-2160.133) [-2155.877] * [-2154.599] (-2155.895) (-2160.685) (-2158.988) -- 0:03:52 111500 -- (-2151.573) [-2156.106] (-2152.642) (-2157.145) * (-2156.282) [-2155.738] (-2169.008) (-2153.327) -- 0:03:51 112000 -- (-2161.052) (-2163.527) (-2157.853) [-2154.687] * (-2160.589) [-2155.471] (-2160.907) (-2153.845) -- 0:03:49 112500 -- (-2151.792) (-2157.480) [-2158.336] (-2157.186) * (-2160.325) (-2157.055) [-2156.227] (-2155.630) -- 0:03:48 113000 -- (-2159.876) (-2160.837) (-2158.391) [-2159.158] * (-2155.181) [-2159.693] (-2159.333) (-2151.449) -- 0:03:55 113500 -- (-2162.904) [-2157.017] (-2154.340) (-2157.363) * (-2165.620) [-2157.935] (-2158.836) (-2155.816) -- 0:03:54 114000 -- (-2165.732) (-2159.132) (-2155.378) [-2152.083] * (-2167.787) (-2157.585) (-2162.587) [-2152.892] -- 0:03:53 114500 -- (-2160.913) (-2158.048) [-2154.675] (-2155.234) * (-2160.006) [-2160.125] (-2167.759) (-2156.142) -- 0:03:52 115000 -- (-2158.265) [-2157.090] (-2155.901) (-2157.566) * (-2160.141) [-2153.429] (-2160.690) (-2161.768) -- 0:03:50 Average standard deviation of split frequencies: 0.006096 115500 -- (-2159.337) [-2153.936] (-2157.653) (-2154.007) * (-2163.806) [-2153.515] (-2154.780) (-2160.269) -- 0:03:49 116000 -- (-2160.915) (-2154.731) (-2151.982) [-2153.132] * (-2163.757) [-2152.788] (-2157.055) (-2157.489) -- 0:03:48 116500 -- (-2161.638) (-2156.892) [-2157.394] (-2156.617) * (-2154.126) (-2158.368) [-2152.368] (-2156.861) -- 0:03:47 117000 -- (-2168.403) [-2152.631] (-2153.801) (-2158.460) * (-2152.501) [-2154.737] (-2152.932) (-2175.409) -- 0:03:53 117500 -- (-2159.332) (-2160.902) (-2152.134) [-2158.614] * (-2168.527) [-2153.411] (-2159.764) (-2160.862) -- 0:03:52 118000 -- [-2156.369] (-2156.962) (-2153.417) (-2157.844) * (-2160.899) (-2162.110) (-2157.061) [-2158.899] -- 0:03:51 118500 -- [-2155.068] (-2158.539) (-2151.009) (-2157.075) * (-2167.279) (-2153.398) [-2155.173] (-2152.635) -- 0:03:50 119000 -- (-2159.200) (-2161.328) [-2152.836] (-2153.980) * (-2159.673) [-2160.827] (-2160.946) (-2156.082) -- 0:03:49 119500 -- (-2158.762) (-2150.863) [-2154.623] (-2155.017) * (-2154.847) [-2155.628] (-2156.364) (-2156.284) -- 0:03:48 120000 -- (-2155.390) (-2156.168) (-2154.965) [-2155.931] * [-2154.221] (-2153.262) (-2170.692) (-2150.879) -- 0:03:47 Average standard deviation of split frequencies: 0.005860 120500 -- (-2167.546) [-2150.731] (-2156.217) (-2157.340) * [-2160.154] (-2158.992) (-2160.923) (-2157.691) -- 0:03:46 121000 -- (-2158.446) [-2152.866] (-2158.906) (-2167.448) * (-2156.867) (-2154.947) (-2158.657) [-2158.395] -- 0:03:52 121500 -- (-2159.961) [-2152.543] (-2153.207) (-2153.160) * (-2161.558) [-2156.724] (-2157.788) (-2165.328) -- 0:03:51 122000 -- [-2163.413] (-2163.176) (-2152.992) (-2153.365) * [-2155.639] (-2153.797) (-2151.266) (-2155.623) -- 0:03:50 122500 -- [-2153.236] (-2158.084) (-2151.805) (-2152.620) * (-2155.052) (-2154.844) [-2160.968] (-2157.421) -- 0:03:49 123000 -- (-2158.346) (-2161.018) [-2151.945] (-2155.143) * [-2154.500] (-2156.668) (-2157.456) (-2159.011) -- 0:03:48 123500 -- (-2157.083) [-2159.393] (-2157.200) (-2154.099) * (-2171.012) (-2159.193) [-2151.220] (-2157.792) -- 0:03:47 124000 -- (-2158.020) (-2158.242) [-2155.809] (-2154.989) * (-2162.560) (-2162.327) (-2155.520) [-2162.095] -- 0:03:46 124500 -- (-2154.063) (-2153.047) [-2159.968] (-2156.510) * (-2161.671) (-2159.293) [-2158.749] (-2160.284) -- 0:03:52 125000 -- (-2156.925) [-2157.290] (-2153.472) (-2159.995) * [-2154.865] (-2159.844) (-2157.659) (-2160.100) -- 0:03:51 Average standard deviation of split frequencies: 0.004677 125500 -- (-2154.309) (-2156.658) [-2149.815] (-2154.315) * [-2152.886] (-2171.796) (-2163.072) (-2156.633) -- 0:03:49 126000 -- (-2166.063) [-2153.618] (-2152.697) (-2156.176) * (-2158.201) [-2155.287] (-2155.620) (-2162.945) -- 0:03:48 126500 -- (-2159.333) (-2159.059) (-2153.477) [-2160.562] * (-2155.719) (-2158.012) [-2154.750] (-2161.687) -- 0:03:47 127000 -- [-2163.183] (-2157.712) (-2156.505) (-2152.853) * (-2157.051) (-2157.819) (-2158.061) [-2153.675] -- 0:03:46 127500 -- (-2158.093) (-2159.699) (-2155.986) [-2159.103] * [-2160.832] (-2160.081) (-2157.857) (-2156.120) -- 0:03:45 128000 -- [-2164.819] (-2152.704) (-2158.250) (-2161.322) * (-2156.725) (-2159.947) [-2158.219] (-2153.770) -- 0:03:44 128500 -- (-2155.901) [-2155.397] (-2151.563) (-2160.700) * (-2165.106) (-2158.448) [-2160.399] (-2157.728) -- 0:03:50 129000 -- [-2154.179] (-2154.734) (-2154.969) (-2156.229) * (-2163.135) [-2153.340] (-2158.300) (-2159.383) -- 0:03:49 129500 -- (-2172.048) (-2160.511) (-2155.348) [-2157.655] * (-2166.249) (-2158.232) [-2156.329] (-2159.955) -- 0:03:48 130000 -- [-2154.530] (-2157.674) (-2157.840) (-2163.993) * (-2160.457) [-2152.895] (-2163.232) (-2159.559) -- 0:03:47 Average standard deviation of split frequencies: 0.012627 130500 -- (-2156.341) (-2160.689) (-2152.146) [-2163.173] * (-2154.647) (-2157.923) [-2149.527] (-2159.776) -- 0:03:46 131000 -- (-2158.388) [-2161.566] (-2156.520) (-2154.196) * [-2155.495] (-2156.103) (-2152.799) (-2161.609) -- 0:03:45 131500 -- (-2161.137) [-2156.094] (-2154.179) (-2153.576) * (-2169.138) [-2156.496] (-2154.221) (-2158.470) -- 0:03:44 132000 -- (-2161.052) [-2153.538] (-2153.720) (-2159.315) * [-2161.550] (-2153.858) (-2155.461) (-2160.564) -- 0:03:43 132500 -- [-2162.142] (-2157.083) (-2161.596) (-2154.309) * (-2164.709) (-2155.399) [-2158.471] (-2161.119) -- 0:03:49 133000 -- (-2155.663) [-2156.522] (-2166.236) (-2154.368) * (-2159.290) (-2154.303) [-2157.915] (-2167.311) -- 0:03:48 133500 -- (-2160.695) (-2153.903) (-2157.053) [-2156.561] * (-2154.374) (-2162.600) (-2160.445) [-2162.089] -- 0:03:47 134000 -- (-2158.714) (-2156.058) (-2155.311) [-2154.966] * (-2155.897) (-2157.486) [-2155.335] (-2162.041) -- 0:03:46 134500 -- (-2154.199) (-2160.101) [-2160.399] (-2158.891) * [-2154.930] (-2154.899) (-2157.612) (-2161.850) -- 0:03:45 135000 -- (-2158.296) (-2158.877) (-2156.402) [-2156.611] * (-2161.459) (-2161.890) (-2157.935) [-2156.355] -- 0:03:44 Average standard deviation of split frequencies: 0.014731 135500 -- (-2154.985) (-2153.322) (-2156.605) [-2154.165] * [-2162.356] (-2163.605) (-2159.426) (-2159.207) -- 0:03:43 136000 -- (-2152.049) (-2163.188) (-2158.966) [-2154.304] * (-2156.277) [-2159.491] (-2157.542) (-2157.779) -- 0:03:48 136500 -- [-2150.590] (-2167.075) (-2160.174) (-2159.340) * (-2158.212) (-2158.060) [-2158.925] (-2158.802) -- 0:03:47 137000 -- [-2153.497] (-2166.342) (-2164.360) (-2162.330) * [-2160.582] (-2155.366) (-2155.968) (-2156.737) -- 0:03:46 137500 -- [-2154.708] (-2162.582) (-2156.885) (-2160.495) * (-2154.834) [-2160.082] (-2154.072) (-2159.369) -- 0:03:45 138000 -- [-2153.309] (-2157.758) (-2165.201) (-2154.946) * [-2150.798] (-2156.849) (-2155.723) (-2153.377) -- 0:03:44 138500 -- (-2151.928) [-2153.031] (-2155.795) (-2151.522) * (-2155.187) (-2156.829) (-2154.625) [-2151.799] -- 0:03:43 139000 -- (-2158.618) (-2153.910) (-2159.637) [-2165.436] * (-2159.708) (-2159.300) [-2160.082] (-2158.786) -- 0:03:42 139500 -- (-2155.414) (-2154.817) (-2156.314) [-2153.934] * (-2157.527) (-2157.847) [-2159.847] (-2151.006) -- 0:03:42 140000 -- (-2151.715) [-2156.081] (-2161.980) (-2158.068) * (-2158.454) (-2156.575) [-2158.260] (-2160.117) -- 0:03:47 Average standard deviation of split frequencies: 0.015080 140500 -- (-2161.305) [-2156.905] (-2156.867) (-2162.770) * (-2157.722) (-2156.077) [-2160.277] (-2157.647) -- 0:03:46 141000 -- [-2153.034] (-2161.618) (-2155.644) (-2161.454) * (-2155.971) (-2156.396) [-2155.646] (-2158.077) -- 0:03:45 141500 -- (-2156.624) (-2154.474) [-2156.715] (-2160.460) * (-2161.827) (-2156.711) [-2150.663] (-2153.331) -- 0:03:44 142000 -- (-2156.121) (-2154.101) (-2157.773) [-2159.786] * (-2155.164) [-2155.203] (-2159.679) (-2159.497) -- 0:03:43 142500 -- (-2153.654) (-2160.324) (-2153.789) [-2159.607] * (-2160.730) [-2158.545] (-2161.046) (-2159.397) -- 0:03:42 143000 -- (-2158.448) (-2159.875) [-2158.383] (-2159.322) * [-2154.327] (-2159.338) (-2153.144) (-2159.420) -- 0:03:47 143500 -- (-2159.512) [-2153.780] (-2158.586) (-2151.985) * (-2168.170) [-2154.270] (-2157.885) (-2155.670) -- 0:03:46 144000 -- (-2161.870) (-2155.553) [-2158.593] (-2158.013) * (-2155.622) (-2158.526) (-2153.669) [-2158.461] -- 0:03:45 144500 -- (-2169.758) (-2151.395) (-2157.595) [-2159.378] * (-2162.885) [-2156.391] (-2161.371) (-2160.484) -- 0:03:44 145000 -- [-2160.427] (-2155.795) (-2160.443) (-2158.321) * (-2155.661) (-2158.535) [-2156.310] (-2151.851) -- 0:03:44 Average standard deviation of split frequencies: 0.016144 145500 -- (-2160.859) (-2161.828) [-2159.472] (-2163.395) * (-2155.382) [-2156.052] (-2160.958) (-2155.873) -- 0:03:43 146000 -- [-2153.298] (-2159.574) (-2158.156) (-2161.838) * (-2149.568) (-2157.495) [-2158.793] (-2165.788) -- 0:03:48 146500 -- (-2156.178) [-2156.448] (-2169.873) (-2155.108) * (-2150.794) (-2155.362) [-2156.232] (-2158.163) -- 0:03:47 147000 -- (-2160.123) (-2169.731) [-2154.758] (-2158.662) * [-2156.245] (-2157.376) (-2159.403) (-2156.072) -- 0:03:46 147500 -- (-2158.321) [-2157.256] (-2155.176) (-2159.852) * [-2153.696] (-2158.426) (-2164.318) (-2155.831) -- 0:03:45 148000 -- (-2156.925) (-2158.013) (-2156.835) [-2157.414] * (-2162.532) (-2154.881) [-2152.473] (-2153.801) -- 0:03:44 148500 -- [-2156.139] (-2152.279) (-2155.989) (-2160.801) * (-2155.182) [-2153.322] (-2158.862) (-2160.139) -- 0:03:43 149000 -- (-2165.512) [-2155.835] (-2161.055) (-2158.669) * (-2154.301) [-2156.436] (-2156.392) (-2159.765) -- 0:03:42 149500 -- (-2153.107) [-2152.586] (-2165.605) (-2153.128) * (-2154.625) (-2154.470) (-2154.570) [-2157.850] -- 0:03:41 150000 -- (-2154.039) (-2153.292) [-2151.885] (-2153.416) * (-2154.562) [-2153.633] (-2166.048) (-2155.903) -- 0:03:46 Average standard deviation of split frequencies: 0.021902 150500 -- [-2158.536] (-2161.707) (-2153.824) (-2162.705) * [-2153.188] (-2151.775) (-2158.040) (-2156.837) -- 0:03:45 151000 -- (-2160.433) (-2155.801) [-2152.559] (-2157.386) * (-2156.948) [-2155.726] (-2158.211) (-2159.737) -- 0:03:44 151500 -- [-2157.454] (-2153.751) (-2154.752) (-2155.847) * (-2158.059) (-2161.119) [-2155.073] (-2150.892) -- 0:03:44 152000 -- (-2156.832) [-2154.399] (-2158.348) (-2150.662) * (-2173.613) [-2155.706] (-2152.587) (-2156.749) -- 0:03:43 152500 -- [-2150.976] (-2154.819) (-2156.945) (-2156.573) * [-2161.355] (-2157.053) (-2158.890) (-2160.262) -- 0:03:42 153000 -- (-2160.653) [-2157.238] (-2153.885) (-2155.904) * (-2158.268) (-2155.345) [-2150.992] (-2160.072) -- 0:03:41 153500 -- (-2157.335) (-2156.625) (-2155.961) [-2160.520] * (-2162.595) [-2154.925] (-2155.188) (-2162.862) -- 0:03:46 154000 -- [-2155.327] (-2157.857) (-2158.051) (-2165.440) * [-2153.467] (-2160.551) (-2157.351) (-2162.135) -- 0:03:45 154500 -- (-2157.423) [-2154.870] (-2163.640) (-2160.339) * [-2155.048] (-2155.840) (-2159.750) (-2163.865) -- 0:03:44 155000 -- (-2156.525) [-2158.945] (-2161.676) (-2161.505) * (-2153.787) (-2157.803) (-2150.843) [-2151.341] -- 0:03:43 Average standard deviation of split frequencies: 0.018886 155500 -- [-2160.485] (-2159.279) (-2166.160) (-2158.054) * (-2158.043) [-2158.071] (-2155.021) (-2159.592) -- 0:03:42 156000 -- [-2161.044] (-2161.417) (-2160.290) (-2158.145) * (-2153.314) [-2153.596] (-2154.533) (-2155.953) -- 0:03:41 156500 -- [-2155.654] (-2157.351) (-2159.269) (-2165.580) * [-2153.124] (-2151.116) (-2164.226) (-2157.073) -- 0:03:40 157000 -- (-2154.500) [-2152.159] (-2155.583) (-2172.133) * (-2153.849) (-2154.099) (-2153.606) [-2158.941] -- 0:03:45 157500 -- (-2162.511) [-2162.587] (-2156.149) (-2160.565) * [-2150.032] (-2156.595) (-2153.726) (-2160.666) -- 0:03:44 158000 -- (-2155.577) (-2159.135) (-2155.234) [-2152.904] * [-2154.811] (-2158.521) (-2155.649) (-2158.680) -- 0:03:43 158500 -- [-2155.267] (-2156.019) (-2157.639) (-2157.195) * (-2158.865) (-2167.729) (-2161.088) [-2155.292] -- 0:03:42 159000 -- (-2160.067) [-2156.735] (-2161.061) (-2153.468) * (-2157.306) (-2155.483) [-2156.654] (-2155.989) -- 0:03:42 159500 -- (-2155.634) [-2159.550] (-2160.545) (-2155.589) * (-2157.084) (-2159.691) [-2156.345] (-2155.129) -- 0:03:41 160000 -- [-2153.251] (-2158.908) (-2163.237) (-2152.494) * (-2151.893) (-2164.423) (-2157.145) [-2159.946] -- 0:03:45 Average standard deviation of split frequencies: 0.019805 160500 -- (-2154.484) (-2165.058) (-2152.456) [-2158.113] * (-2158.621) (-2155.005) (-2153.124) [-2155.149] -- 0:03:44 161000 -- (-2162.267) (-2153.951) [-2156.995] (-2160.316) * [-2158.891] (-2162.012) (-2158.703) (-2163.486) -- 0:03:44 161500 -- (-2153.201) [-2149.505] (-2153.743) (-2155.326) * (-2162.058) (-2158.775) [-2152.204] (-2162.467) -- 0:03:43 162000 -- [-2156.368] (-2155.927) (-2157.751) (-2159.783) * [-2157.578] (-2162.126) (-2163.250) (-2165.871) -- 0:03:42 162500 -- (-2169.756) (-2165.849) [-2152.688] (-2162.722) * (-2157.625) (-2153.799) [-2153.557] (-2158.828) -- 0:03:41 163000 -- [-2159.657] (-2155.784) (-2157.108) (-2160.032) * (-2154.640) (-2165.842) [-2160.748] (-2157.921) -- 0:03:40 163500 -- (-2152.355) [-2162.970] (-2154.430) (-2160.302) * (-2156.573) [-2154.434] (-2157.474) (-2155.494) -- 0:03:39 164000 -- [-2156.601] (-2154.382) (-2152.266) (-2168.115) * (-2151.186) (-2153.451) [-2151.581] (-2155.784) -- 0:03:44 164500 -- [-2154.833] (-2161.838) (-2157.140) (-2154.802) * (-2154.159) (-2154.941) [-2153.150] (-2155.268) -- 0:03:43 165000 -- (-2154.911) (-2163.831) (-2161.326) [-2158.230] * (-2163.155) (-2155.523) [-2160.552] (-2160.172) -- 0:03:42 Average standard deviation of split frequencies: 0.017749 165500 -- (-2155.674) (-2156.322) (-2152.665) [-2154.873] * (-2161.689) (-2159.233) [-2153.242] (-2153.317) -- 0:03:41 166000 -- (-2155.923) (-2157.543) (-2152.120) [-2156.243] * [-2156.232] (-2156.585) (-2159.256) (-2168.142) -- 0:03:41 166500 -- (-2158.542) (-2159.985) [-2156.050] (-2158.160) * (-2160.739) (-2153.943) (-2160.178) [-2159.468] -- 0:03:40 167000 -- (-2160.018) [-2161.149] (-2158.991) (-2155.919) * (-2161.226) (-2154.650) (-2158.158) [-2157.368] -- 0:03:44 167500 -- [-2157.840] (-2159.644) (-2158.980) (-2156.007) * (-2160.053) [-2152.563] (-2156.082) (-2159.384) -- 0:03:43 168000 -- (-2163.152) (-2161.574) (-2158.771) [-2155.409] * (-2158.099) (-2152.497) [-2152.567] (-2160.658) -- 0:03:42 168500 -- [-2154.944] (-2158.154) (-2160.000) (-2156.399) * (-2165.329) (-2164.885) [-2153.667] (-2157.414) -- 0:03:42 169000 -- (-2153.059) (-2155.643) [-2162.438] (-2165.504) * (-2165.738) (-2161.272) [-2155.945] (-2157.983) -- 0:03:41 169500 -- (-2154.162) (-2155.555) (-2154.975) [-2154.773] * (-2160.308) (-2155.780) [-2158.478] (-2156.500) -- 0:03:40 170000 -- (-2157.265) (-2154.260) [-2155.801] (-2153.774) * (-2165.604) (-2162.665) [-2157.665] (-2156.518) -- 0:03:44 Average standard deviation of split frequencies: 0.018644 170500 -- (-2155.616) (-2155.622) [-2154.348] (-2155.045) * [-2153.922] (-2154.773) (-2157.388) (-2166.503) -- 0:03:43 171000 -- (-2155.833) (-2161.192) [-2155.572] (-2157.781) * (-2160.913) (-2157.745) [-2152.941] (-2159.097) -- 0:03:43 171500 -- (-2158.865) [-2158.049] (-2156.820) (-2159.070) * [-2155.003] (-2161.313) (-2158.357) (-2154.311) -- 0:03:42 172000 -- [-2156.393] (-2154.827) (-2154.019) (-2155.380) * (-2156.686) (-2165.531) [-2160.781] (-2159.457) -- 0:03:41 172500 -- [-2156.409] (-2155.063) (-2158.461) (-2166.519) * (-2162.622) (-2159.459) [-2153.520] (-2155.861) -- 0:03:40 173000 -- (-2152.467) (-2158.122) (-2154.966) [-2156.684] * [-2158.307] (-2159.049) (-2157.745) (-2154.926) -- 0:03:44 173500 -- [-2150.394] (-2156.647) (-2155.072) (-2153.862) * (-2160.207) [-2153.792] (-2164.802) (-2155.945) -- 0:03:43 174000 -- (-2157.418) [-2161.743] (-2159.095) (-2160.832) * (-2158.543) (-2172.210) (-2155.495) [-2156.461] -- 0:03:43 174500 -- [-2151.630] (-2161.011) (-2156.722) (-2156.434) * (-2168.071) (-2155.050) (-2150.644) [-2153.849] -- 0:03:42 175000 -- (-2155.072) (-2157.085) [-2155.898] (-2161.612) * (-2165.145) (-2157.313) [-2155.388] (-2164.734) -- 0:03:41 Average standard deviation of split frequencies: 0.018079 175500 -- [-2152.805] (-2158.488) (-2161.897) (-2165.463) * (-2154.527) (-2157.540) (-2155.673) [-2159.811] -- 0:03:40 176000 -- (-2155.581) (-2156.537) [-2155.384] (-2157.369) * (-2155.997) (-2155.842) (-2159.286) [-2158.747] -- 0:03:44 176500 -- (-2155.774) (-2152.466) [-2154.509] (-2155.840) * (-2165.430) (-2161.657) (-2154.174) [-2157.735] -- 0:03:43 177000 -- [-2152.567] (-2156.727) (-2156.682) (-2151.847) * [-2155.496] (-2158.118) (-2157.577) (-2158.467) -- 0:03:43 177500 -- [-2152.937] (-2154.990) (-2161.041) (-2153.517) * (-2156.290) (-2154.658) (-2157.395) [-2154.336] -- 0:03:42 178000 -- [-2156.208] (-2159.438) (-2167.037) (-2154.420) * (-2157.390) [-2158.678] (-2162.465) (-2151.866) -- 0:03:41 178500 -- (-2155.398) (-2158.920) [-2154.945] (-2159.261) * (-2156.212) (-2165.287) [-2154.921] (-2157.960) -- 0:03:40 179000 -- (-2152.959) (-2152.311) (-2160.362) [-2153.326] * (-2162.044) (-2159.177) (-2157.420) [-2153.538] -- 0:03:40 179500 -- (-2164.566) (-2154.221) (-2166.283) [-2157.806] * (-2159.426) [-2158.654] (-2161.755) (-2155.940) -- 0:03:39 180000 -- [-2170.484] (-2158.064) (-2161.513) (-2159.130) * (-2159.465) (-2151.871) [-2159.258] (-2156.259) -- 0:03:43 Average standard deviation of split frequencies: 0.019569 180500 -- [-2152.762] (-2158.054) (-2163.040) (-2164.959) * (-2158.530) [-2152.820] (-2163.890) (-2157.992) -- 0:03:42 181000 -- [-2152.750] (-2152.487) (-2154.493) (-2158.664) * (-2152.337) (-2163.413) [-2153.567] (-2160.008) -- 0:03:41 181500 -- (-2154.330) (-2157.488) [-2156.007] (-2165.744) * (-2152.811) (-2166.850) (-2155.881) [-2152.823] -- 0:03:40 182000 -- (-2155.996) [-2160.670] (-2154.752) (-2156.383) * (-2168.057) (-2160.357) (-2156.248) [-2154.433] -- 0:03:40 182500 -- [-2159.950] (-2152.889) (-2160.036) (-2164.102) * (-2160.694) (-2163.546) [-2156.262] (-2162.265) -- 0:03:39 183000 -- (-2160.406) [-2159.589] (-2162.504) (-2154.419) * (-2156.268) (-2160.591) [-2153.987] (-2151.898) -- 0:03:43 183500 -- (-2158.493) (-2159.183) (-2156.685) [-2151.623] * [-2157.040] (-2160.122) (-2158.746) (-2153.242) -- 0:03:42 184000 -- (-2156.087) [-2161.367] (-2155.214) (-2161.698) * [-2154.449] (-2159.393) (-2154.675) (-2149.952) -- 0:03:41 184500 -- (-2159.441) [-2160.930] (-2159.704) (-2157.742) * [-2151.650] (-2155.160) (-2160.888) (-2157.053) -- 0:03:41 185000 -- (-2155.095) (-2156.073) [-2155.862] (-2164.540) * [-2157.301] (-2160.844) (-2164.825) (-2158.531) -- 0:03:40 Average standard deviation of split frequencies: 0.019008 185500 -- (-2162.523) (-2160.977) [-2157.320] (-2158.038) * (-2160.712) (-2157.784) [-2155.415] (-2155.124) -- 0:03:39 186000 -- (-2166.454) [-2157.552] (-2156.208) (-2154.876) * (-2151.835) (-2161.964) [-2154.979] (-2158.311) -- 0:03:43 186500 -- (-2161.459) (-2155.431) [-2155.349] (-2154.732) * [-2158.163] (-2160.184) (-2155.790) (-2156.881) -- 0:03:42 187000 -- (-2163.702) (-2159.586) (-2160.140) [-2156.164] * (-2157.699) (-2156.790) [-2160.622] (-2161.847) -- 0:03:41 187500 -- (-2153.702) (-2153.477) [-2158.223] (-2158.213) * [-2154.291] (-2159.854) (-2158.980) (-2160.983) -- 0:03:41 188000 -- [-2158.267] (-2159.133) (-2157.039) (-2152.272) * (-2154.769) [-2157.016] (-2156.923) (-2155.212) -- 0:03:40 188500 -- (-2156.187) (-2158.125) (-2165.734) [-2158.247] * [-2160.148] (-2159.530) (-2162.717) (-2156.493) -- 0:03:39 189000 -- [-2153.794] (-2160.791) (-2161.050) (-2153.145) * (-2166.901) (-2154.198) [-2155.012] (-2159.828) -- 0:03:38 189500 -- (-2158.952) (-2155.462) (-2158.435) [-2156.197] * (-2157.129) (-2158.707) (-2155.974) [-2163.474] -- 0:03:42 190000 -- [-2154.841] (-2153.829) (-2150.691) (-2153.740) * (-2157.216) [-2156.093] (-2164.476) (-2153.693) -- 0:03:41 Average standard deviation of split frequencies: 0.020397 190500 -- (-2153.159) [-2154.922] (-2158.886) (-2155.566) * (-2157.383) [-2157.345] (-2160.918) (-2153.148) -- 0:03:40 191000 -- (-2155.294) (-2159.057) [-2158.455] (-2164.389) * (-2156.881) (-2154.497) (-2159.049) [-2159.118] -- 0:03:40 191500 -- [-2155.783] (-2162.813) (-2156.349) (-2157.757) * [-2163.139] (-2159.302) (-2162.115) (-2157.826) -- 0:03:39 192000 -- (-2154.707) [-2152.493] (-2161.106) (-2155.800) * (-2165.470) (-2156.186) (-2155.899) [-2150.834] -- 0:03:38 192500 -- [-2153.263] (-2158.863) (-2160.769) (-2157.862) * [-2158.258] (-2163.088) (-2160.493) (-2153.488) -- 0:03:42 193000 -- (-2157.256) (-2153.543) [-2158.864] (-2157.741) * (-2153.900) (-2159.054) [-2155.952] (-2156.307) -- 0:03:41 193500 -- [-2157.354] (-2155.521) (-2156.118) (-2152.824) * (-2156.900) (-2154.758) (-2154.891) [-2158.638] -- 0:03:40 194000 -- (-2151.604) (-2154.838) (-2151.550) [-2157.932] * (-2161.748) (-2157.849) [-2159.382] (-2161.151) -- 0:03:40 194500 -- [-2151.455] (-2156.782) (-2163.553) (-2161.207) * (-2160.408) (-2154.350) [-2162.756] (-2155.082) -- 0:03:39 195000 -- [-2159.896] (-2157.154) (-2153.647) (-2160.755) * (-2159.344) [-2154.258] (-2155.192) (-2167.390) -- 0:03:38 Average standard deviation of split frequencies: 0.018038 195500 -- [-2152.505] (-2153.259) (-2153.456) (-2158.031) * (-2156.676) [-2158.501] (-2151.197) (-2158.063) -- 0:03:38 196000 -- [-2154.726] (-2155.616) (-2156.225) (-2161.283) * (-2160.960) [-2154.514] (-2153.952) (-2155.638) -- 0:03:37 196500 -- [-2164.867] (-2162.797) (-2160.312) (-2165.931) * (-2158.714) (-2160.041) (-2160.369) [-2156.059] -- 0:03:40 197000 -- (-2160.537) (-2156.414) (-2158.452) [-2156.854] * (-2156.288) (-2156.755) [-2166.178] (-2159.600) -- 0:03:40 197500 -- [-2158.420] (-2153.439) (-2157.741) (-2159.221) * (-2155.727) (-2156.012) (-2156.825) [-2156.332] -- 0:03:39 198000 -- [-2156.575] (-2158.172) (-2160.280) (-2150.851) * (-2158.714) [-2158.725] (-2152.929) (-2158.089) -- 0:03:38 198500 -- (-2156.539) [-2153.740] (-2158.147) (-2159.094) * (-2154.711) (-2160.832) [-2151.074] (-2156.518) -- 0:03:38 199000 -- (-2151.587) [-2155.955] (-2158.957) (-2168.672) * (-2162.677) [-2155.964] (-2153.582) (-2156.599) -- 0:03:37 199500 -- (-2154.714) [-2154.025] (-2154.431) (-2159.628) * (-2155.854) (-2164.544) [-2154.678] (-2161.558) -- 0:03:36 200000 -- (-2160.439) (-2158.691) (-2157.881) [-2155.285] * [-2157.439] (-2160.376) (-2160.380) (-2155.259) -- 0:03:36 Average standard deviation of split frequencies: 0.018794 200500 -- [-2154.035] (-2154.077) (-2157.773) (-2158.607) * (-2160.562) [-2155.067] (-2153.118) (-2164.266) -- 0:03:39 201000 -- (-2159.925) [-2154.155] (-2159.814) (-2158.195) * [-2151.771] (-2160.263) (-2161.598) (-2162.425) -- 0:03:38 201500 -- (-2154.787) [-2157.568] (-2150.476) (-2160.492) * (-2158.583) [-2156.122] (-2157.819) (-2163.556) -- 0:03:37 202000 -- [-2155.817] (-2158.450) (-2160.180) (-2161.719) * (-2152.151) (-2160.680) [-2164.383] (-2164.138) -- 0:03:37 202500 -- (-2163.050) (-2161.018) (-2159.470) [-2156.148] * (-2157.594) (-2157.874) [-2158.776] (-2152.480) -- 0:03:36 203000 -- (-2158.469) [-2157.760] (-2156.247) (-2156.721) * [-2155.301] (-2154.365) (-2165.739) (-2156.037) -- 0:03:35 203500 -- (-2168.848) (-2155.445) [-2156.220] (-2158.659) * (-2163.994) (-2156.782) [-2152.125] (-2155.995) -- 0:03:35 204000 -- [-2157.724] (-2163.594) (-2154.857) (-2160.822) * (-2156.786) (-2154.296) (-2157.797) [-2153.123] -- 0:03:38 204500 -- (-2158.108) [-2156.802] (-2162.900) (-2160.764) * (-2156.587) (-2163.767) [-2156.302] (-2159.100) -- 0:03:37 205000 -- (-2159.129) (-2161.665) (-2155.532) [-2160.319] * (-2153.594) (-2157.710) [-2160.357] (-2155.155) -- 0:03:37 Average standard deviation of split frequencies: 0.017163 205500 -- [-2161.181] (-2162.599) (-2157.236) (-2156.175) * (-2158.786) (-2156.333) [-2159.168] (-2160.485) -- 0:03:36 206000 -- [-2158.402] (-2166.158) (-2161.218) (-2162.538) * (-2163.625) (-2155.983) [-2153.881] (-2157.364) -- 0:03:35 206500 -- (-2158.783) (-2151.738) [-2160.831] (-2165.416) * (-2161.014) (-2159.503) (-2161.232) [-2155.470] -- 0:03:35 207000 -- (-2153.998) (-2152.850) (-2155.442) [-2157.057] * (-2154.533) (-2155.927) (-2158.378) [-2153.654] -- 0:03:34 207500 -- (-2159.742) [-2155.647] (-2152.550) (-2164.326) * [-2153.835] (-2156.431) (-2160.199) (-2155.860) -- 0:03:33 208000 -- (-2159.682) [-2164.467] (-2158.889) (-2164.136) * (-2153.215) (-2157.734) [-2152.065] (-2154.779) -- 0:03:37 208500 -- [-2157.701] (-2167.925) (-2152.743) (-2153.373) * [-2156.630] (-2156.148) (-2158.266) (-2152.890) -- 0:03:36 209000 -- (-2163.544) (-2160.550) (-2157.993) [-2154.890] * (-2154.321) [-2157.750] (-2157.555) (-2159.459) -- 0:03:35 209500 -- [-2158.865] (-2161.130) (-2155.987) (-2156.178) * (-2158.809) (-2157.935) [-2154.181] (-2152.808) -- 0:03:35 210000 -- (-2156.326) (-2159.341) (-2158.804) [-2159.935] * (-2159.627) (-2156.272) (-2153.774) [-2154.537] -- 0:03:34 Average standard deviation of split frequencies: 0.014545 210500 -- (-2159.337) (-2157.234) (-2154.894) [-2156.979] * (-2155.603) (-2154.737) (-2156.661) [-2152.490] -- 0:03:33 211000 -- (-2156.443) (-2158.888) (-2157.201) [-2157.119] * (-2156.853) (-2153.721) [-2151.850] (-2156.907) -- 0:03:33 211500 -- [-2153.277] (-2153.012) (-2155.387) (-2154.974) * (-2155.606) (-2154.627) (-2154.478) [-2154.709] -- 0:03:36 212000 -- (-2151.118) (-2158.057) (-2152.609) [-2157.675] * [-2155.145] (-2158.305) (-2160.200) (-2158.469) -- 0:03:35 212500 -- (-2158.642) (-2155.711) (-2156.343) [-2159.911] * [-2151.544] (-2153.000) (-2161.613) (-2160.568) -- 0:03:34 213000 -- (-2160.813) (-2160.138) (-2162.914) [-2159.552] * (-2151.950) (-2158.903) [-2158.178] (-2153.758) -- 0:03:34 213500 -- (-2159.151) (-2153.495) (-2156.586) [-2153.396] * [-2154.246] (-2153.426) (-2165.483) (-2154.345) -- 0:03:33 214000 -- (-2155.825) [-2151.937] (-2153.462) (-2159.613) * (-2155.121) (-2155.139) [-2155.706] (-2155.952) -- 0:03:33 214500 -- (-2156.142) [-2157.769] (-2157.009) (-2153.229) * (-2155.060) (-2161.883) (-2151.294) [-2158.670] -- 0:03:32 215000 -- [-2157.710] (-2161.747) (-2154.607) (-2151.865) * (-2151.924) (-2157.085) [-2155.243] (-2155.691) -- 0:03:31 Average standard deviation of split frequencies: 0.016368 215500 -- (-2150.584) (-2158.535) (-2158.529) [-2159.821] * (-2155.500) (-2157.483) [-2155.665] (-2155.302) -- 0:03:34 216000 -- (-2154.982) (-2165.153) [-2157.644] (-2157.646) * (-2165.363) (-2162.350) [-2158.753] (-2156.342) -- 0:03:34 216500 -- (-2157.291) (-2170.620) (-2160.301) [-2158.489] * (-2151.864) (-2152.274) [-2152.237] (-2155.466) -- 0:03:33 217000 -- (-2161.133) [-2164.762] (-2174.915) (-2160.454) * (-2156.296) (-2156.093) [-2153.063] (-2162.782) -- 0:03:32 217500 -- (-2156.384) (-2167.962) [-2159.968] (-2163.908) * [-2159.265] (-2155.273) (-2160.525) (-2157.175) -- 0:03:32 218000 -- (-2159.100) (-2160.175) (-2162.513) [-2161.523] * (-2159.027) (-2156.390) (-2161.458) [-2154.271] -- 0:03:31 218500 -- [-2151.884] (-2154.384) (-2159.931) (-2154.276) * (-2156.246) [-2156.110] (-2159.913) (-2155.225) -- 0:03:31 219000 -- (-2155.501) [-2155.530] (-2156.325) (-2157.872) * (-2160.779) [-2151.187] (-2159.970) (-2153.243) -- 0:03:33 219500 -- (-2158.991) (-2160.918) (-2156.862) [-2156.290] * [-2158.730] (-2157.841) (-2157.834) (-2157.686) -- 0:03:33 220000 -- (-2160.117) (-2157.596) (-2153.176) [-2158.668] * (-2156.449) (-2152.317) [-2154.365] (-2160.835) -- 0:03:32 Average standard deviation of split frequencies: 0.014954 220500 -- (-2160.024) (-2168.299) [-2153.247] (-2163.005) * (-2156.406) (-2162.391) [-2156.706] (-2160.787) -- 0:03:32 221000 -- (-2158.776) (-2155.618) [-2154.689] (-2155.944) * [-2154.245] (-2162.570) (-2155.776) (-2156.167) -- 0:03:31 221500 -- (-2162.131) [-2159.067] (-2152.111) (-2152.633) * [-2153.456] (-2158.279) (-2158.200) (-2153.071) -- 0:03:30 222000 -- [-2153.500] (-2165.159) (-2161.580) (-2151.002) * (-2153.039) (-2157.099) [-2158.512] (-2157.970) -- 0:03:30 222500 -- [-2151.521] (-2156.142) (-2162.865) (-2157.713) * (-2157.352) [-2156.346] (-2158.373) (-2159.087) -- 0:03:29 223000 -- (-2161.936) (-2167.835) [-2151.123] (-2155.269) * (-2152.128) (-2153.456) (-2158.554) [-2157.176] -- 0:03:32 223500 -- [-2155.480] (-2155.002) (-2154.376) (-2155.213) * (-2162.857) (-2163.183) (-2158.594) [-2156.176] -- 0:03:31 224000 -- (-2155.187) (-2158.135) (-2155.503) [-2155.237] * (-2163.605) [-2154.798] (-2155.645) (-2156.372) -- 0:03:31 224500 -- [-2155.854] (-2156.077) (-2160.228) (-2152.950) * (-2165.189) (-2162.429) [-2152.981] (-2156.433) -- 0:03:30 225000 -- [-2158.729] (-2158.318) (-2153.413) (-2152.774) * [-2156.554] (-2167.987) (-2166.568) (-2156.668) -- 0:03:30 Average standard deviation of split frequencies: 0.014601 225500 -- (-2160.554) [-2159.783] (-2156.512) (-2154.861) * [-2160.861] (-2161.609) (-2156.544) (-2153.573) -- 0:03:29 226000 -- (-2155.872) (-2155.175) [-2156.008] (-2160.266) * (-2158.300) (-2161.358) (-2157.959) [-2159.220] -- 0:03:28 226500 -- (-2157.087) [-2153.929] (-2157.773) (-2157.871) * [-2159.337] (-2156.414) (-2170.706) (-2156.869) -- 0:03:28 227000 -- (-2158.322) [-2155.182] (-2158.482) (-2156.756) * (-2163.008) (-2154.825) (-2153.113) [-2153.884] -- 0:03:31 227500 -- (-2164.320) [-2157.886] (-2159.602) (-2156.975) * (-2159.264) (-2152.000) (-2157.425) [-2157.643] -- 0:03:30 228000 -- (-2159.920) [-2158.353] (-2164.112) (-2153.000) * (-2154.769) (-2153.943) [-2158.993] (-2157.859) -- 0:03:29 228500 -- (-2160.305) [-2154.105] (-2164.175) (-2156.602) * [-2157.273] (-2156.606) (-2154.766) (-2155.595) -- 0:03:29 229000 -- (-2160.716) (-2157.043) [-2156.438] (-2159.518) * (-2158.118) (-2158.237) [-2156.048] (-2160.007) -- 0:03:28 229500 -- [-2152.556] (-2155.287) (-2160.421) (-2154.359) * [-2162.920] (-2154.947) (-2159.991) (-2157.457) -- 0:03:28 230000 -- (-2165.380) (-2155.601) (-2157.798) [-2152.924] * (-2155.007) (-2155.483) [-2158.740] (-2155.437) -- 0:03:27 Average standard deviation of split frequencies: 0.014817 230500 -- (-2165.553) (-2162.297) (-2153.864) [-2153.633] * (-2155.875) (-2158.541) (-2152.555) [-2156.581] -- 0:03:30 231000 -- (-2169.226) (-2154.735) (-2148.058) [-2155.679] * (-2151.895) (-2163.042) (-2160.119) [-2152.627] -- 0:03:29 231500 -- (-2165.679) (-2154.923) [-2157.892] (-2156.898) * (-2153.950) (-2158.339) [-2153.180] (-2158.504) -- 0:03:29 232000 -- (-2160.002) (-2160.855) [-2159.355] (-2156.322) * [-2156.904] (-2156.916) (-2156.696) (-2156.790) -- 0:03:28 232500 -- (-2163.466) (-2157.085) (-2160.326) [-2157.000] * (-2155.908) [-2156.064] (-2157.278) (-2158.417) -- 0:03:27 233000 -- (-2163.840) (-2157.909) [-2153.601] (-2158.585) * (-2152.048) (-2158.873) [-2161.464] (-2163.628) -- 0:03:27 233500 -- (-2158.790) (-2158.371) (-2158.154) [-2156.387] * (-2159.522) [-2150.043] (-2160.361) (-2163.347) -- 0:03:26 234000 -- (-2161.533) (-2160.312) (-2149.243) [-2154.282] * [-2154.086] (-2153.632) (-2162.608) (-2165.291) -- 0:03:26 234500 -- (-2157.363) (-2164.089) [-2156.880] (-2154.984) * (-2155.108) [-2159.531] (-2159.069) (-2155.373) -- 0:03:28 235000 -- (-2154.699) (-2158.143) (-2165.618) [-2158.588] * (-2151.771) (-2159.419) [-2156.420] (-2154.506) -- 0:03:28 Average standard deviation of split frequencies: 0.013982 235500 -- (-2159.006) (-2157.230) (-2158.442) [-2151.625] * [-2154.904] (-2155.203) (-2155.737) (-2154.073) -- 0:03:27 236000 -- (-2166.085) [-2155.606] (-2154.883) (-2156.195) * (-2157.510) (-2156.939) [-2151.615] (-2160.537) -- 0:03:27 236500 -- (-2154.974) (-2153.317) [-2154.854] (-2157.323) * (-2160.253) [-2155.498] (-2156.955) (-2154.410) -- 0:03:26 237000 -- (-2156.809) (-2154.721) (-2154.542) [-2152.083] * (-2153.582) (-2166.058) [-2157.932] (-2153.290) -- 0:03:26 237500 -- [-2159.373] (-2157.846) (-2160.814) (-2155.561) * (-2158.757) (-2161.904) (-2155.905) [-2156.136] -- 0:03:25 238000 -- [-2160.222] (-2155.917) (-2157.655) (-2153.917) * (-2155.747) (-2165.553) (-2155.394) [-2156.671] -- 0:03:28 238500 -- (-2167.853) (-2157.648) [-2162.459] (-2157.903) * (-2158.910) (-2170.667) (-2157.118) [-2154.913] -- 0:03:27 239000 -- [-2159.250] (-2157.396) (-2164.572) (-2152.508) * (-2156.126) (-2153.924) (-2153.841) [-2152.841] -- 0:03:26 239500 -- (-2159.204) [-2154.988] (-2161.779) (-2163.211) * (-2157.318) (-2155.253) (-2164.445) [-2158.183] -- 0:03:26 240000 -- (-2158.464) [-2155.332] (-2157.521) (-2155.610) * [-2152.770] (-2162.146) (-2157.602) (-2156.674) -- 0:03:25 Average standard deviation of split frequencies: 0.013711 240500 -- (-2152.014) (-2153.879) (-2160.878) [-2155.369] * (-2160.467) (-2168.622) [-2157.489] (-2157.675) -- 0:03:25 241000 -- [-2152.684] (-2160.396) (-2157.500) (-2163.577) * [-2155.237] (-2158.894) (-2158.139) (-2158.292) -- 0:03:24 241500 -- (-2151.393) (-2157.043) [-2156.104] (-2155.399) * (-2154.437) (-2155.671) (-2159.436) [-2157.502] -- 0:03:24 242000 -- (-2155.123) (-2159.507) [-2153.627] (-2156.014) * (-2152.645) [-2150.691] (-2153.473) (-2156.126) -- 0:03:26 242500 -- (-2156.751) (-2156.296) (-2158.488) [-2155.608] * (-2156.629) (-2159.416) [-2152.615] (-2163.502) -- 0:03:26 243000 -- [-2152.518] (-2155.769) (-2157.985) (-2153.937) * (-2156.048) (-2158.542) [-2158.282] (-2161.299) -- 0:03:25 243500 -- (-2157.821) [-2162.025] (-2160.818) (-2155.740) * (-2153.642) (-2157.191) [-2159.681] (-2157.588) -- 0:03:25 244000 -- [-2150.287] (-2161.601) (-2158.049) (-2156.049) * (-2155.399) [-2151.839] (-2156.543) (-2156.782) -- 0:03:24 244500 -- [-2157.762] (-2160.120) (-2166.749) (-2151.232) * (-2158.971) (-2155.075) (-2152.741) [-2158.571] -- 0:03:23 245000 -- (-2153.003) (-2160.691) (-2158.880) [-2155.210] * (-2154.922) (-2151.942) [-2159.565] (-2157.252) -- 0:03:23 Average standard deviation of split frequencies: 0.017247 245500 -- (-2163.345) [-2159.594] (-2157.162) (-2160.151) * (-2154.064) (-2156.411) (-2160.322) [-2155.599] -- 0:03:22 246000 -- (-2160.149) (-2157.327) [-2152.312] (-2153.564) * (-2156.878) (-2151.966) (-2161.000) [-2159.014] -- 0:03:25 246500 -- (-2153.370) (-2162.849) [-2154.211] (-2150.271) * (-2153.711) (-2153.268) [-2161.456] (-2161.737) -- 0:03:24 247000 -- (-2162.635) (-2159.551) (-2160.897) [-2154.452] * (-2153.500) (-2157.218) (-2154.858) [-2156.445] -- 0:03:24 247500 -- (-2157.725) [-2154.069] (-2158.996) (-2154.509) * (-2155.581) [-2153.737] (-2153.483) (-2158.788) -- 0:03:23 248000 -- (-2159.178) [-2152.850] (-2159.511) (-2159.215) * (-2162.723) (-2155.657) [-2155.178] (-2161.027) -- 0:03:23 248500 -- (-2167.361) [-2155.255] (-2161.346) (-2162.036) * (-2155.570) [-2153.543] (-2158.413) (-2161.170) -- 0:03:22 249000 -- (-2156.448) (-2157.485) (-2164.210) [-2152.195] * (-2157.775) [-2153.153] (-2160.958) (-2165.747) -- 0:03:22 249500 -- [-2160.640] (-2160.550) (-2157.722) (-2154.969) * (-2155.451) [-2159.551] (-2159.785) (-2163.686) -- 0:03:24 250000 -- (-2161.262) (-2162.762) (-2156.779) [-2152.391] * (-2164.981) [-2158.181] (-2156.738) (-2161.959) -- 0:03:24 Average standard deviation of split frequencies: 0.016925 250500 -- [-2154.154] (-2159.334) (-2159.900) (-2155.141) * (-2163.412) [-2162.515] (-2158.492) (-2155.008) -- 0:03:23 251000 -- (-2158.119) (-2159.114) (-2155.898) [-2154.444] * (-2156.902) (-2154.986) (-2161.366) [-2158.802] -- 0:03:22 251500 -- (-2155.863) [-2165.372] (-2161.877) (-2158.144) * (-2157.361) (-2153.908) (-2159.488) [-2158.081] -- 0:03:22 252000 -- (-2154.845) [-2158.094] (-2165.753) (-2156.435) * (-2155.101) (-2156.848) [-2158.216] (-2158.844) -- 0:03:21 252500 -- (-2159.470) (-2157.339) (-2153.274) [-2152.988] * [-2153.412] (-2156.993) (-2157.377) (-2160.788) -- 0:03:21 253000 -- [-2154.973] (-2162.339) (-2157.670) (-2155.988) * (-2156.249) [-2153.728] (-2158.959) (-2156.115) -- 0:03:20 253500 -- (-2162.477) (-2155.533) [-2157.089] (-2154.432) * (-2155.821) [-2157.224] (-2158.188) (-2157.335) -- 0:03:23 254000 -- (-2155.867) (-2163.406) [-2151.421] (-2159.858) * (-2159.380) (-2153.339) (-2156.961) [-2153.238] -- 0:03:22 254500 -- [-2155.133] (-2154.987) (-2163.008) (-2155.915) * (-2158.630) (-2157.594) [-2156.107] (-2159.642) -- 0:03:22 255000 -- (-2158.170) (-2159.215) (-2157.715) [-2153.372] * (-2160.732) [-2155.958] (-2161.284) (-2154.062) -- 0:03:21 Average standard deviation of split frequencies: 0.017954 255500 -- (-2160.105) [-2160.061] (-2156.121) (-2158.715) * (-2163.976) (-2156.658) (-2157.213) [-2155.336] -- 0:03:21 256000 -- (-2153.018) (-2157.716) (-2158.537) [-2154.768] * (-2157.358) [-2159.668] (-2160.364) (-2160.996) -- 0:03:20 256500 -- [-2155.180] (-2157.126) (-2153.706) (-2155.686) * (-2160.489) (-2168.148) (-2157.611) [-2156.945] -- 0:03:20 257000 -- (-2160.102) [-2161.723] (-2162.489) (-2157.526) * (-2165.217) (-2157.881) [-2155.845] (-2159.320) -- 0:03:22 257500 -- [-2160.955] (-2161.143) (-2155.267) (-2157.234) * [-2155.863] (-2161.528) (-2155.778) (-2162.141) -- 0:03:21 258000 -- [-2155.511] (-2176.323) (-2153.636) (-2156.313) * (-2150.696) [-2157.989] (-2152.390) (-2160.711) -- 0:03:21 258500 -- (-2156.633) [-2164.510] (-2154.461) (-2156.606) * (-2157.819) (-2161.289) (-2159.680) [-2153.282] -- 0:03:20 259000 -- (-2153.521) (-2161.392) (-2156.803) [-2153.878] * (-2158.230) (-2169.013) (-2155.209) [-2151.252] -- 0:03:20 259500 -- (-2159.016) (-2157.877) (-2157.334) [-2155.231] * (-2156.894) [-2154.071] (-2159.559) (-2154.580) -- 0:03:19 260000 -- [-2158.709] (-2158.737) (-2155.789) (-2159.610) * [-2160.026] (-2161.881) (-2165.690) (-2155.636) -- 0:03:19 Average standard deviation of split frequencies: 0.015824 260500 -- (-2156.972) [-2157.141] (-2163.319) (-2160.944) * (-2155.230) (-2152.240) (-2155.304) [-2158.747] -- 0:03:18 261000 -- [-2162.123] (-2158.470) (-2158.016) (-2158.246) * (-2165.614) [-2154.819] (-2153.673) (-2155.842) -- 0:03:21 261500 -- [-2157.093] (-2155.741) (-2160.277) (-2155.303) * [-2158.053] (-2154.808) (-2161.340) (-2158.931) -- 0:03:20 262000 -- (-2158.282) [-2151.227] (-2158.554) (-2157.064) * (-2152.772) [-2151.902] (-2169.446) (-2155.756) -- 0:03:19 262500 -- [-2160.464] (-2156.629) (-2155.647) (-2152.399) * (-2155.801) [-2154.218] (-2164.488) (-2154.799) -- 0:03:19 263000 -- (-2160.762) (-2155.425) [-2159.433] (-2153.858) * (-2161.917) (-2156.521) [-2162.371] (-2152.118) -- 0:03:18 263500 -- (-2153.876) (-2156.382) (-2156.186) [-2153.195] * (-2155.187) [-2154.531] (-2159.990) (-2161.989) -- 0:03:18 264000 -- (-2157.546) (-2155.827) [-2156.839] (-2157.844) * [-2154.432] (-2158.543) (-2157.713) (-2160.733) -- 0:03:17 264500 -- [-2155.452] (-2153.121) (-2152.366) (-2152.187) * (-2157.195) (-2156.681) (-2168.588) [-2153.823] -- 0:03:20 265000 -- (-2157.916) (-2152.100) [-2158.773] (-2161.748) * (-2161.204) (-2153.943) (-2155.293) [-2158.554] -- 0:03:19 Average standard deviation of split frequencies: 0.015507 265500 -- [-2159.117] (-2158.979) (-2158.346) (-2155.569) * (-2165.464) (-2156.446) [-2155.459] (-2159.585) -- 0:03:19 266000 -- (-2155.780) [-2154.589] (-2162.913) (-2163.236) * [-2161.171] (-2155.448) (-2159.024) (-2164.751) -- 0:03:18 266500 -- (-2161.414) (-2154.328) [-2157.325] (-2152.095) * [-2151.101] (-2152.881) (-2151.818) (-2158.743) -- 0:03:18 267000 -- (-2160.588) (-2163.856) (-2159.266) [-2156.415] * (-2155.977) [-2156.006] (-2154.084) (-2158.176) -- 0:03:17 267500 -- (-2160.611) [-2154.859] (-2159.868) (-2157.936) * (-2154.047) (-2159.005) (-2151.561) [-2155.771] -- 0:03:17 268000 -- (-2160.346) [-2152.501] (-2155.483) (-2152.468) * [-2155.048] (-2158.734) (-2156.791) (-2156.629) -- 0:03:16 268500 -- (-2168.040) [-2163.178] (-2160.026) (-2154.735) * (-2158.267) (-2157.861) [-2159.129] (-2152.063) -- 0:03:18 269000 -- (-2155.562) (-2155.627) (-2153.022) [-2160.801] * [-2160.042] (-2160.516) (-2156.088) (-2161.900) -- 0:03:18 269500 -- (-2169.300) (-2156.517) [-2158.527] (-2156.416) * (-2161.073) (-2154.960) (-2154.428) [-2153.612] -- 0:03:17 270000 -- (-2161.993) (-2155.715) [-2156.497] (-2155.940) * (-2162.807) [-2157.231] (-2154.372) (-2157.312) -- 0:03:17 Average standard deviation of split frequencies: 0.016546 270500 -- (-2155.204) (-2159.160) (-2155.298) [-2155.511] * (-2157.962) [-2153.127] (-2159.213) (-2161.757) -- 0:03:16 271000 -- (-2151.919) (-2159.825) (-2159.271) [-2152.620] * (-2157.551) (-2162.565) (-2161.090) [-2157.450] -- 0:03:16 271500 -- (-2155.786) (-2150.176) (-2152.735) [-2154.903] * (-2162.006) (-2157.120) (-2155.568) [-2153.188] -- 0:03:15 272000 -- [-2153.967] (-2156.275) (-2158.062) (-2153.567) * (-2155.287) [-2158.148] (-2159.929) (-2155.051) -- 0:03:18 272500 -- (-2157.827) (-2154.972) [-2160.216] (-2161.152) * (-2155.678) (-2159.886) [-2156.058] (-2157.474) -- 0:03:17 273000 -- (-2152.971) [-2152.956] (-2159.802) (-2159.047) * (-2158.968) (-2158.635) (-2157.636) [-2154.933] -- 0:03:17 273500 -- (-2159.987) (-2158.293) [-2154.090] (-2160.317) * [-2160.706] (-2152.938) (-2159.767) (-2162.965) -- 0:03:16 274000 -- (-2152.884) (-2159.605) [-2160.830] (-2156.421) * [-2159.241] (-2158.280) (-2156.368) (-2169.150) -- 0:03:16 274500 -- (-2154.632) (-2157.724) (-2166.838) [-2154.856] * (-2157.170) (-2160.017) [-2157.683] (-2157.885) -- 0:03:15 275000 -- (-2162.690) (-2158.247) (-2157.497) [-2151.715] * (-2158.581) [-2160.741] (-2152.822) (-2155.374) -- 0:03:15 Average standard deviation of split frequencies: 0.015372 275500 -- (-2155.591) (-2157.319) (-2158.679) [-2151.946] * (-2155.653) (-2155.327) (-2159.671) [-2154.852] -- 0:03:14 276000 -- (-2157.204) [-2154.647] (-2165.978) (-2158.132) * (-2155.491) (-2160.253) [-2158.980] (-2158.576) -- 0:03:16 276500 -- (-2164.708) (-2157.791) (-2152.695) [-2153.801] * (-2156.445) (-2156.641) [-2151.128] (-2154.002) -- 0:03:16 277000 -- (-2154.243) (-2155.825) [-2157.888] (-2151.783) * (-2165.609) (-2155.600) [-2153.323] (-2155.085) -- 0:03:15 277500 -- [-2160.413] (-2163.624) (-2154.403) (-2159.066) * (-2159.990) (-2157.493) [-2158.563] (-2154.690) -- 0:03:15 278000 -- [-2151.477] (-2152.864) (-2152.728) (-2157.456) * (-2161.732) (-2157.468) [-2152.263] (-2155.837) -- 0:03:14 278500 -- (-2153.628) (-2157.993) (-2159.451) [-2153.798] * (-2162.662) (-2159.076) (-2155.934) [-2156.828] -- 0:03:14 279000 -- (-2157.639) (-2159.693) [-2157.903] (-2156.298) * [-2162.442] (-2155.713) (-2151.058) (-2159.005) -- 0:03:13 279500 -- (-2155.685) (-2161.753) (-2161.766) [-2154.355] * (-2161.181) [-2153.214] (-2152.622) (-2150.913) -- 0:03:15 280000 -- (-2158.190) (-2158.395) [-2162.578] (-2155.297) * [-2158.929] (-2157.465) (-2156.528) (-2159.074) -- 0:03:15 Average standard deviation of split frequencies: 0.017636 280500 -- (-2156.782) (-2158.456) (-2164.665) [-2160.068] * (-2157.874) (-2164.597) (-2153.427) [-2154.788] -- 0:03:14 281000 -- (-2157.301) (-2150.201) (-2166.785) [-2156.571] * (-2168.012) (-2158.008) (-2158.670) [-2152.355] -- 0:03:14 281500 -- (-2160.285) [-2149.569] (-2157.449) (-2154.056) * (-2152.239) [-2151.070] (-2158.586) (-2158.559) -- 0:03:13 282000 -- (-2159.471) (-2149.602) (-2161.378) [-2157.951] * [-2157.838] (-2156.333) (-2153.925) (-2163.433) -- 0:03:13 282500 -- [-2157.037] (-2156.778) (-2155.852) (-2157.322) * [-2157.016] (-2165.139) (-2160.973) (-2159.885) -- 0:03:13 283000 -- (-2154.508) (-2154.160) (-2157.333) [-2152.793] * (-2161.650) (-2158.291) [-2161.811] (-2161.828) -- 0:03:12 283500 -- (-2154.846) [-2151.452] (-2171.612) (-2162.867) * (-2158.118) (-2151.699) [-2160.349] (-2156.669) -- 0:03:14 284000 -- (-2159.318) (-2154.545) (-2158.022) [-2159.163] * (-2154.655) (-2155.100) [-2152.766] (-2157.346) -- 0:03:14 284500 -- (-2156.168) (-2156.923) (-2158.846) [-2159.218] * (-2164.679) [-2154.702] (-2154.120) (-2159.779) -- 0:03:13 285000 -- (-2156.406) (-2154.641) (-2164.975) [-2157.059] * (-2159.230) (-2154.018) (-2153.234) [-2156.380] -- 0:03:13 Average standard deviation of split frequencies: 0.017307 285500 -- (-2155.178) (-2154.826) [-2159.705] (-2158.793) * [-2157.543] (-2157.786) (-2155.410) (-2159.519) -- 0:03:12 286000 -- [-2160.650] (-2157.836) (-2164.291) (-2157.009) * (-2157.081) [-2158.762] (-2155.798) (-2158.614) -- 0:03:12 286500 -- (-2158.567) (-2157.071) [-2165.796] (-2157.464) * [-2152.036] (-2152.424) (-2158.498) (-2157.662) -- 0:03:11 287000 -- (-2168.820) (-2154.730) (-2157.545) [-2154.191] * (-2157.405) [-2154.250] (-2157.869) (-2158.441) -- 0:03:11 287500 -- (-2155.724) (-2156.773) (-2156.801) [-2155.733] * (-2158.875) [-2155.117] (-2157.007) (-2159.255) -- 0:03:13 288000 -- (-2155.398) (-2155.095) [-2154.119] (-2155.647) * [-2154.489] (-2154.096) (-2158.502) (-2154.388) -- 0:03:12 288500 -- (-2153.942) (-2160.811) (-2154.675) [-2155.896] * (-2158.836) [-2153.199] (-2158.044) (-2157.980) -- 0:03:12 289000 -- [-2152.036] (-2155.823) (-2160.267) (-2167.676) * (-2159.847) [-2156.414] (-2162.747) (-2156.341) -- 0:03:11 289500 -- (-2155.075) (-2160.526) [-2158.227] (-2164.122) * (-2159.007) (-2158.671) (-2159.866) [-2153.318] -- 0:03:11 290000 -- (-2158.992) (-2164.232) [-2159.514] (-2156.014) * [-2156.743] (-2159.550) (-2159.531) (-2160.422) -- 0:03:10 Average standard deviation of split frequencies: 0.017029 290500 -- (-2159.044) (-2158.237) (-2162.014) [-2151.559] * [-2152.045] (-2160.781) (-2161.053) (-2156.460) -- 0:03:10 291000 -- (-2157.490) (-2160.853) (-2156.769) [-2155.765] * [-2153.554] (-2158.962) (-2157.161) (-2166.221) -- 0:03:12 291500 -- [-2158.739] (-2162.034) (-2160.377) (-2162.781) * (-2154.957) [-2157.521] (-2158.010) (-2157.967) -- 0:03:12 292000 -- (-2154.999) (-2157.943) (-2156.790) [-2159.347] * [-2158.777] (-2150.908) (-2159.202) (-2163.612) -- 0:03:11 292500 -- (-2153.381) [-2158.351] (-2160.495) (-2160.391) * (-2155.955) [-2154.931] (-2163.054) (-2164.126) -- 0:03:11 293000 -- (-2154.911) (-2164.157) [-2158.545] (-2155.198) * (-2156.589) [-2153.570] (-2160.465) (-2152.255) -- 0:03:10 293500 -- (-2152.698) (-2164.785) [-2151.993] (-2162.673) * (-2159.028) [-2160.257] (-2156.150) (-2157.855) -- 0:03:10 294000 -- (-2156.235) [-2156.175] (-2156.733) (-2157.943) * (-2159.682) (-2156.844) [-2154.407] (-2167.911) -- 0:03:09 294500 -- (-2158.920) (-2164.338) [-2156.652] (-2161.690) * [-2160.962] (-2153.524) (-2154.206) (-2158.890) -- 0:03:09 295000 -- [-2154.653] (-2158.079) (-2157.887) (-2159.512) * (-2157.939) (-2160.510) [-2160.641] (-2159.161) -- 0:03:11 Average standard deviation of split frequencies: 0.015528 295500 -- (-2161.015) [-2151.927] (-2158.431) (-2158.208) * (-2159.731) [-2156.609] (-2155.382) (-2163.430) -- 0:03:10 296000 -- (-2158.796) (-2152.722) [-2153.760] (-2152.843) * [-2156.984] (-2155.392) (-2156.996) (-2161.092) -- 0:03:10 296500 -- (-2160.750) (-2157.386) [-2156.680] (-2154.850) * (-2153.369) (-2155.254) [-2158.639] (-2161.758) -- 0:03:09 297000 -- (-2157.764) (-2153.670) [-2152.847] (-2162.107) * (-2156.311) (-2154.946) [-2155.204] (-2161.505) -- 0:03:09 297500 -- (-2159.038) [-2160.445] (-2163.368) (-2154.202) * (-2157.108) (-2155.892) (-2157.728) [-2160.084] -- 0:03:08 298000 -- [-2157.641] (-2162.462) (-2157.060) (-2152.071) * (-2162.211) [-2155.401] (-2166.046) (-2157.032) -- 0:03:08 298500 -- (-2159.223) (-2158.193) (-2155.954) [-2149.806] * [-2165.907] (-2150.522) (-2153.138) (-2154.130) -- 0:03:10 299000 -- [-2153.326] (-2163.471) (-2153.744) (-2165.212) * [-2152.325] (-2156.715) (-2155.281) (-2153.819) -- 0:03:09 299500 -- (-2158.053) (-2151.510) (-2157.358) [-2157.138] * (-2157.213) [-2153.188] (-2154.748) (-2157.433) -- 0:03:09 300000 -- (-2155.913) (-2158.383) (-2154.460) [-2155.028] * (-2152.479) [-2151.515] (-2154.945) (-2159.578) -- 0:03:09 Average standard deviation of split frequencies: 0.016855 300500 -- (-2153.413) (-2155.754) (-2158.395) [-2157.061] * (-2163.206) (-2168.846) [-2153.863] (-2163.538) -- 0:03:08 301000 -- (-2156.455) [-2151.887] (-2158.779) (-2156.560) * (-2161.765) (-2161.693) [-2151.579] (-2161.827) -- 0:03:08 301500 -- (-2149.907) [-2153.289] (-2155.169) (-2160.348) * [-2155.913] (-2164.039) (-2157.892) (-2153.260) -- 0:03:07 302000 -- (-2161.093) [-2153.017] (-2151.429) (-2159.181) * (-2157.048) (-2161.503) (-2155.439) [-2154.020] -- 0:03:07 302500 -- (-2151.681) (-2163.540) (-2157.737) [-2157.668] * [-2159.350] (-2160.659) (-2162.320) (-2152.720) -- 0:03:09 303000 -- (-2156.650) (-2158.988) (-2158.295) [-2157.857] * (-2161.967) (-2166.640) (-2154.066) [-2158.449] -- 0:03:08 303500 -- (-2158.512) [-2155.526] (-2154.979) (-2163.468) * (-2165.842) [-2160.164] (-2154.106) (-2161.712) -- 0:03:08 304000 -- [-2156.235] (-2158.794) (-2156.069) (-2155.402) * (-2154.973) (-2167.331) (-2157.124) [-2157.373] -- 0:03:07 304500 -- (-2155.987) (-2161.983) [-2160.332] (-2154.484) * (-2154.921) (-2164.823) [-2155.715] (-2160.206) -- 0:03:07 305000 -- (-2161.601) (-2156.359) [-2153.137] (-2161.948) * (-2157.663) (-2153.571) (-2163.101) [-2159.240] -- 0:03:06 Average standard deviation of split frequencies: 0.015791 305500 -- (-2157.037) (-2160.931) [-2153.355] (-2159.035) * [-2154.690] (-2159.941) (-2160.520) (-2157.056) -- 0:03:06 306000 -- (-2155.851) (-2158.794) [-2154.405] (-2161.790) * (-2154.105) (-2159.508) [-2158.792] (-2160.276) -- 0:03:08 306500 -- (-2159.211) [-2156.635] (-2166.002) (-2155.850) * [-2153.409] (-2160.172) (-2156.817) (-2161.664) -- 0:03:07 307000 -- (-2155.314) (-2159.628) [-2154.006] (-2158.958) * (-2156.979) (-2167.216) (-2165.657) [-2155.721] -- 0:03:07 307500 -- (-2164.599) [-2155.127] (-2158.150) (-2154.337) * (-2163.193) (-2158.953) [-2159.393] (-2153.544) -- 0:03:06 308000 -- [-2155.704] (-2158.955) (-2164.446) (-2159.915) * (-2157.245) (-2156.907) [-2162.429] (-2152.557) -- 0:03:06 308500 -- (-2160.857) (-2163.469) [-2154.422] (-2168.031) * (-2160.806) [-2160.128] (-2161.480) (-2157.263) -- 0:03:06 309000 -- (-2161.495) (-2156.841) [-2151.340] (-2155.203) * (-2156.893) (-2161.512) [-2160.276] (-2154.738) -- 0:03:05 309500 -- [-2157.573] (-2161.450) (-2153.725) (-2148.425) * [-2153.519] (-2155.870) (-2154.525) (-2164.779) -- 0:03:05 310000 -- [-2159.914] (-2154.656) (-2160.448) (-2155.031) * (-2153.386) (-2162.770) [-2164.903] (-2156.758) -- 0:03:06 Average standard deviation of split frequencies: 0.012898 310500 -- (-2157.418) (-2154.603) (-2160.062) [-2154.920] * (-2157.573) [-2155.542] (-2160.064) (-2160.420) -- 0:03:06 311000 -- (-2155.460) [-2151.840] (-2161.916) (-2157.721) * (-2163.286) (-2154.412) (-2155.334) [-2157.989] -- 0:03:06 311500 -- (-2154.891) [-2156.090] (-2156.792) (-2157.675) * (-2158.757) [-2154.242] (-2158.561) (-2157.157) -- 0:03:05 312000 -- (-2156.390) [-2158.851] (-2155.658) (-2154.348) * (-2159.608) (-2155.372) [-2157.198] (-2167.166) -- 0:03:05 312500 -- [-2155.563] (-2155.008) (-2158.314) (-2156.827) * [-2157.673] (-2152.776) (-2154.996) (-2166.199) -- 0:03:04 313000 -- (-2154.566) (-2164.328) [-2152.786] (-2158.843) * [-2159.556] (-2154.316) (-2158.088) (-2160.146) -- 0:03:04 313500 -- [-2154.987] (-2159.888) (-2159.827) (-2152.274) * (-2157.082) (-2161.773) [-2155.154] (-2155.600) -- 0:03:06 314000 -- (-2160.401) (-2154.246) (-2156.427) [-2155.602] * (-2158.872) [-2155.142] (-2156.552) (-2156.673) -- 0:03:05 314500 -- (-2160.560) (-2154.160) [-2155.028] (-2162.095) * [-2151.746] (-2160.179) (-2160.056) (-2156.932) -- 0:03:05 315000 -- (-2158.347) (-2155.236) [-2154.411] (-2159.462) * [-2150.350] (-2155.508) (-2157.767) (-2162.189) -- 0:03:04 Average standard deviation of split frequencies: 0.013426 315500 -- (-2161.209) (-2159.860) [-2163.932] (-2157.557) * (-2156.926) [-2155.163] (-2155.642) (-2157.718) -- 0:03:04 316000 -- [-2154.777] (-2156.836) (-2160.569) (-2155.269) * (-2161.442) [-2153.261] (-2153.855) (-2155.410) -- 0:03:03 316500 -- (-2155.959) (-2155.238) [-2156.320] (-2159.276) * (-2162.779) (-2159.631) (-2158.150) [-2151.432] -- 0:03:03 317000 -- [-2151.295] (-2158.823) (-2158.038) (-2154.236) * (-2162.162) [-2156.846] (-2153.046) (-2150.160) -- 0:03:03 317500 -- (-2158.650) (-2159.736) (-2156.898) [-2154.058] * (-2159.778) (-2160.046) [-2154.575] (-2151.213) -- 0:03:04 318000 -- (-2162.750) (-2159.689) [-2149.803] (-2155.121) * (-2160.075) (-2160.116) [-2152.319] (-2155.678) -- 0:03:04 318500 -- (-2159.581) (-2157.487) (-2157.142) [-2157.463] * (-2160.765) (-2160.152) [-2156.695] (-2155.840) -- 0:03:04 319000 -- [-2155.047] (-2157.169) (-2162.557) (-2156.476) * (-2166.271) (-2164.505) (-2158.317) [-2155.744] -- 0:03:03 319500 -- (-2154.922) (-2161.621) [-2164.767] (-2157.476) * (-2156.405) (-2165.159) [-2155.490] (-2156.097) -- 0:03:03 320000 -- (-2155.638) [-2161.914] (-2158.416) (-2157.563) * (-2158.136) [-2155.586] (-2155.377) (-2157.019) -- 0:03:02 Average standard deviation of split frequencies: 0.016538 320500 -- [-2157.510] (-2161.408) (-2156.348) (-2157.367) * (-2156.056) (-2155.003) [-2156.927] (-2164.385) -- 0:03:02 321000 -- (-2153.945) [-2162.733] (-2162.886) (-2162.932) * (-2152.709) (-2161.251) [-2162.532] (-2156.986) -- 0:03:01 321500 -- (-2154.982) [-2161.360] (-2154.865) (-2159.996) * (-2152.972) [-2155.878] (-2166.209) (-2153.430) -- 0:03:03 322000 -- (-2157.098) [-2163.761] (-2153.403) (-2158.827) * [-2152.447] (-2153.770) (-2159.117) (-2155.902) -- 0:03:03 322500 -- (-2159.947) [-2165.886] (-2157.292) (-2157.510) * [-2154.667] (-2156.669) (-2165.287) (-2165.152) -- 0:03:02 323000 -- (-2164.405) (-2162.918) [-2153.204] (-2152.748) * (-2156.935) [-2156.849] (-2159.281) (-2159.693) -- 0:03:02 323500 -- (-2152.844) (-2159.414) (-2160.856) [-2151.677] * (-2155.748) (-2164.314) (-2157.330) [-2157.107] -- 0:03:01 324000 -- [-2153.979] (-2159.495) (-2149.198) (-2152.890) * (-2159.363) (-2154.581) [-2157.100] (-2153.285) -- 0:03:01 324500 -- (-2151.383) (-2160.137) (-2151.895) [-2157.680] * [-2157.115] (-2156.724) (-2156.196) (-2157.530) -- 0:03:01 325000 -- [-2158.438] (-2162.168) (-2153.467) (-2157.953) * (-2163.239) [-2155.650] (-2157.334) (-2157.617) -- 0:03:02 Average standard deviation of split frequencies: 0.013376 325500 -- (-2159.873) (-2155.614) [-2157.236] (-2163.883) * (-2170.465) (-2161.803) [-2156.790] (-2158.039) -- 0:03:02 326000 -- [-2152.616] (-2159.176) (-2158.646) (-2150.816) * (-2160.699) [-2152.807] (-2152.033) (-2159.090) -- 0:03:01 326500 -- (-2154.400) (-2161.577) (-2160.015) [-2151.432] * (-2154.338) [-2153.064] (-2163.424) (-2158.048) -- 0:03:01 327000 -- (-2155.628) (-2160.698) [-2156.104] (-2151.434) * (-2159.708) [-2157.632] (-2154.323) (-2164.273) -- 0:03:01 327500 -- (-2160.511) (-2158.833) (-2157.359) [-2157.099] * [-2159.761] (-2155.196) (-2156.617) (-2158.826) -- 0:03:00 328000 -- (-2156.093) (-2155.743) (-2162.521) [-2152.263] * (-2157.329) (-2161.586) [-2160.152] (-2156.261) -- 0:03:00 328500 -- [-2153.469] (-2155.754) (-2159.797) (-2156.082) * [-2151.368] (-2159.308) (-2160.904) (-2160.533) -- 0:02:59 329000 -- [-2154.748] (-2157.786) (-2156.383) (-2151.480) * (-2155.022) [-2159.064] (-2176.868) (-2160.719) -- 0:03:01 329500 -- (-2155.279) (-2167.447) [-2153.036] (-2156.329) * (-2154.879) [-2159.714] (-2162.774) (-2157.999) -- 0:03:01 330000 -- (-2160.505) (-2163.423) (-2157.935) [-2152.958] * (-2154.855) (-2157.983) [-2161.511] (-2158.373) -- 0:03:00 Average standard deviation of split frequencies: 0.011049 330500 -- [-2156.628] (-2161.270) (-2166.220) (-2161.105) * (-2163.539) [-2159.813] (-2159.986) (-2157.374) -- 0:03:00 331000 -- (-2161.761) (-2153.831) [-2155.611] (-2164.807) * [-2153.193] (-2160.445) (-2161.979) (-2154.679) -- 0:02:59 331500 -- (-2163.334) [-2155.324] (-2160.042) (-2166.929) * (-2167.230) [-2159.243] (-2160.472) (-2151.402) -- 0:02:59 332000 -- (-2159.190) (-2155.099) (-2158.239) [-2164.972] * (-2159.440) (-2158.620) [-2153.148] (-2158.169) -- 0:02:59 332500 -- (-2154.071) [-2156.802] (-2152.202) (-2160.847) * [-2163.277] (-2154.164) (-2163.138) (-2155.849) -- 0:03:00 333000 -- (-2155.995) [-2158.996] (-2154.284) (-2161.248) * (-2157.455) (-2153.756) [-2154.408] (-2157.603) -- 0:03:00 333500 -- (-2156.596) [-2155.368] (-2155.880) (-2162.247) * (-2161.418) (-2156.359) [-2155.692] (-2165.498) -- 0:02:59 334000 -- [-2157.469] (-2158.460) (-2155.935) (-2160.152) * (-2159.643) (-2151.839) [-2150.868] (-2158.177) -- 0:02:59 334500 -- (-2164.406) [-2157.907] (-2161.961) (-2159.729) * (-2162.842) [-2157.070] (-2155.466) (-2159.886) -- 0:02:59 335000 -- (-2161.787) (-2162.082) (-2155.030) [-2153.335] * (-2158.887) (-2155.164) [-2152.236] (-2155.031) -- 0:02:58 Average standard deviation of split frequencies: 0.012276 335500 -- (-2160.517) (-2158.494) [-2155.350] (-2150.642) * (-2156.008) [-2160.113] (-2159.843) (-2155.115) -- 0:02:58 336000 -- (-2153.749) (-2161.350) (-2157.200) [-2154.511] * [-2154.111] (-2163.580) (-2159.072) (-2160.375) -- 0:02:57 336500 -- (-2153.777) (-2158.638) (-2153.146) [-2160.219] * (-2158.208) (-2158.364) (-2153.109) [-2162.372] -- 0:02:59 337000 -- (-2155.285) [-2158.539] (-2152.773) (-2157.706) * (-2153.637) (-2163.518) [-2153.366] (-2156.682) -- 0:02:59 337500 -- (-2160.330) (-2156.557) [-2156.288] (-2155.393) * [-2155.553] (-2165.788) (-2156.470) (-2157.911) -- 0:02:58 338000 -- (-2167.768) [-2156.973] (-2155.806) (-2154.101) * (-2158.672) [-2157.472] (-2153.880) (-2160.014) -- 0:02:58 338500 -- (-2155.958) (-2156.692) [-2155.473] (-2154.143) * [-2156.674] (-2155.763) (-2158.079) (-2158.671) -- 0:02:57 339000 -- (-2156.013) (-2153.427) [-2159.094] (-2159.073) * (-2152.773) (-2155.539) (-2164.271) [-2159.307] -- 0:02:57 339500 -- (-2153.458) (-2163.122) [-2156.657] (-2160.692) * (-2155.872) (-2154.640) [-2160.551] (-2158.258) -- 0:02:57 340000 -- (-2159.025) [-2156.172] (-2155.396) (-2153.765) * [-2153.887] (-2152.517) (-2160.917) (-2155.662) -- 0:02:56 Average standard deviation of split frequencies: 0.009340 340500 -- [-2168.284] (-2162.067) (-2155.068) (-2159.603) * (-2156.811) [-2151.222] (-2167.430) (-2157.292) -- 0:02:58 341000 -- (-2164.366) (-2155.534) [-2155.331] (-2153.046) * [-2158.842] (-2155.754) (-2156.139) (-2157.609) -- 0:02:57 341500 -- [-2159.248] (-2154.725) (-2151.735) (-2155.178) * (-2159.979) (-2153.946) (-2159.306) [-2161.440] -- 0:02:57 342000 -- (-2161.952) (-2166.647) [-2158.982] (-2155.154) * (-2156.529) (-2159.978) (-2155.652) [-2163.149] -- 0:02:57 342500 -- (-2162.784) (-2154.772) [-2163.496] (-2153.317) * [-2150.950] (-2157.404) (-2158.388) (-2157.557) -- 0:02:56 343000 -- (-2152.763) [-2151.458] (-2159.656) (-2168.300) * (-2161.799) [-2162.501] (-2155.628) (-2159.334) -- 0:02:56 343500 -- [-2154.059] (-2154.225) (-2155.113) (-2157.844) * (-2157.137) (-2166.196) [-2153.397] (-2155.128) -- 0:02:55 344000 -- (-2155.359) (-2154.652) (-2155.551) [-2155.227] * (-2154.788) (-2165.346) [-2152.648] (-2158.993) -- 0:02:57 344500 -- (-2156.031) (-2153.228) [-2157.650] (-2158.234) * [-2161.005] (-2167.564) (-2157.788) (-2156.636) -- 0:02:56 345000 -- (-2153.706) [-2151.471] (-2157.487) (-2153.320) * [-2153.689] (-2161.786) (-2164.262) (-2164.216) -- 0:02:56 Average standard deviation of split frequencies: 0.010559 345500 -- (-2153.999) (-2158.753) [-2153.212] (-2151.883) * (-2156.663) (-2156.747) (-2161.328) [-2152.685] -- 0:02:56 346000 -- (-2153.923) [-2153.802] (-2158.036) (-2157.094) * (-2156.246) (-2152.173) (-2159.433) [-2155.568] -- 0:02:55 346500 -- [-2156.863] (-2161.692) (-2152.806) (-2165.572) * (-2153.304) [-2151.681] (-2159.067) (-2156.651) -- 0:02:55 347000 -- [-2153.321] (-2156.550) (-2160.458) (-2163.559) * [-2152.162] (-2158.697) (-2168.512) (-2158.723) -- 0:02:55 347500 -- [-2155.533] (-2163.102) (-2160.474) (-2165.879) * (-2159.520) (-2156.980) (-2158.588) [-2160.947] -- 0:02:54 348000 -- (-2155.700) [-2156.264] (-2159.092) (-2159.895) * (-2168.381) (-2158.549) (-2156.284) [-2154.703] -- 0:02:56 348500 -- [-2154.658] (-2156.570) (-2153.313) (-2160.570) * (-2161.232) (-2156.313) [-2151.017] (-2157.043) -- 0:02:55 349000 -- [-2152.462] (-2161.190) (-2156.081) (-2162.481) * (-2164.717) [-2159.451] (-2156.028) (-2150.376) -- 0:02:55 349500 -- (-2154.477) (-2157.708) (-2152.256) [-2152.610] * (-2161.091) [-2151.589] (-2157.941) (-2160.800) -- 0:02:54 350000 -- (-2154.593) (-2152.997) [-2156.817] (-2154.747) * (-2154.373) (-2159.177) [-2156.362] (-2154.365) -- 0:02:54 Average standard deviation of split frequencies: 0.011763 350500 -- (-2156.749) (-2157.921) (-2156.121) [-2155.049] * (-2160.962) (-2165.293) [-2159.698] (-2156.749) -- 0:02:54 351000 -- (-2157.427) [-2156.620] (-2156.095) (-2158.119) * (-2151.494) (-2159.122) (-2157.888) [-2160.176] -- 0:02:53 351500 -- (-2159.841) (-2153.854) (-2162.861) [-2157.844] * (-2161.989) [-2154.006] (-2156.479) (-2159.387) -- 0:02:53 352000 -- (-2155.997) [-2155.715] (-2162.841) (-2160.348) * (-2158.351) (-2154.168) [-2155.273] (-2162.541) -- 0:02:54 352500 -- [-2156.142] (-2156.672) (-2159.195) (-2157.633) * (-2161.554) [-2158.126] (-2157.155) (-2165.719) -- 0:02:54 353000 -- (-2165.220) (-2158.238) [-2155.609] (-2162.743) * (-2157.043) [-2155.775] (-2159.801) (-2160.288) -- 0:02:54 353500 -- (-2155.948) (-2158.456) [-2154.315] (-2156.273) * [-2155.891] (-2153.315) (-2162.369) (-2162.280) -- 0:02:53 354000 -- (-2166.478) (-2157.202) [-2149.673] (-2153.592) * [-2155.920] (-2159.596) (-2163.925) (-2153.896) -- 0:02:53 354500 -- (-2153.385) (-2151.608) [-2156.713] (-2159.346) * (-2156.699) (-2159.652) (-2160.815) [-2152.020] -- 0:02:52 355000 -- [-2152.968] (-2159.006) (-2151.862) (-2158.621) * (-2168.890) [-2154.801] (-2161.062) (-2157.035) -- 0:02:52 Average standard deviation of split frequencies: 0.009600 355500 -- [-2155.029] (-2159.701) (-2156.919) (-2154.598) * (-2158.004) (-2158.644) [-2157.077] (-2153.284) -- 0:02:54 356000 -- (-2170.351) (-2152.306) [-2157.684] (-2159.710) * (-2165.867) [-2154.097] (-2161.211) (-2159.263) -- 0:02:53 356500 -- (-2162.127) [-2153.855] (-2155.862) (-2154.635) * (-2155.667) (-2152.781) (-2158.797) [-2160.815] -- 0:02:53 357000 -- (-2156.206) (-2153.679) [-2156.737] (-2157.064) * (-2162.842) (-2155.310) (-2159.376) [-2155.863] -- 0:02:52 357500 -- (-2161.302) (-2160.754) (-2160.666) [-2157.727] * (-2154.293) [-2154.837] (-2153.940) (-2157.749) -- 0:02:52 358000 -- [-2156.296] (-2160.810) (-2162.242) (-2160.462) * (-2159.151) (-2159.991) (-2158.563) [-2154.225] -- 0:02:52 358500 -- [-2155.513] (-2155.269) (-2155.011) (-2153.694) * (-2156.011) (-2159.866) (-2155.630) [-2154.078] -- 0:02:51 359000 -- [-2154.984] (-2159.282) (-2162.505) (-2156.592) * (-2156.008) (-2155.713) [-2155.452] (-2157.703) -- 0:02:51 359500 -- (-2160.529) [-2155.798] (-2158.738) (-2156.031) * (-2159.799) (-2152.228) [-2158.846] (-2154.492) -- 0:02:52 360000 -- (-2167.607) (-2154.887) [-2159.844] (-2157.632) * (-2158.393) (-2159.098) (-2153.054) [-2155.100] -- 0:02:52 Average standard deviation of split frequencies: 0.012744 360500 -- (-2160.940) (-2161.111) (-2156.288) [-2153.744] * (-2154.875) (-2166.890) [-2160.229] (-2162.241) -- 0:02:52 361000 -- (-2156.350) [-2155.804] (-2154.952) (-2152.658) * [-2159.487] (-2163.116) (-2163.043) (-2162.159) -- 0:02:51 361500 -- (-2168.037) (-2160.552) (-2158.505) [-2153.842] * (-2166.408) (-2155.435) [-2157.385] (-2160.407) -- 0:02:51 362000 -- (-2156.062) (-2152.268) [-2158.131] (-2154.376) * (-2162.548) (-2157.617) [-2159.435] (-2159.551) -- 0:02:50 362500 -- (-2156.980) (-2154.463) (-2156.995) [-2151.974] * (-2168.285) (-2154.437) [-2156.436] (-2153.501) -- 0:02:50 363000 -- (-2160.558) [-2160.319] (-2153.456) (-2161.894) * (-2156.772) (-2152.336) [-2160.892] (-2156.757) -- 0:02:50 363500 -- (-2162.491) (-2157.677) (-2160.202) [-2151.497] * (-2157.347) (-2158.829) (-2158.867) [-2157.719] -- 0:02:51 364000 -- (-2157.614) (-2160.014) (-2158.046) [-2155.373] * (-2155.381) (-2163.061) (-2151.893) [-2156.852] -- 0:02:51 364500 -- (-2160.215) (-2161.496) [-2154.918] (-2155.475) * [-2156.106] (-2165.268) (-2155.615) (-2158.545) -- 0:02:50 365000 -- (-2158.848) [-2159.537] (-2160.292) (-2156.810) * (-2159.463) (-2158.707) (-2159.790) [-2159.089] -- 0:02:50 Average standard deviation of split frequencies: 0.014168 365500 -- (-2157.105) (-2162.334) [-2162.335] (-2153.261) * (-2154.776) [-2154.368] (-2155.432) (-2155.676) -- 0:02:50 366000 -- (-2156.328) (-2160.730) [-2152.347] (-2160.776) * (-2153.930) [-2156.407] (-2155.343) (-2161.725) -- 0:02:49 366500 -- [-2152.373] (-2154.778) (-2157.889) (-2158.409) * (-2155.926) (-2162.113) [-2159.348] (-2156.457) -- 0:02:49 367000 -- (-2150.826) (-2159.834) (-2162.371) [-2156.421] * [-2158.048] (-2159.026) (-2160.128) (-2162.320) -- 0:02:50 367500 -- (-2155.309) (-2155.765) [-2154.897] (-2156.267) * (-2154.924) [-2154.039] (-2161.991) (-2155.815) -- 0:02:50 368000 -- (-2155.623) (-2153.411) [-2155.633] (-2162.199) * (-2162.445) (-2160.280) [-2163.145] (-2160.603) -- 0:02:50 368500 -- (-2161.023) (-2153.856) [-2155.612] (-2159.862) * (-2162.033) (-2156.887) [-2154.000] (-2161.002) -- 0:02:49 369000 -- (-2164.120) (-2154.865) (-2153.948) [-2159.793] * [-2154.554] (-2155.687) (-2156.808) (-2156.468) -- 0:02:49 369500 -- (-2158.500) [-2157.982] (-2161.386) (-2157.492) * [-2156.108] (-2161.937) (-2156.804) (-2158.849) -- 0:02:48 370000 -- [-2155.600] (-2157.580) (-2153.927) (-2159.178) * (-2152.945) (-2156.682) (-2159.384) [-2156.136] -- 0:02:48 Average standard deviation of split frequencies: 0.013354 370500 -- (-2169.189) [-2160.526] (-2154.824) (-2158.901) * (-2163.203) (-2155.162) (-2159.026) [-2154.926] -- 0:02:48 371000 -- (-2166.610) (-2156.731) (-2157.223) [-2154.976] * (-2154.192) (-2154.463) (-2154.006) [-2155.894] -- 0:02:49 371500 -- [-2158.368] (-2158.636) (-2153.343) (-2160.115) * [-2153.335] (-2162.531) (-2158.798) (-2153.214) -- 0:02:49 372000 -- [-2157.358] (-2158.906) (-2164.068) (-2164.954) * (-2159.822) [-2158.750] (-2158.449) (-2162.716) -- 0:02:48 372500 -- [-2156.334] (-2156.534) (-2157.138) (-2158.358) * (-2160.686) (-2159.591) (-2165.833) [-2155.026] -- 0:02:48 373000 -- (-2155.517) (-2158.391) [-2157.498] (-2160.773) * (-2164.298) (-2157.214) [-2161.364] (-2155.292) -- 0:02:48 373500 -- (-2162.006) (-2161.224) [-2163.526] (-2155.099) * (-2161.721) (-2161.343) (-2159.500) [-2154.092] -- 0:02:47 374000 -- (-2155.683) [-2154.814] (-2161.761) (-2152.233) * [-2160.126] (-2157.143) (-2155.699) (-2162.481) -- 0:02:47 374500 -- (-2154.182) (-2156.062) (-2164.691) [-2157.048] * (-2157.166) (-2157.175) (-2159.657) [-2155.696] -- 0:02:48 375000 -- (-2162.661) [-2156.633] (-2166.095) (-2156.245) * (-2162.156) [-2156.601] (-2152.775) (-2152.729) -- 0:02:48 Average standard deviation of split frequencies: 0.010970 375500 -- (-2159.939) (-2158.454) (-2165.440) [-2155.740] * (-2157.035) [-2157.251] (-2156.679) (-2163.424) -- 0:02:47 376000 -- (-2160.970) [-2155.080] (-2170.136) (-2156.187) * (-2151.944) (-2158.726) (-2164.472) [-2157.188] -- 0:02:47 376500 -- (-2160.081) [-2149.902] (-2157.275) (-2156.691) * (-2157.622) (-2162.692) (-2161.101) [-2152.406] -- 0:02:47 377000 -- (-2157.158) (-2150.809) [-2155.850] (-2160.194) * [-2154.686] (-2160.940) (-2155.337) (-2153.998) -- 0:02:46 377500 -- [-2152.825] (-2152.943) (-2160.637) (-2154.098) * (-2150.099) (-2158.024) (-2159.209) [-2156.418] -- 0:02:46 378000 -- (-2165.105) (-2158.623) (-2163.270) [-2160.617] * (-2153.058) (-2152.426) [-2151.458] (-2154.567) -- 0:02:46 378500 -- (-2157.004) (-2159.010) (-2155.034) [-2156.588] * (-2164.818) (-2155.567) [-2155.781] (-2155.707) -- 0:02:47 379000 -- (-2157.649) [-2163.745] (-2150.872) (-2156.197) * (-2153.264) (-2158.399) (-2153.852) [-2161.502] -- 0:02:47 379500 -- [-2158.598] (-2158.727) (-2157.149) (-2159.060) * (-2160.771) (-2161.420) (-2153.257) [-2156.965] -- 0:02:46 380000 -- (-2160.161) [-2157.948] (-2163.729) (-2155.007) * (-2165.658) (-2155.186) (-2159.769) [-2152.699] -- 0:02:46 Average standard deviation of split frequencies: 0.009597 380500 -- (-2162.120) [-2155.851] (-2155.502) (-2159.800) * (-2158.373) [-2155.105] (-2156.610) (-2161.243) -- 0:02:46 381000 -- (-2160.508) (-2157.279) (-2157.124) [-2154.893] * (-2162.909) [-2154.287] (-2163.528) (-2157.315) -- 0:02:45 381500 -- (-2163.423) (-2157.406) (-2163.625) [-2160.840] * (-2154.831) (-2160.250) [-2159.355] (-2152.529) -- 0:02:45 382000 -- (-2158.640) (-2155.701) [-2154.120] (-2160.218) * [-2153.942] (-2164.061) (-2159.105) (-2155.731) -- 0:02:46 382500 -- [-2153.914] (-2155.349) (-2162.688) (-2165.044) * (-2154.161) (-2160.129) [-2156.500] (-2158.294) -- 0:02:46 383000 -- (-2157.033) (-2159.740) (-2153.424) [-2160.172] * (-2153.922) [-2157.147] (-2162.055) (-2159.899) -- 0:02:45 383500 -- (-2160.169) (-2151.662) [-2161.190] (-2169.142) * (-2159.815) (-2168.628) [-2162.391] (-2157.440) -- 0:02:45 384000 -- (-2150.801) [-2155.493] (-2156.849) (-2163.199) * (-2163.177) (-2164.688) [-2163.429] (-2156.303) -- 0:02:45 384500 -- (-2165.041) (-2157.285) [-2158.147] (-2157.994) * (-2159.441) [-2162.874] (-2162.920) (-2165.918) -- 0:02:44 385000 -- [-2158.546] (-2165.573) (-2152.769) (-2157.577) * [-2154.005] (-2160.410) (-2163.012) (-2159.025) -- 0:02:44 Average standard deviation of split frequencies: 0.009465 385500 -- (-2158.082) (-2154.933) [-2161.894] (-2154.955) * [-2162.812] (-2157.903) (-2155.572) (-2157.078) -- 0:02:44 386000 -- [-2158.722] (-2154.603) (-2154.324) (-2158.979) * (-2158.444) (-2160.138) (-2156.452) [-2156.577] -- 0:02:45 386500 -- [-2154.167] (-2156.419) (-2157.467) (-2161.585) * [-2157.244] (-2157.012) (-2169.256) (-2159.836) -- 0:02:45 387000 -- (-2157.670) [-2156.694] (-2157.800) (-2156.859) * (-2160.508) (-2157.110) (-2161.892) [-2161.148] -- 0:02:44 387500 -- (-2160.608) (-2157.193) [-2155.317] (-2155.993) * (-2159.260) (-2157.905) [-2161.547] (-2157.666) -- 0:02:44 388000 -- (-2161.030) (-2154.723) (-2156.389) [-2156.058] * (-2149.948) [-2157.541] (-2160.223) (-2165.559) -- 0:02:44 388500 -- [-2152.938] (-2159.639) (-2154.011) (-2156.180) * [-2151.927] (-2156.968) (-2155.281) (-2162.659) -- 0:02:43 389000 -- [-2159.525] (-2161.966) (-2159.970) (-2160.382) * (-2154.660) [-2152.854] (-2161.505) (-2155.352) -- 0:02:43 389500 -- (-2159.596) [-2153.586] (-2159.393) (-2158.151) * [-2157.494] (-2156.496) (-2165.938) (-2159.974) -- 0:02:44 390000 -- (-2155.579) (-2153.637) (-2162.118) [-2157.305] * [-2153.357] (-2153.587) (-2159.593) (-2157.483) -- 0:02:44 Average standard deviation of split frequencies: 0.007542 390500 -- (-2155.353) [-2161.312] (-2160.895) (-2154.742) * (-2159.638) (-2153.899) [-2163.865] (-2159.503) -- 0:02:43 391000 -- (-2155.052) (-2157.702) (-2160.680) [-2155.017] * (-2155.465) [-2157.612] (-2170.156) (-2155.298) -- 0:02:43 391500 -- (-2157.994) (-2157.779) (-2157.423) [-2154.933] * (-2156.171) [-2154.140] (-2164.975) (-2158.547) -- 0:02:43 392000 -- [-2155.049] (-2167.926) (-2157.858) (-2157.263) * (-2158.985) (-2157.599) [-2162.604] (-2160.289) -- 0:02:42 392500 -- (-2157.189) [-2158.636] (-2160.443) (-2154.199) * (-2154.198) (-2160.438) (-2160.613) [-2162.417] -- 0:02:42 393000 -- (-2161.423) (-2156.975) (-2162.724) [-2158.129] * (-2161.581) (-2154.696) (-2156.840) [-2155.323] -- 0:02:42 393500 -- (-2156.335) (-2156.618) (-2157.225) [-2155.678] * (-2165.521) (-2155.282) [-2155.626] (-2160.563) -- 0:02:43 394000 -- (-2164.466) (-2157.181) (-2159.695) [-2166.634] * (-2153.817) (-2160.851) [-2157.980] (-2152.717) -- 0:02:43 394500 -- (-2161.412) [-2155.776] (-2163.088) (-2154.992) * (-2153.563) (-2162.601) (-2158.684) [-2155.720] -- 0:02:42 395000 -- (-2155.146) (-2158.124) (-2163.665) [-2154.661] * [-2155.768] (-2154.717) (-2162.987) (-2160.341) -- 0:02:42 Average standard deviation of split frequencies: 0.006547 395500 -- (-2155.951) [-2153.258] (-2155.126) (-2160.198) * [-2154.086] (-2162.239) (-2157.206) (-2155.719) -- 0:02:42 396000 -- (-2157.239) (-2156.638) [-2157.058] (-2159.082) * (-2153.070) (-2161.512) [-2153.054] (-2157.359) -- 0:02:41 396500 -- (-2159.664) [-2153.231] (-2160.559) (-2154.852) * [-2152.809] (-2156.239) (-2157.056) (-2155.122) -- 0:02:41 397000 -- (-2156.890) (-2158.413) [-2157.358] (-2155.952) * (-2158.188) [-2156.455] (-2154.423) (-2162.112) -- 0:02:41 397500 -- [-2152.477] (-2160.216) (-2153.817) (-2154.538) * [-2159.508] (-2154.009) (-2153.577) (-2157.539) -- 0:02:42 398000 -- (-2155.160) [-2154.027] (-2161.099) (-2151.744) * (-2164.489) [-2153.662] (-2153.621) (-2158.267) -- 0:02:41 398500 -- (-2168.726) [-2154.351] (-2162.320) (-2157.132) * (-2155.220) (-2154.557) (-2156.322) [-2162.574] -- 0:02:41 399000 -- [-2161.015] (-2157.465) (-2160.242) (-2160.366) * (-2154.951) (-2157.780) (-2158.542) [-2157.644] -- 0:02:41 399500 -- [-2152.805] (-2155.630) (-2154.675) (-2160.641) * [-2153.282] (-2168.694) (-2150.581) (-2163.000) -- 0:02:40 400000 -- (-2157.566) (-2160.066) [-2153.589] (-2162.310) * (-2158.605) [-2162.778] (-2155.606) (-2155.405) -- 0:02:40 Average standard deviation of split frequencies: 0.006471 400500 -- [-2153.414] (-2157.362) (-2157.737) (-2155.129) * (-2155.271) (-2160.615) [-2153.413] (-2160.006) -- 0:02:40 401000 -- (-2160.637) [-2156.949] (-2154.185) (-2152.943) * (-2168.597) (-2159.551) (-2157.207) [-2154.475] -- 0:02:41 401500 -- [-2159.767] (-2155.117) (-2160.036) (-2158.935) * (-2155.174) (-2157.080) [-2157.630] (-2158.204) -- 0:02:40 402000 -- (-2171.530) (-2156.626) (-2155.245) [-2158.635] * [-2156.307] (-2153.746) (-2158.439) (-2156.699) -- 0:02:40 402500 -- (-2160.517) (-2156.243) (-2158.753) [-2157.496] * [-2150.639] (-2162.424) (-2156.954) (-2159.925) -- 0:02:40 403000 -- (-2159.997) (-2151.984) (-2158.678) [-2150.898] * [-2152.683] (-2163.764) (-2154.536) (-2162.762) -- 0:02:39 403500 -- (-2164.275) (-2156.385) [-2156.627] (-2158.508) * (-2153.949) (-2158.164) [-2161.089] (-2160.900) -- 0:02:39 404000 -- [-2167.865] (-2159.570) (-2156.724) (-2157.262) * (-2156.246) [-2161.673] (-2163.412) (-2155.272) -- 0:02:39 404500 -- (-2163.933) (-2159.913) (-2152.301) [-2157.327] * (-2157.182) [-2155.071] (-2157.201) (-2170.573) -- 0:02:38 405000 -- (-2152.613) (-2155.924) [-2157.455] (-2163.894) * [-2161.857] (-2156.455) (-2155.271) (-2155.554) -- 0:02:40 Average standard deviation of split frequencies: 0.006386 405500 -- (-2157.352) [-2169.397] (-2153.608) (-2162.539) * (-2156.542) (-2157.671) (-2157.704) [-2152.290] -- 0:02:39 406000 -- (-2159.395) (-2164.291) [-2156.028] (-2163.566) * (-2159.059) [-2159.009] (-2159.217) (-2150.763) -- 0:02:39 406500 -- (-2159.018) (-2152.905) [-2158.361] (-2157.138) * (-2154.827) (-2158.910) (-2154.086) [-2155.752] -- 0:02:39 407000 -- (-2157.272) [-2156.404] (-2157.354) (-2156.934) * (-2156.451) (-2157.245) (-2155.892) [-2155.336] -- 0:02:38 407500 -- [-2157.760] (-2159.347) (-2167.138) (-2171.058) * (-2159.625) (-2154.953) [-2154.325] (-2153.791) -- 0:02:38 408000 -- (-2152.311) (-2161.951) (-2161.487) [-2160.754] * (-2153.903) (-2155.547) (-2157.920) [-2154.970] -- 0:02:38 408500 -- [-2161.717] (-2156.024) (-2153.703) (-2156.537) * (-2159.210) (-2159.035) (-2156.670) [-2152.171] -- 0:02:39 409000 -- (-2160.758) (-2153.827) (-2156.182) [-2153.665] * (-2160.382) (-2159.142) (-2151.407) [-2155.025] -- 0:02:38 409500 -- (-2158.538) (-2155.551) [-2154.593] (-2155.284) * [-2159.729] (-2160.931) (-2161.269) (-2154.638) -- 0:02:38 410000 -- (-2161.289) [-2150.935] (-2160.448) (-2158.959) * [-2158.817] (-2163.618) (-2162.120) (-2161.142) -- 0:02:38 Average standard deviation of split frequencies: 0.006026 410500 -- [-2164.260] (-2154.334) (-2158.480) (-2155.330) * [-2158.243] (-2154.585) (-2158.038) (-2158.973) -- 0:02:37 411000 -- (-2155.634) (-2157.737) [-2157.199] (-2153.599) * (-2154.587) [-2156.928] (-2164.294) (-2160.145) -- 0:02:37 411500 -- (-2152.999) (-2158.479) (-2162.214) [-2152.529] * (-2155.600) [-2159.532] (-2162.375) (-2156.035) -- 0:02:37 412000 -- (-2160.741) [-2158.603] (-2158.309) (-2160.492) * (-2152.731) [-2158.973] (-2163.920) (-2160.642) -- 0:02:36 412500 -- (-2161.049) [-2152.221] (-2153.735) (-2157.965) * (-2156.368) [-2167.436] (-2155.701) (-2159.945) -- 0:02:38 413000 -- (-2162.833) [-2157.098] (-2154.592) (-2153.921) * (-2158.506) [-2152.435] (-2154.014) (-2165.101) -- 0:02:37 413500 -- (-2159.731) (-2163.544) (-2158.454) [-2155.488] * [-2156.705] (-2154.700) (-2157.709) (-2157.453) -- 0:02:37 414000 -- (-2156.057) (-2158.017) [-2155.249] (-2158.691) * (-2156.784) (-2154.480) [-2159.561] (-2154.097) -- 0:02:37 414500 -- [-2155.061] (-2155.855) (-2156.550) (-2161.181) * (-2158.455) (-2153.661) [-2158.075] (-2161.691) -- 0:02:36 415000 -- (-2153.401) (-2162.179) (-2161.213) [-2151.517] * [-2153.453] (-2159.020) (-2151.824) (-2153.517) -- 0:02:36 Average standard deviation of split frequencies: 0.005949 415500 -- (-2164.343) (-2162.605) (-2156.993) [-2149.623] * [-2156.332] (-2158.899) (-2157.039) (-2155.811) -- 0:02:36 416000 -- (-2160.398) (-2164.812) (-2156.524) [-2155.209] * [-2155.431] (-2154.450) (-2155.756) (-2156.897) -- 0:02:35 416500 -- [-2152.867] (-2164.452) (-2157.608) (-2164.901) * [-2155.874] (-2160.468) (-2159.359) (-2158.575) -- 0:02:36 417000 -- [-2154.738] (-2162.569) (-2154.679) (-2157.126) * (-2158.653) (-2158.032) (-2156.390) [-2159.319] -- 0:02:36 417500 -- (-2155.681) [-2151.129] (-2152.499) (-2160.448) * [-2158.472] (-2159.981) (-2158.900) (-2160.899) -- 0:02:36 418000 -- (-2155.116) (-2154.329) [-2155.710] (-2158.189) * (-2156.334) (-2162.688) [-2158.309] (-2153.955) -- 0:02:35 418500 -- (-2158.014) [-2157.591] (-2161.128) (-2153.816) * [-2156.510] (-2155.765) (-2157.997) (-2157.407) -- 0:02:35 419000 -- [-2153.572] (-2156.242) (-2154.607) (-2158.290) * (-2158.320) (-2158.670) [-2151.718] (-2155.759) -- 0:02:35 419500 -- (-2162.997) (-2172.299) (-2154.792) [-2154.595] * (-2152.132) (-2166.198) [-2156.389] (-2161.696) -- 0:02:34 420000 -- (-2163.368) [-2165.091] (-2155.827) (-2157.693) * [-2156.501] (-2166.281) (-2160.863) (-2157.133) -- 0:02:36 Average standard deviation of split frequencies: 0.005883 420500 -- (-2158.353) (-2155.158) [-2156.716] (-2156.447) * [-2155.466] (-2160.615) (-2156.702) (-2156.774) -- 0:02:35 421000 -- [-2160.729] (-2155.472) (-2158.598) (-2162.852) * (-2156.684) (-2156.958) (-2159.023) [-2159.409] -- 0:02:35 421500 -- (-2156.796) [-2159.315] (-2155.768) (-2157.832) * (-2159.375) [-2155.334] (-2159.096) (-2151.736) -- 0:02:35 422000 -- (-2157.247) (-2154.982) (-2164.368) [-2155.496] * (-2166.615) (-2162.589) (-2160.914) [-2153.889] -- 0:02:34 422500 -- (-2156.827) [-2156.075] (-2153.099) (-2160.735) * (-2159.580) (-2157.629) (-2151.401) [-2156.734] -- 0:02:34 423000 -- (-2155.001) (-2153.301) [-2153.789] (-2159.451) * (-2156.940) [-2155.977] (-2157.031) (-2152.976) -- 0:02:34 423500 -- (-2159.992) (-2157.628) (-2156.806) [-2155.679] * (-2165.052) (-2160.799) [-2161.994] (-2159.669) -- 0:02:33 424000 -- (-2154.175) [-2155.226] (-2156.284) (-2159.700) * (-2158.341) (-2155.993) (-2160.975) [-2158.500] -- 0:02:34 424500 -- [-2158.495] (-2155.721) (-2157.964) (-2157.998) * (-2162.501) [-2151.718] (-2161.357) (-2159.615) -- 0:02:34 425000 -- (-2155.214) [-2162.179] (-2162.039) (-2162.334) * (-2160.416) (-2156.816) (-2166.126) [-2155.302] -- 0:02:34 Average standard deviation of split frequencies: 0.005810 425500 -- (-2158.048) [-2160.928] (-2164.608) (-2159.609) * (-2160.199) (-2161.329) [-2161.131] (-2158.558) -- 0:02:33 426000 -- [-2160.151] (-2165.247) (-2155.047) (-2157.150) * [-2152.847] (-2153.784) (-2157.106) (-2157.244) -- 0:02:33 426500 -- [-2157.774] (-2161.021) (-2163.062) (-2154.888) * (-2162.784) [-2158.046] (-2158.846) (-2158.286) -- 0:02:33 427000 -- (-2155.894) (-2158.985) (-2160.856) [-2155.848] * (-2157.766) (-2160.942) [-2159.918] (-2165.733) -- 0:02:32 427500 -- (-2156.964) (-2153.754) [-2150.466] (-2153.627) * [-2152.010] (-2158.293) (-2156.038) (-2165.088) -- 0:02:34 428000 -- [-2155.369] (-2162.707) (-2161.299) (-2159.135) * [-2155.308] (-2163.105) (-2152.065) (-2159.908) -- 0:02:33 428500 -- (-2155.659) (-2163.795) [-2152.648] (-2155.981) * (-2156.922) [-2155.828] (-2158.919) (-2159.801) -- 0:02:33 429000 -- (-2155.740) [-2158.469] (-2155.389) (-2154.515) * (-2150.662) (-2156.440) (-2153.854) [-2155.132] -- 0:02:33 429500 -- (-2158.493) (-2158.895) (-2158.676) [-2151.636] * [-2154.318] (-2153.951) (-2158.772) (-2158.992) -- 0:02:32 430000 -- (-2161.772) (-2158.062) [-2155.340] (-2158.567) * (-2151.517) (-2157.409) (-2158.682) [-2169.605] -- 0:02:32 Average standard deviation of split frequencies: 0.005747 430500 -- (-2161.716) (-2159.447) [-2163.891] (-2159.308) * (-2155.545) (-2156.537) (-2164.949) [-2157.493] -- 0:02:32 431000 -- (-2158.865) [-2157.006] (-2158.033) (-2160.718) * (-2160.306) [-2151.342] (-2161.006) (-2158.905) -- 0:02:31 431500 -- (-2162.673) (-2162.430) (-2156.615) [-2153.852] * (-2153.196) [-2150.037] (-2157.459) (-2165.294) -- 0:02:32 432000 -- (-2158.105) (-2161.392) [-2153.917] (-2157.745) * [-2155.703] (-2154.703) (-2162.357) (-2162.045) -- 0:02:32 432500 -- (-2165.026) (-2156.363) (-2149.589) [-2160.938] * (-2158.356) [-2159.795] (-2165.774) (-2161.617) -- 0:02:32 433000 -- [-2160.804] (-2155.779) (-2153.962) (-2159.085) * [-2155.263] (-2153.924) (-2163.400) (-2154.337) -- 0:02:31 433500 -- (-2156.734) (-2155.549) (-2157.087) [-2156.803] * [-2154.102] (-2158.259) (-2161.816) (-2151.980) -- 0:02:31 434000 -- (-2156.760) (-2151.071) (-2158.949) [-2156.217] * [-2154.297] (-2152.440) (-2156.009) (-2161.109) -- 0:02:31 434500 -- (-2161.527) [-2161.499] (-2158.983) (-2158.857) * (-2153.498) (-2161.549) (-2158.393) [-2152.960] -- 0:02:30 435000 -- (-2161.126) (-2156.920) (-2157.588) [-2160.248] * [-2153.620] (-2158.261) (-2155.618) (-2158.569) -- 0:02:31 Average standard deviation of split frequencies: 0.005676 435500 -- (-2156.711) (-2153.418) [-2159.368] (-2155.674) * (-2159.618) (-2156.534) [-2156.644] (-2156.045) -- 0:02:31 436000 -- [-2156.532] (-2156.465) (-2162.498) (-2156.777) * (-2156.033) (-2153.857) [-2164.769] (-2150.406) -- 0:02:31 436500 -- [-2150.994] (-2157.632) (-2154.114) (-2161.170) * (-2157.487) [-2157.465] (-2156.513) (-2161.330) -- 0:02:31 437000 -- (-2157.069) (-2159.067) [-2154.253] (-2151.913) * [-2157.196] (-2155.744) (-2153.646) (-2162.688) -- 0:02:30 437500 -- (-2164.721) (-2150.737) [-2155.942] (-2152.946) * (-2155.583) (-2156.913) [-2154.391] (-2162.526) -- 0:02:30 438000 -- (-2156.538) [-2154.404] (-2155.075) (-2154.592) * [-2157.485] (-2159.555) (-2159.891) (-2159.376) -- 0:02:30 438500 -- (-2153.445) [-2155.149] (-2153.476) (-2157.798) * [-2156.711] (-2159.879) (-2157.892) (-2162.354) -- 0:02:29 439000 -- (-2161.275) (-2165.263) [-2155.359] (-2159.324) * (-2159.341) (-2161.897) (-2151.755) [-2159.543] -- 0:02:30 439500 -- [-2162.731] (-2160.425) (-2163.089) (-2152.043) * (-2158.649) (-2162.675) (-2158.961) [-2155.941] -- 0:02:30 440000 -- (-2157.015) (-2165.756) (-2161.701) [-2154.284] * [-2151.369] (-2159.328) (-2158.064) (-2161.840) -- 0:02:30 Average standard deviation of split frequencies: 0.005884 440500 -- (-2160.377) (-2162.270) [-2170.294] (-2162.760) * (-2153.676) (-2155.950) (-2158.077) [-2159.827] -- 0:02:29 441000 -- (-2163.945) (-2155.793) [-2156.993] (-2162.657) * (-2163.939) [-2160.061] (-2159.894) (-2155.292) -- 0:02:29 441500 -- [-2165.888] (-2155.254) (-2152.179) (-2163.596) * (-2157.188) [-2154.833] (-2161.011) (-2155.541) -- 0:02:29 442000 -- (-2158.936) (-2163.694) (-2162.261) [-2154.829] * (-2179.921) (-2153.266) (-2158.651) [-2157.732] -- 0:02:28 442500 -- (-2160.645) (-2154.274) [-2157.285] (-2153.762) * (-2162.531) (-2153.515) (-2156.462) [-2152.996] -- 0:02:28 443000 -- (-2152.380) (-2160.337) [-2152.902] (-2153.633) * (-2162.415) (-2160.758) [-2154.263] (-2162.694) -- 0:02:29 443500 -- (-2155.825) (-2161.905) (-2158.249) [-2153.602] * (-2154.517) (-2159.216) [-2155.824] (-2162.650) -- 0:02:29 444000 -- (-2157.481) (-2162.977) (-2159.923) [-2153.552] * [-2155.229] (-2162.302) (-2156.606) (-2162.374) -- 0:02:29 444500 -- (-2159.185) (-2159.377) (-2160.350) [-2161.757] * (-2161.378) (-2169.537) (-2153.393) [-2152.178] -- 0:02:28 445000 -- (-2152.550) (-2157.343) (-2165.019) [-2162.615] * [-2153.617] (-2154.493) (-2153.505) (-2151.961) -- 0:02:28 Average standard deviation of split frequencies: 0.006078 445500 -- (-2161.159) [-2155.336] (-2154.296) (-2156.633) * (-2154.706) (-2164.371) [-2154.742] (-2153.534) -- 0:02:28 446000 -- (-2156.005) (-2161.639) [-2157.256] (-2157.573) * (-2150.548) (-2156.076) (-2157.150) [-2157.489] -- 0:02:27 446500 -- [-2155.617] (-2161.546) (-2157.530) (-2163.465) * (-2163.780) [-2162.585] (-2161.059) (-2156.454) -- 0:02:28 447000 -- (-2162.689) (-2162.776) [-2155.975] (-2159.940) * (-2155.546) (-2155.761) (-2156.299) [-2150.799] -- 0:02:28 447500 -- (-2160.944) (-2166.168) [-2159.524] (-2157.690) * (-2158.142) [-2161.643] (-2163.451) (-2153.370) -- 0:02:28 448000 -- [-2151.597] (-2154.894) (-2158.884) (-2159.086) * [-2156.071] (-2163.645) (-2158.248) (-2160.235) -- 0:02:27 448500 -- [-2152.463] (-2161.895) (-2155.786) (-2151.348) * (-2164.935) [-2155.600] (-2151.904) (-2159.201) -- 0:02:27 449000 -- (-2153.251) (-2158.377) (-2156.100) [-2152.424] * (-2156.442) [-2156.587] (-2163.310) (-2160.799) -- 0:02:27 449500 -- (-2159.149) (-2157.240) (-2153.877) [-2158.479] * (-2156.378) [-2160.215] (-2162.858) (-2159.480) -- 0:02:26 450000 -- (-2160.531) (-2156.082) (-2156.609) [-2154.221] * (-2153.192) (-2160.836) [-2161.460] (-2157.978) -- 0:02:26 Average standard deviation of split frequencies: 0.006015 450500 -- (-2161.604) [-2156.796] (-2156.586) (-2163.148) * [-2148.589] (-2167.033) (-2159.923) (-2150.984) -- 0:02:27 451000 -- (-2163.748) (-2157.033) [-2150.863] (-2157.786) * [-2154.882] (-2163.614) (-2157.629) (-2159.683) -- 0:02:27 451500 -- (-2157.826) [-2154.520] (-2151.654) (-2160.433) * (-2155.789) (-2164.952) [-2159.436] (-2158.863) -- 0:02:26 452000 -- [-2156.961] (-2152.509) (-2153.893) (-2155.928) * (-2152.299) (-2165.942) [-2159.481] (-2159.490) -- 0:02:26 452500 -- (-2160.517) (-2164.105) (-2160.379) [-2162.350] * (-2156.440) (-2159.149) [-2155.828] (-2160.991) -- 0:02:26 453000 -- (-2159.562) [-2152.531] (-2156.955) (-2162.152) * (-2159.031) (-2159.002) [-2156.206] (-2159.715) -- 0:02:26 453500 -- [-2156.368] (-2160.781) (-2158.297) (-2162.941) * (-2160.753) [-2152.057] (-2159.141) (-2162.310) -- 0:02:25 454000 -- (-2153.854) (-2161.585) [-2153.598] (-2158.512) * (-2156.569) [-2156.427] (-2164.325) (-2155.707) -- 0:02:26 454500 -- (-2159.637) (-2158.665) (-2163.219) [-2157.824] * (-2159.665) [-2165.690] (-2162.339) (-2162.909) -- 0:02:26 455000 -- (-2157.388) (-2162.577) (-2160.071) [-2158.756] * (-2155.639) [-2157.662] (-2160.937) (-2153.812) -- 0:02:26 Average standard deviation of split frequencies: 0.005944 455500 -- [-2155.873] (-2154.102) (-2158.830) (-2165.594) * (-2166.865) [-2161.659] (-2158.152) (-2159.757) -- 0:02:25 456000 -- (-2156.998) [-2150.647] (-2157.981) (-2159.643) * (-2159.743) (-2165.139) [-2161.319] (-2156.361) -- 0:02:25 456500 -- (-2158.850) [-2152.754] (-2159.324) (-2154.581) * (-2155.245) [-2153.351] (-2163.788) (-2156.768) -- 0:02:25 457000 -- (-2157.950) [-2155.223] (-2162.571) (-2164.412) * (-2156.409) (-2157.870) [-2156.402] (-2158.367) -- 0:02:24 457500 -- [-2156.615] (-2163.940) (-2161.670) (-2154.038) * [-2157.383] (-2156.555) (-2159.056) (-2157.089) -- 0:02:24 458000 -- (-2152.935) [-2152.036] (-2154.796) (-2160.025) * [-2158.600] (-2153.110) (-2152.644) (-2155.580) -- 0:02:25 458500 -- (-2154.805) (-2163.586) [-2159.719] (-2159.658) * [-2155.236] (-2159.639) (-2151.235) (-2152.626) -- 0:02:25 459000 -- (-2156.439) [-2155.521] (-2157.219) (-2152.883) * [-2151.236] (-2156.248) (-2154.781) (-2159.978) -- 0:02:24 459500 -- (-2157.392) [-2156.779] (-2161.070) (-2159.240) * (-2156.471) (-2154.290) (-2160.086) [-2152.145] -- 0:02:24 460000 -- (-2156.167) (-2153.717) (-2163.360) [-2158.511] * (-2160.573) [-2150.287] (-2164.186) (-2155.162) -- 0:02:24 Average standard deviation of split frequencies: 0.005884 460500 -- (-2157.425) (-2162.148) (-2162.083) [-2156.895] * [-2152.630] (-2152.163) (-2161.815) (-2155.599) -- 0:02:24 461000 -- (-2160.016) [-2153.512] (-2160.132) (-2155.312) * [-2153.860] (-2155.469) (-2155.952) (-2163.125) -- 0:02:23 461500 -- (-2159.342) (-2155.240) (-2156.569) [-2161.039] * (-2152.813) [-2156.810] (-2151.740) (-2155.670) -- 0:02:23 462000 -- [-2152.272] (-2159.313) (-2153.880) (-2160.266) * (-2155.091) [-2154.672] (-2157.564) (-2150.680) -- 0:02:24 462500 -- [-2158.926] (-2152.331) (-2152.273) (-2164.208) * (-2159.997) (-2155.073) [-2162.720] (-2155.857) -- 0:02:24 463000 -- (-2156.369) (-2159.036) [-2153.747] (-2159.182) * (-2158.383) (-2155.471) (-2166.033) [-2160.078] -- 0:02:23 463500 -- (-2153.115) [-2155.480] (-2171.666) (-2157.186) * (-2153.729) [-2155.730] (-2159.853) (-2159.717) -- 0:02:23 464000 -- (-2155.002) (-2158.815) [-2159.948] (-2154.866) * (-2156.563) (-2155.435) (-2162.520) [-2161.224] -- 0:02:23 464500 -- [-2153.910] (-2157.856) (-2163.149) (-2154.620) * (-2161.365) (-2162.872) (-2158.659) [-2158.877] -- 0:02:22 465000 -- (-2169.925) [-2158.937] (-2157.096) (-2153.521) * (-2160.794) (-2164.701) [-2164.043] (-2158.534) -- 0:02:22 Average standard deviation of split frequencies: 0.005311 465500 -- (-2158.560) (-2154.964) [-2155.120] (-2153.948) * [-2161.077] (-2156.226) (-2167.759) (-2153.958) -- 0:02:23 466000 -- (-2152.754) [-2159.897] (-2159.688) (-2154.882) * (-2161.489) (-2159.382) [-2157.639] (-2158.600) -- 0:02:23 466500 -- (-2155.645) (-2158.905) (-2160.070) [-2154.153] * (-2158.403) (-2158.537) [-2155.531] (-2156.615) -- 0:02:22 467000 -- [-2156.662] (-2152.903) (-2159.277) (-2155.576) * (-2159.069) (-2164.076) (-2159.778) [-2155.834] -- 0:02:22 467500 -- (-2163.679) [-2156.154] (-2156.558) (-2163.092) * (-2164.815) [-2157.421] (-2153.805) (-2156.611) -- 0:02:22 468000 -- (-2156.094) [-2156.951] (-2157.709) (-2151.359) * (-2160.815) (-2161.677) (-2156.188) [-2158.250] -- 0:02:22 468500 -- (-2162.005) (-2158.398) [-2158.403] (-2155.605) * [-2159.753] (-2156.940) (-2156.074) (-2160.057) -- 0:02:21 469000 -- (-2154.602) [-2154.299] (-2165.148) (-2159.240) * (-2161.905) (-2164.873) [-2157.577] (-2158.968) -- 0:02:22 469500 -- (-2161.183) (-2156.146) (-2156.985) [-2157.597] * (-2162.671) [-2157.933] (-2163.205) (-2154.637) -- 0:02:22 470000 -- (-2155.981) (-2158.354) [-2159.731] (-2153.368) * (-2156.397) [-2154.153] (-2168.248) (-2159.518) -- 0:02:22 Average standard deviation of split frequencies: 0.005759 470500 -- [-2153.731] (-2159.855) (-2157.190) (-2152.888) * (-2161.337) [-2154.942] (-2157.751) (-2166.269) -- 0:02:21 471000 -- (-2154.591) (-2158.737) [-2158.111] (-2163.840) * (-2156.214) (-2167.400) (-2155.979) [-2155.116] -- 0:02:21 471500 -- [-2160.387] (-2159.340) (-2156.411) (-2155.207) * (-2160.473) (-2162.871) (-2157.601) [-2159.652] -- 0:02:21 472000 -- (-2160.174) (-2155.022) [-2156.286] (-2162.524) * (-2155.421) (-2164.503) (-2157.052) [-2156.299] -- 0:02:20 472500 -- (-2156.234) [-2155.976] (-2165.825) (-2156.025) * [-2153.791] (-2159.475) (-2157.092) (-2159.301) -- 0:02:21 473000 -- [-2156.039] (-2154.139) (-2153.906) (-2163.485) * [-2151.937] (-2157.167) (-2153.509) (-2159.446) -- 0:02:21 473500 -- (-2156.585) (-2158.941) [-2154.755] (-2175.231) * [-2150.278] (-2160.122) (-2159.540) (-2159.068) -- 0:02:21 474000 -- (-2159.282) (-2154.676) [-2159.702] (-2161.345) * (-2156.733) (-2158.887) [-2155.031] (-2165.734) -- 0:02:20 474500 -- (-2157.757) (-2159.820) [-2154.883] (-2161.663) * (-2156.204) (-2159.347) [-2152.081] (-2164.081) -- 0:02:20 475000 -- (-2156.035) (-2158.336) [-2153.387] (-2164.678) * (-2160.778) [-2157.372] (-2160.859) (-2157.462) -- 0:02:20 Average standard deviation of split frequencies: 0.005694 475500 -- (-2156.375) (-2152.881) [-2152.783] (-2156.172) * (-2159.790) (-2153.670) [-2160.002] (-2165.908) -- 0:02:20 476000 -- (-2155.712) (-2160.692) [-2151.748] (-2155.057) * (-2157.667) [-2155.103] (-2159.578) (-2157.675) -- 0:02:19 476500 -- (-2158.223) (-2160.188) [-2157.915] (-2154.204) * (-2158.049) (-2152.048) [-2152.942] (-2161.625) -- 0:02:20 477000 -- [-2156.246] (-2162.386) (-2156.249) (-2158.620) * [-2151.912] (-2158.741) (-2153.656) (-2155.094) -- 0:02:20 477500 -- [-2156.948] (-2158.046) (-2162.214) (-2162.141) * (-2158.180) (-2154.704) (-2149.059) [-2156.990] -- 0:02:20 478000 -- [-2154.770] (-2157.263) (-2156.106) (-2155.929) * (-2151.619) [-2154.303] (-2158.379) (-2160.799) -- 0:02:19 478500 -- (-2158.381) (-2157.516) (-2172.343) [-2155.584] * [-2160.064] (-2160.814) (-2162.985) (-2163.241) -- 0:02:19 479000 -- (-2152.993) (-2162.262) [-2156.611] (-2160.038) * (-2157.592) (-2157.793) [-2152.770] (-2158.360) -- 0:02:19 479500 -- (-2154.966) (-2158.108) [-2153.780] (-2161.073) * (-2162.550) (-2155.752) [-2153.987] (-2152.290) -- 0:02:18 480000 -- [-2156.958] (-2158.062) (-2160.037) (-2157.210) * (-2153.976) (-2157.118) [-2154.296] (-2156.544) -- 0:02:18 Average standard deviation of split frequencies: 0.005394 480500 -- (-2154.023) [-2154.516] (-2161.814) (-2160.856) * [-2159.837] (-2158.345) (-2156.771) (-2162.397) -- 0:02:19 481000 -- (-2155.219) [-2158.151] (-2163.849) (-2157.499) * [-2155.463] (-2152.517) (-2161.328) (-2159.591) -- 0:02:19 481500 -- (-2162.198) (-2157.112) (-2168.724) [-2155.575] * (-2162.557) (-2162.306) [-2155.068] (-2161.879) -- 0:02:18 482000 -- (-2163.587) (-2157.404) (-2155.136) [-2154.686] * (-2162.250) (-2162.330) [-2155.848] (-2164.764) -- 0:02:18 482500 -- (-2158.007) (-2157.894) [-2162.122] (-2153.104) * (-2154.898) (-2158.859) (-2157.493) [-2161.731] -- 0:02:18 483000 -- (-2153.447) (-2161.864) [-2156.530] (-2154.162) * [-2157.188] (-2156.437) (-2159.937) (-2165.203) -- 0:02:18 483500 -- (-2161.610) (-2170.062) (-2158.544) [-2158.686] * [-2161.176] (-2161.262) (-2155.665) (-2161.800) -- 0:02:17 484000 -- (-2160.134) (-2159.797) (-2156.696) [-2155.998] * (-2155.110) [-2159.127] (-2153.824) (-2170.061) -- 0:02:18 484500 -- (-2159.114) (-2160.870) [-2153.450] (-2153.202) * (-2157.937) (-2161.673) (-2160.773) [-2160.047] -- 0:02:18 485000 -- (-2154.010) (-2168.131) [-2154.210] (-2155.702) * (-2165.128) [-2153.923] (-2156.878) (-2163.355) -- 0:02:18 Average standard deviation of split frequencies: 0.005335 485500 -- (-2157.666) (-2152.966) (-2154.795) [-2157.032] * (-2160.520) [-2152.566] (-2156.437) (-2158.532) -- 0:02:17 486000 -- (-2157.274) [-2150.294] (-2158.029) (-2157.821) * (-2156.369) [-2152.530] (-2159.025) (-2168.343) -- 0:02:17 486500 -- (-2157.456) (-2155.171) [-2158.221] (-2156.690) * (-2154.571) [-2151.620] (-2163.948) (-2156.871) -- 0:02:17 487000 -- (-2156.546) [-2154.781] (-2155.118) (-2157.065) * (-2157.616) (-2156.287) [-2158.603] (-2157.406) -- 0:02:16 487500 -- (-2157.981) (-2165.017) [-2151.270] (-2162.169) * [-2155.318] (-2163.398) (-2161.529) (-2159.079) -- 0:02:16 488000 -- (-2163.940) (-2157.432) [-2154.377] (-2164.407) * [-2154.572] (-2159.567) (-2154.315) (-2160.520) -- 0:02:17 488500 -- (-2167.620) (-2159.593) [-2156.032] (-2153.844) * [-2158.885] (-2162.985) (-2149.901) (-2162.251) -- 0:02:17 489000 -- (-2162.986) (-2158.917) [-2158.893] (-2158.325) * (-2155.249) (-2160.029) [-2154.471] (-2162.504) -- 0:02:16 489500 -- (-2164.219) (-2156.987) [-2156.989] (-2163.803) * [-2152.922] (-2156.148) (-2160.758) (-2160.995) -- 0:02:16 490000 -- (-2155.386) [-2156.579] (-2155.754) (-2153.162) * [-2151.485] (-2161.706) (-2157.190) (-2153.557) -- 0:02:16 Average standard deviation of split frequencies: 0.005524 490500 -- (-2156.585) (-2152.338) [-2151.307] (-2152.906) * [-2155.982] (-2158.132) (-2159.626) (-2165.728) -- 0:02:16 491000 -- [-2158.933] (-2153.224) (-2163.784) (-2162.597) * (-2156.733) (-2166.407) [-2156.918] (-2160.813) -- 0:02:15 491500 -- [-2159.871] (-2157.115) (-2158.561) (-2163.952) * (-2158.518) (-2163.876) [-2155.277] (-2151.379) -- 0:02:16 492000 -- (-2162.782) (-2155.478) (-2156.028) [-2155.000] * (-2157.364) (-2160.970) (-2162.466) [-2157.950] -- 0:02:16 492500 -- (-2167.359) (-2156.691) [-2158.109] (-2162.510) * [-2157.770] (-2157.472) (-2155.344) (-2160.257) -- 0:02:16 493000 -- (-2165.547) (-2154.355) [-2155.581] (-2159.970) * (-2150.301) (-2162.372) [-2160.253] (-2157.597) -- 0:02:15 493500 -- (-2161.332) (-2152.967) [-2154.437] (-2158.035) * (-2156.319) [-2154.416] (-2158.708) (-2161.195) -- 0:02:15 494000 -- [-2159.344] (-2156.365) (-2162.261) (-2156.213) * [-2156.440] (-2169.327) (-2153.636) (-2155.180) -- 0:02:15 494500 -- [-2160.976] (-2158.624) (-2158.672) (-2154.499) * [-2152.516] (-2161.494) (-2158.658) (-2160.331) -- 0:02:14 495000 -- (-2160.456) [-2156.807] (-2155.689) (-2159.305) * [-2155.145] (-2154.975) (-2167.358) (-2159.702) -- 0:02:14 Average standard deviation of split frequencies: 0.005465 495500 -- (-2171.495) [-2161.457] (-2156.844) (-2160.016) * [-2157.411] (-2162.131) (-2160.737) (-2168.713) -- 0:02:15 496000 -- [-2152.938] (-2155.387) (-2155.414) (-2153.027) * [-2153.356] (-2159.028) (-2154.291) (-2157.080) -- 0:02:15 496500 -- (-2155.782) (-2160.055) (-2160.886) [-2156.796] * (-2153.743) (-2161.597) [-2154.523] (-2157.013) -- 0:02:14 497000 -- [-2153.499] (-2151.849) (-2159.847) (-2154.000) * [-2156.586] (-2155.273) (-2157.155) (-2154.029) -- 0:02:14 497500 -- [-2156.320] (-2152.537) (-2159.914) (-2152.916) * [-2157.583] (-2157.022) (-2152.308) (-2153.318) -- 0:02:14 498000 -- (-2158.280) (-2154.775) [-2152.398] (-2152.510) * [-2155.497] (-2157.880) (-2171.460) (-2159.347) -- 0:02:14 498500 -- (-2158.843) (-2156.533) [-2152.498] (-2160.244) * [-2151.538] (-2164.814) (-2153.606) (-2155.879) -- 0:02:13 499000 -- (-2157.495) (-2158.188) [-2156.476] (-2162.898) * (-2154.833) (-2160.294) (-2160.422) [-2155.978] -- 0:02:14 499500 -- (-2155.698) [-2152.910] (-2164.183) (-2158.830) * [-2154.515] (-2162.363) (-2164.360) (-2161.571) -- 0:02:14 500000 -- (-2160.211) [-2156.357] (-2149.345) (-2158.029) * (-2156.301) (-2158.722) (-2156.071) [-2160.724] -- 0:02:14 Average standard deviation of split frequencies: 0.005414 500500 -- (-2153.744) [-2154.295] (-2156.206) (-2162.149) * (-2161.512) (-2160.885) [-2160.859] (-2159.049) -- 0:02:13 501000 -- (-2155.270) (-2156.744) (-2161.388) [-2158.501] * (-2158.101) (-2153.224) [-2153.203] (-2154.077) -- 0:02:13 501500 -- (-2153.962) (-2159.308) (-2162.078) [-2155.565] * [-2161.009] (-2153.913) (-2154.895) (-2159.772) -- 0:02:13 502000 -- (-2161.331) (-2158.001) [-2156.806] (-2156.924) * [-2159.168] (-2157.304) (-2156.491) (-2153.585) -- 0:02:12 502500 -- (-2171.734) (-2158.769) (-2165.161) [-2156.561] * (-2157.856) [-2159.650] (-2158.389) (-2153.101) -- 0:02:12 503000 -- (-2157.467) (-2159.319) [-2158.222] (-2158.954) * (-2151.568) (-2156.325) [-2161.003] (-2152.058) -- 0:02:13 503500 -- (-2156.781) (-2159.808) [-2152.621] (-2165.451) * [-2159.631] (-2158.035) (-2159.116) (-2154.023) -- 0:02:13 504000 -- [-2152.633] (-2159.866) (-2159.056) (-2157.355) * (-2156.649) [-2151.261] (-2155.746) (-2159.880) -- 0:02:12 504500 -- [-2151.466] (-2157.428) (-2158.094) (-2159.144) * [-2155.585] (-2157.729) (-2155.170) (-2157.095) -- 0:02:12 505000 -- (-2155.425) (-2159.354) [-2153.236] (-2159.445) * (-2157.218) [-2152.681] (-2151.890) (-2159.281) -- 0:02:12 Average standard deviation of split frequencies: 0.005124 505500 -- (-2161.647) [-2155.472] (-2157.651) (-2158.316) * (-2155.758) (-2161.090) [-2160.375] (-2152.757) -- 0:02:12 506000 -- (-2160.327) (-2157.710) [-2159.005] (-2165.549) * (-2153.649) (-2162.275) (-2161.019) [-2159.593] -- 0:02:11 506500 -- (-2158.291) (-2155.863) [-2167.991] (-2159.972) * (-2163.588) (-2160.404) (-2153.283) [-2157.894] -- 0:02:12 507000 -- [-2148.826] (-2157.235) (-2165.909) (-2164.655) * (-2163.186) (-2157.139) (-2159.021) [-2157.057] -- 0:02:12 507500 -- [-2154.413] (-2160.178) (-2156.908) (-2161.941) * (-2158.797) [-2160.648] (-2151.937) (-2156.743) -- 0:02:11 508000 -- (-2156.474) (-2154.720) (-2157.953) [-2157.899] * (-2156.313) (-2157.588) [-2152.574] (-2153.715) -- 0:02:11 508500 -- (-2162.297) (-2152.224) [-2160.174] (-2164.903) * (-2158.665) [-2158.819] (-2151.747) (-2153.901) -- 0:02:11 509000 -- (-2159.780) (-2155.507) (-2160.384) [-2158.223] * (-2155.424) (-2155.618) [-2155.939] (-2157.053) -- 0:02:11 509500 -- [-2156.053] (-2160.759) (-2160.456) (-2155.703) * (-2162.042) [-2156.611] (-2162.779) (-2154.091) -- 0:02:10 510000 -- [-2157.965] (-2154.054) (-2153.223) (-2162.063) * [-2156.389] (-2170.695) (-2163.377) (-2159.074) -- 0:02:10 Average standard deviation of split frequencies: 0.005308 510500 -- (-2157.411) (-2155.174) (-2155.215) [-2157.728] * (-2163.702) [-2153.658] (-2156.028) (-2155.320) -- 0:02:11 511000 -- (-2154.630) (-2170.969) [-2153.559] (-2165.417) * (-2159.680) [-2154.558] (-2159.832) (-2154.977) -- 0:02:11 511500 -- (-2157.772) (-2164.624) (-2159.213) [-2156.743] * (-2152.618) (-2157.428) (-2164.298) [-2152.800] -- 0:02:10 512000 -- (-2159.610) (-2152.456) (-2161.130) [-2158.430] * (-2155.270) (-2154.250) [-2157.008] (-2157.466) -- 0:02:10 512500 -- [-2161.165] (-2161.358) (-2162.374) (-2149.880) * (-2155.997) [-2156.191] (-2159.590) (-2157.796) -- 0:02:10 513000 -- (-2153.727) [-2158.872] (-2163.774) (-2158.067) * (-2151.718) (-2152.664) (-2165.036) [-2159.494] -- 0:02:10 513500 -- (-2155.763) (-2161.119) (-2158.045) [-2167.134] * [-2155.102] (-2161.839) (-2159.312) (-2160.608) -- 0:02:09 514000 -- (-2153.914) [-2158.759] (-2169.639) (-2166.706) * (-2157.608) [-2153.774] (-2157.554) (-2154.739) -- 0:02:09 514500 -- [-2156.842] (-2152.150) (-2159.377) (-2160.934) * [-2155.887] (-2158.316) (-2154.290) (-2153.265) -- 0:02:10 515000 -- (-2160.755) (-2158.015) (-2157.348) [-2159.374] * (-2156.063) [-2157.806] (-2161.433) (-2160.465) -- 0:02:09 Average standard deviation of split frequencies: 0.005710 515500 -- [-2156.600] (-2159.313) (-2159.524) (-2155.016) * (-2155.259) (-2156.149) [-2160.675] (-2162.577) -- 0:02:09 516000 -- (-2160.243) (-2157.236) (-2155.138) [-2155.425] * (-2153.371) (-2155.763) [-2153.829] (-2164.851) -- 0:02:09 516500 -- (-2155.270) (-2153.837) [-2160.080] (-2160.531) * (-2160.471) [-2163.074] (-2157.371) (-2158.251) -- 0:02:09 517000 -- (-2156.813) (-2154.597) (-2158.907) [-2157.078] * (-2152.105) (-2152.789) [-2157.600] (-2160.819) -- 0:02:08 517500 -- (-2160.264) (-2159.709) (-2155.873) [-2156.552] * (-2161.062) (-2152.609) (-2160.785) [-2159.292] -- 0:02:08 518000 -- (-2155.199) (-2157.182) [-2157.377] (-2165.619) * [-2155.252] (-2158.545) (-2156.965) (-2164.246) -- 0:02:09 518500 -- (-2157.928) (-2159.902) [-2156.911] (-2154.260) * [-2154.403] (-2160.708) (-2167.630) (-2161.545) -- 0:02:09 519000 -- (-2155.843) (-2162.819) [-2166.218] (-2158.788) * [-2152.486] (-2160.729) (-2158.579) (-2159.970) -- 0:02:08 519500 -- (-2162.714) [-2156.748] (-2153.632) (-2158.860) * (-2156.019) (-2161.141) [-2158.877] (-2159.833) -- 0:02:08 520000 -- [-2154.375] (-2157.003) (-2168.372) (-2158.517) * (-2156.152) [-2156.752] (-2162.476) (-2161.050) -- 0:02:08 Average standard deviation of split frequencies: 0.005206 520500 -- (-2155.388) [-2155.998] (-2161.321) (-2158.988) * (-2158.353) [-2152.426] (-2157.242) (-2158.179) -- 0:02:08 521000 -- [-2161.311] (-2155.920) (-2165.620) (-2157.314) * (-2153.039) (-2161.171) (-2165.180) [-2157.165] -- 0:02:07 521500 -- (-2162.630) (-2159.354) (-2165.234) [-2159.596] * (-2157.056) (-2153.780) [-2157.789] (-2162.667) -- 0:02:07 522000 -- (-2161.448) (-2160.360) (-2157.053) [-2156.065] * (-2155.304) (-2153.433) (-2155.042) [-2158.724] -- 0:02:08 522500 -- (-2159.869) (-2155.186) [-2160.437] (-2166.032) * (-2161.738) (-2157.423) [-2156.448] (-2164.441) -- 0:02:07 523000 -- (-2158.418) (-2154.264) [-2157.512] (-2157.832) * (-2158.873) (-2157.565) (-2155.485) [-2159.810] -- 0:02:07 523500 -- (-2158.544) [-2158.751] (-2167.943) (-2153.133) * (-2157.795) [-2156.657] (-2152.602) (-2164.092) -- 0:02:07 524000 -- [-2164.547] (-2156.680) (-2160.546) (-2153.988) * [-2157.486] (-2156.893) (-2150.970) (-2162.649) -- 0:02:07 524500 -- (-2168.218) (-2156.600) (-2161.138) [-2163.481] * (-2163.600) (-2151.056) [-2157.850] (-2161.421) -- 0:02:06 525000 -- (-2164.424) [-2157.625] (-2154.513) (-2159.672) * (-2159.371) (-2159.184) [-2158.165] (-2159.950) -- 0:02:06 Average standard deviation of split frequencies: 0.004481 525500 -- (-2159.364) [-2155.967] (-2159.723) (-2159.719) * [-2159.167] (-2161.409) (-2154.852) (-2159.182) -- 0:02:06 526000 -- [-2155.046] (-2160.526) (-2157.405) (-2155.201) * (-2170.133) [-2159.394] (-2155.842) (-2155.516) -- 0:02:07 526500 -- (-2155.615) [-2160.467] (-2159.501) (-2153.643) * (-2161.434) (-2155.585) [-2152.788] (-2169.210) -- 0:02:06 527000 -- (-2160.585) [-2157.511] (-2158.292) (-2154.346) * (-2167.924) (-2155.721) [-2158.288] (-2163.199) -- 0:02:06 527500 -- (-2154.744) [-2156.779] (-2157.112) (-2159.692) * [-2161.551] (-2150.440) (-2159.466) (-2153.994) -- 0:02:06 528000 -- [-2153.174] (-2156.774) (-2155.698) (-2170.691) * (-2157.882) (-2162.689) [-2157.753] (-2156.809) -- 0:02:06 528500 -- (-2158.513) [-2152.848] (-2154.225) (-2160.229) * (-2156.259) (-2159.101) [-2158.090] (-2159.731) -- 0:02:05 529000 -- (-2154.689) [-2157.133] (-2157.163) (-2159.674) * (-2161.787) (-2164.997) [-2156.855] (-2163.437) -- 0:02:05 529500 -- (-2163.598) [-2163.271] (-2157.653) (-2162.867) * [-2159.523] (-2158.339) (-2155.458) (-2160.563) -- 0:02:06 530000 -- (-2158.134) (-2158.590) (-2158.783) [-2155.067] * [-2153.041] (-2157.695) (-2159.960) (-2160.478) -- 0:02:05 Average standard deviation of split frequencies: 0.004886 530500 -- (-2161.803) (-2156.390) [-2158.813] (-2151.962) * (-2156.349) [-2162.082] (-2159.742) (-2157.956) -- 0:02:05 531000 -- (-2164.197) [-2155.963] (-2157.943) (-2160.624) * (-2161.824) [-2160.408] (-2152.478) (-2152.841) -- 0:02:05 531500 -- (-2158.894) (-2155.361) [-2155.753] (-2160.025) * (-2162.806) (-2153.933) [-2152.375] (-2158.558) -- 0:02:05 532000 -- (-2159.205) [-2157.810] (-2161.240) (-2156.777) * (-2159.448) (-2160.967) [-2151.755] (-2154.159) -- 0:02:04 532500 -- (-2157.872) (-2159.638) (-2160.987) [-2157.413] * (-2153.217) (-2153.723) [-2153.504] (-2152.380) -- 0:02:04 533000 -- [-2158.481] (-2157.121) (-2155.741) (-2157.144) * [-2151.518] (-2155.015) (-2157.846) (-2158.627) -- 0:02:04 533500 -- [-2154.596] (-2159.230) (-2158.183) (-2158.954) * (-2159.971) (-2151.501) (-2153.098) [-2156.999] -- 0:02:05 534000 -- (-2157.814) [-2156.144] (-2153.849) (-2166.079) * [-2160.072] (-2151.312) (-2159.151) (-2159.741) -- 0:02:04 534500 -- (-2155.327) [-2155.202] (-2161.317) (-2160.766) * (-2152.631) (-2151.932) [-2156.793] (-2150.561) -- 0:02:04 535000 -- [-2152.632] (-2160.039) (-2154.606) (-2155.773) * (-2162.797) [-2153.067] (-2157.367) (-2157.923) -- 0:02:04 Average standard deviation of split frequencies: 0.006376 535500 -- (-2159.987) (-2162.223) [-2153.644] (-2160.366) * (-2165.399) (-2158.832) [-2153.529] (-2163.047) -- 0:02:04 536000 -- (-2162.425) (-2152.772) (-2161.996) [-2157.411] * (-2156.892) (-2154.909) [-2159.003] (-2160.521) -- 0:02:03 536500 -- (-2154.837) [-2154.003] (-2152.884) (-2150.959) * (-2171.826) (-2157.469) [-2155.374] (-2164.036) -- 0:02:03 537000 -- (-2156.038) [-2153.521] (-2158.927) (-2157.173) * (-2160.445) [-2160.836] (-2159.075) (-2159.189) -- 0:02:04 537500 -- (-2160.042) [-2155.613] (-2156.485) (-2157.704) * (-2159.615) (-2155.959) [-2152.106] (-2159.107) -- 0:02:03 538000 -- (-2167.475) (-2159.501) [-2155.292] (-2158.667) * (-2159.009) [-2151.435] (-2156.109) (-2161.285) -- 0:02:03 538500 -- (-2163.022) (-2163.795) (-2160.452) [-2161.627] * (-2154.004) [-2157.690] (-2156.112) (-2155.393) -- 0:02:03 539000 -- (-2155.584) (-2161.835) [-2159.766] (-2162.739) * (-2157.273) [-2156.769] (-2154.992) (-2161.518) -- 0:02:03 539500 -- (-2153.741) (-2158.459) [-2154.264] (-2162.659) * (-2157.527) (-2155.910) [-2158.850] (-2159.805) -- 0:02:02 540000 -- (-2158.414) [-2159.183] (-2163.079) (-2157.867) * (-2162.127) (-2161.042) [-2154.711] (-2156.842) -- 0:02:02 Average standard deviation of split frequencies: 0.005449 540500 -- (-2166.181) [-2155.826] (-2160.761) (-2153.708) * [-2155.122] (-2153.541) (-2152.798) (-2161.059) -- 0:02:02 541000 -- [-2153.676] (-2158.910) (-2153.521) (-2159.468) * (-2155.201) (-2154.192) [-2152.042] (-2159.563) -- 0:02:03 541500 -- (-2160.347) (-2158.851) (-2160.639) [-2155.908] * (-2153.017) (-2164.906) [-2155.611] (-2157.493) -- 0:02:02 542000 -- (-2156.748) (-2163.073) (-2166.346) [-2155.851] * (-2157.961) (-2158.065) [-2158.720] (-2162.109) -- 0:02:02 542500 -- (-2158.465) (-2155.715) (-2158.932) [-2154.551] * (-2168.634) (-2153.736) [-2156.571] (-2160.510) -- 0:02:02 543000 -- [-2159.156] (-2164.167) (-2157.970) (-2158.507) * [-2161.285] (-2156.105) (-2153.884) (-2162.479) -- 0:02:02 543500 -- (-2156.975) [-2157.490] (-2155.984) (-2166.521) * (-2156.483) (-2162.073) (-2160.628) [-2158.604] -- 0:02:01 544000 -- (-2156.953) [-2156.486] (-2151.849) (-2156.848) * (-2157.008) [-2151.337] (-2159.985) (-2153.895) -- 0:02:01 544500 -- (-2161.096) [-2158.077] (-2157.067) (-2159.129) * (-2155.994) [-2151.459] (-2157.980) (-2165.957) -- 0:02:01 545000 -- [-2158.816] (-2157.177) (-2157.754) (-2156.877) * (-2157.829) [-2152.040] (-2157.975) (-2163.036) -- 0:02:01 Average standard deviation of split frequencies: 0.004533 545500 -- (-2155.867) (-2156.350) (-2156.655) [-2156.678] * (-2160.558) [-2152.152] (-2155.049) (-2165.974) -- 0:02:01 546000 -- (-2154.928) (-2157.840) (-2158.822) [-2154.865] * [-2151.073] (-2160.883) (-2155.994) (-2166.152) -- 0:02:01 546500 -- (-2156.231) [-2155.979] (-2164.600) (-2160.893) * (-2154.986) (-2153.028) (-2164.761) [-2168.410] -- 0:02:01 547000 -- (-2160.573) (-2156.038) [-2161.696] (-2154.463) * (-2155.578) [-2152.621] (-2164.471) (-2163.625) -- 0:02:00 547500 -- [-2158.226] (-2155.067) (-2159.590) (-2159.725) * (-2150.081) [-2160.872] (-2160.851) (-2162.792) -- 0:02:00 548000 -- (-2156.248) [-2152.501] (-2154.214) (-2158.606) * (-2156.815) (-2159.928) [-2156.224] (-2156.960) -- 0:02:00 548500 -- (-2159.289) [-2153.771] (-2164.589) (-2152.862) * [-2153.237] (-2163.832) (-2162.343) (-2160.344) -- 0:02:01 549000 -- [-2153.855] (-2159.357) (-2165.465) (-2161.130) * [-2158.452] (-2159.257) (-2157.389) (-2157.309) -- 0:02:00 549500 -- (-2154.230) [-2158.317] (-2161.623) (-2165.510) * [-2155.219] (-2160.514) (-2161.187) (-2156.265) -- 0:02:00 550000 -- [-2156.586] (-2154.257) (-2160.157) (-2158.117) * (-2163.546) (-2156.828) (-2157.200) [-2156.657] -- 0:02:00 Average standard deviation of split frequencies: 0.005564 550500 -- (-2163.371) [-2154.444] (-2152.605) (-2162.006) * (-2157.473) (-2157.151) [-2159.606] (-2154.133) -- 0:02:00 551000 -- (-2157.631) (-2160.217) [-2153.243] (-2157.971) * [-2152.606] (-2169.072) (-2157.204) (-2159.177) -- 0:01:59 551500 -- (-2157.821) (-2157.789) (-2152.489) [-2151.190] * (-2161.977) (-2167.077) [-2153.160] (-2158.620) -- 0:01:59 552000 -- (-2155.125) (-2154.397) [-2154.195] (-2153.944) * [-2156.017] (-2163.683) (-2160.491) (-2157.774) -- 0:01:59 552500 -- (-2154.693) (-2156.039) [-2154.996] (-2165.334) * (-2164.028) (-2170.033) (-2155.164) [-2156.758] -- 0:01:59 553000 -- [-2156.218] (-2155.043) (-2156.448) (-2158.096) * (-2161.589) (-2159.733) [-2155.812] (-2162.810) -- 0:01:59 553500 -- [-2157.507] (-2155.142) (-2161.102) (-2155.893) * [-2153.350] (-2159.389) (-2159.309) (-2157.016) -- 0:01:59 554000 -- (-2159.168) (-2152.019) [-2170.356] (-2155.925) * (-2154.373) [-2160.967] (-2157.572) (-2153.471) -- 0:01:59 554500 -- (-2156.457) (-2152.400) (-2155.523) [-2158.043] * (-2154.660) [-2157.598] (-2152.515) (-2160.369) -- 0:01:58 555000 -- (-2154.982) [-2156.571] (-2166.339) (-2159.338) * (-2163.793) (-2161.434) [-2159.990] (-2166.293) -- 0:01:58 Average standard deviation of split frequencies: 0.005723 555500 -- (-2155.377) (-2153.489) (-2164.171) [-2156.258] * (-2160.787) [-2162.115] (-2157.179) (-2158.122) -- 0:01:58 556000 -- (-2159.913) (-2160.404) (-2158.718) [-2157.300] * (-2156.167) (-2153.123) [-2160.081] (-2158.735) -- 0:01:58 556500 -- [-2157.053] (-2162.963) (-2153.126) (-2150.023) * (-2167.778) (-2155.394) [-2153.957] (-2167.240) -- 0:01:58 557000 -- (-2155.882) [-2151.877] (-2158.116) (-2152.288) * (-2159.466) (-2156.279) [-2158.503] (-2169.282) -- 0:01:58 557500 -- (-2152.725) (-2158.331) (-2156.005) [-2158.792] * [-2160.481] (-2152.895) (-2166.157) (-2160.269) -- 0:01:58 558000 -- (-2156.302) (-2156.066) (-2156.649) [-2153.827] * (-2153.097) (-2152.234) (-2158.282) [-2156.203] -- 0:01:58 558500 -- (-2156.603) (-2155.199) (-2157.940) [-2154.161] * [-2153.355] (-2158.740) (-2164.697) (-2156.847) -- 0:01:57 559000 -- (-2161.615) (-2158.448) [-2158.517] (-2155.025) * [-2154.404] (-2157.599) (-2157.939) (-2155.227) -- 0:01:57 559500 -- (-2159.424) [-2155.865] (-2160.181) (-2157.591) * (-2158.753) (-2160.157) (-2157.077) [-2161.615] -- 0:01:57 560000 -- (-2160.077) [-2156.896] (-2163.979) (-2154.637) * (-2156.568) [-2154.450] (-2153.963) (-2165.727) -- 0:01:57 Average standard deviation of split frequencies: 0.007357 560500 -- (-2158.184) (-2155.487) [-2156.334] (-2159.117) * [-2153.847] (-2163.741) (-2154.915) (-2158.935) -- 0:01:57 561000 -- (-2156.470) (-2156.427) (-2163.854) [-2162.252] * (-2155.383) (-2157.837) (-2154.202) [-2156.622] -- 0:01:57 561500 -- (-2160.583) (-2155.176) [-2155.137] (-2159.457) * (-2159.409) (-2167.012) [-2152.226] (-2151.944) -- 0:01:57 562000 -- (-2154.267) [-2160.686] (-2151.843) (-2165.925) * [-2151.969] (-2157.026) (-2156.424) (-2157.933) -- 0:01:56 562500 -- [-2151.557] (-2159.660) (-2157.817) (-2156.535) * (-2158.875) [-2151.724] (-2153.915) (-2159.562) -- 0:01:56 563000 -- (-2157.617) (-2155.897) [-2154.695] (-2160.366) * (-2158.700) [-2159.183] (-2153.840) (-2154.190) -- 0:01:56 563500 -- (-2159.953) (-2154.317) [-2157.353] (-2168.178) * (-2155.833) [-2154.360] (-2162.912) (-2157.582) -- 0:01:56 564000 -- (-2160.635) (-2157.912) [-2160.586] (-2162.516) * (-2153.450) (-2160.842) (-2161.770) [-2154.637] -- 0:01:56 564500 -- [-2163.706] (-2156.502) (-2151.370) (-2159.084) * [-2158.456] (-2156.920) (-2156.365) (-2153.601) -- 0:01:56 565000 -- (-2171.261) [-2155.472] (-2153.147) (-2158.425) * (-2157.513) [-2153.484] (-2150.885) (-2156.572) -- 0:01:56 Average standard deviation of split frequencies: 0.006871 565500 -- (-2155.990) (-2152.040) [-2152.186] (-2160.209) * [-2154.296] (-2152.264) (-2155.867) (-2164.777) -- 0:01:56 566000 -- [-2160.648] (-2155.147) (-2152.451) (-2158.337) * (-2154.264) (-2161.187) (-2157.636) [-2158.214] -- 0:01:55 566500 -- [-2156.256] (-2160.282) (-2160.254) (-2157.725) * [-2150.681] (-2160.424) (-2158.666) (-2159.183) -- 0:01:55 567000 -- (-2157.364) (-2156.256) (-2160.471) [-2153.713] * [-2152.831] (-2153.085) (-2162.601) (-2155.477) -- 0:01:55 567500 -- [-2152.800] (-2154.486) (-2168.824) (-2159.061) * (-2151.433) (-2163.461) (-2164.409) [-2158.122] -- 0:01:55 568000 -- (-2154.439) [-2155.559] (-2162.039) (-2152.115) * [-2158.992] (-2155.983) (-2155.164) (-2161.180) -- 0:01:55 568500 -- [-2151.639] (-2160.963) (-2157.133) (-2155.114) * [-2158.043] (-2155.064) (-2160.973) (-2155.762) -- 0:01:55 569000 -- (-2159.753) (-2158.295) (-2154.597) [-2153.387] * (-2154.772) (-2160.607) [-2157.299] (-2164.823) -- 0:01:55 569500 -- (-2153.854) (-2154.536) (-2154.282) [-2153.289] * (-2154.273) (-2159.341) (-2157.336) [-2156.072] -- 0:01:54 570000 -- (-2155.289) [-2154.131] (-2163.541) (-2156.240) * (-2160.134) (-2162.276) (-2162.381) [-2155.604] -- 0:01:54 Average standard deviation of split frequencies: 0.006815 570500 -- (-2159.167) [-2159.483] (-2152.821) (-2154.510) * (-2154.734) [-2157.788] (-2159.602) (-2160.549) -- 0:01:54 571000 -- (-2153.285) [-2153.485] (-2155.016) (-2153.471) * (-2159.351) [-2159.701] (-2159.090) (-2158.426) -- 0:01:54 571500 -- [-2154.386] (-2156.905) (-2163.892) (-2158.239) * (-2152.585) (-2157.148) (-2158.201) [-2152.515] -- 0:01:54 572000 -- (-2155.279) (-2156.115) [-2159.829] (-2158.833) * (-2155.520) (-2161.037) (-2154.106) [-2153.007] -- 0:01:54 572500 -- (-2153.127) (-2164.481) (-2161.477) [-2155.517] * (-2166.399) (-2159.141) [-2156.624] (-2158.297) -- 0:01:54 573000 -- [-2160.433] (-2155.584) (-2163.788) (-2156.842) * (-2157.272) (-2151.261) (-2154.580) [-2156.261] -- 0:01:54 573500 -- (-2159.500) [-2151.103] (-2154.229) (-2153.177) * (-2163.568) (-2156.875) [-2155.507] (-2152.310) -- 0:01:53 574000 -- (-2157.033) [-2153.462] (-2152.119) (-2156.220) * (-2154.742) (-2156.742) (-2157.172) [-2152.214] -- 0:01:53 574500 -- [-2162.877] (-2157.114) (-2154.910) (-2157.297) * (-2156.480) (-2159.900) [-2156.481] (-2150.800) -- 0:01:53 575000 -- [-2161.003] (-2151.563) (-2154.607) (-2154.820) * [-2164.963] (-2153.793) (-2158.085) (-2155.037) -- 0:01:53 Average standard deviation of split frequencies: 0.005320 575500 -- (-2158.150) [-2154.645] (-2158.439) (-2158.528) * (-2153.739) [-2159.363] (-2171.394) (-2162.322) -- 0:01:53 576000 -- [-2159.445] (-2154.489) (-2153.022) (-2156.944) * [-2155.571] (-2158.786) (-2158.080) (-2157.505) -- 0:01:53 576500 -- (-2161.036) [-2156.892] (-2161.313) (-2161.247) * (-2152.598) (-2162.687) [-2155.826] (-2163.823) -- 0:01:53 577000 -- (-2154.313) [-2158.046] (-2161.949) (-2157.296) * (-2154.622) (-2154.262) [-2158.532] (-2156.920) -- 0:01:52 577500 -- (-2154.156) (-2153.419) (-2167.359) [-2157.812] * (-2160.794) [-2150.738] (-2154.408) (-2159.928) -- 0:01:52 578000 -- (-2171.371) (-2155.158) (-2162.645) [-2159.496] * (-2158.081) [-2157.624] (-2151.182) (-2159.650) -- 0:01:52 578500 -- (-2156.236) [-2157.900] (-2170.241) (-2159.694) * (-2160.079) (-2163.534) [-2156.261] (-2164.085) -- 0:01:52 579000 -- (-2160.039) (-2149.684) (-2162.916) [-2158.093] * (-2164.894) (-2168.550) [-2154.972] (-2159.936) -- 0:01:52 579500 -- (-2156.362) (-2156.679) (-2157.590) [-2152.842] * [-2169.442] (-2152.291) (-2158.398) (-2154.392) -- 0:01:52 580000 -- (-2155.184) (-2156.551) (-2158.342) [-2155.136] * [-2152.921] (-2157.775) (-2158.850) (-2157.164) -- 0:01:52 Average standard deviation of split frequencies: 0.005277 580500 -- (-2152.163) [-2159.928] (-2154.280) (-2153.543) * (-2156.457) (-2151.760) [-2153.662] (-2153.782) -- 0:01:52 581000 -- (-2154.736) (-2157.243) [-2157.025] (-2153.146) * (-2155.558) [-2151.003] (-2156.629) (-2158.453) -- 0:01:51 581500 -- (-2156.479) (-2155.537) [-2163.759] (-2156.316) * (-2163.360) [-2158.036] (-2158.533) (-2155.529) -- 0:01:51 582000 -- (-2158.332) (-2161.545) (-2160.186) [-2151.101] * (-2159.301) (-2160.086) (-2160.136) [-2156.330] -- 0:01:51 582500 -- (-2163.378) [-2156.572] (-2159.916) (-2152.325) * [-2159.698] (-2162.937) (-2169.418) (-2168.035) -- 0:01:51 583000 -- (-2156.126) (-2162.846) [-2160.450] (-2163.732) * (-2158.704) (-2153.804) (-2159.961) [-2159.635] -- 0:01:51 583500 -- (-2158.201) (-2155.736) (-2159.603) [-2159.366] * (-2156.356) [-2156.412] (-2162.990) (-2161.891) -- 0:01:51 584000 -- (-2161.180) (-2156.019) [-2156.648] (-2158.034) * (-2161.871) (-2160.286) (-2157.780) [-2153.665] -- 0:01:51 584500 -- (-2156.646) (-2158.295) (-2159.626) [-2154.186] * (-2156.648) (-2159.090) [-2157.720] (-2160.287) -- 0:01:50 585000 -- (-2154.227) [-2154.301] (-2152.868) (-2156.914) * (-2162.283) [-2154.001] (-2162.344) (-2156.556) -- 0:01:50 Average standard deviation of split frequencies: 0.005028 585500 -- (-2163.315) (-2157.362) (-2164.871) [-2159.265] * (-2159.308) [-2156.443] (-2158.339) (-2157.241) -- 0:01:50 586000 -- (-2163.244) (-2153.771) (-2161.161) [-2161.463] * (-2157.087) [-2162.880] (-2166.267) (-2160.627) -- 0:01:50 586500 -- (-2160.038) [-2153.973] (-2165.431) (-2169.593) * (-2157.010) (-2164.863) (-2153.831) [-2160.608] -- 0:01:50 587000 -- [-2158.822] (-2152.507) (-2161.161) (-2168.583) * [-2149.662] (-2157.317) (-2155.934) (-2157.028) -- 0:01:50 587500 -- (-2163.444) [-2158.850] (-2166.614) (-2168.937) * (-2153.085) (-2155.715) (-2157.755) [-2155.219] -- 0:01:50 588000 -- (-2157.242) (-2156.061) [-2159.669] (-2154.111) * (-2154.164) (-2156.611) (-2155.239) [-2156.754] -- 0:01:50 588500 -- (-2158.810) (-2161.975) [-2155.887] (-2151.592) * (-2167.150) [-2154.283] (-2158.498) (-2160.450) -- 0:01:49 589000 -- [-2156.528] (-2155.882) (-2158.222) (-2159.031) * (-2156.451) [-2158.222] (-2152.444) (-2156.276) -- 0:01:49 589500 -- (-2163.878) (-2157.237) (-2154.167) [-2157.954] * (-2152.578) (-2163.606) (-2159.299) [-2156.339] -- 0:01:49 590000 -- (-2153.038) (-2160.966) [-2157.004] (-2162.168) * (-2162.595) [-2158.393] (-2152.516) (-2159.602) -- 0:01:49 Average standard deviation of split frequencies: 0.004589 590500 -- (-2160.008) (-2152.818) (-2155.199) [-2156.001] * (-2154.684) (-2152.505) [-2154.114] (-2160.167) -- 0:01:49 591000 -- (-2161.195) (-2156.088) [-2151.435] (-2158.433) * [-2151.646] (-2154.096) (-2158.875) (-2164.874) -- 0:01:49 591500 -- (-2161.615) (-2161.855) (-2151.118) [-2156.204] * (-2153.266) (-2162.496) [-2152.609] (-2164.780) -- 0:01:49 592000 -- (-2160.179) (-2157.167) (-2166.053) [-2151.740] * (-2156.174) (-2155.920) (-2156.386) [-2159.432] -- 0:01:48 592500 -- (-2158.377) [-2153.536] (-2155.175) (-2151.705) * (-2155.043) (-2159.853) (-2158.225) [-2155.897] -- 0:01:48 593000 -- (-2157.573) (-2152.161) (-2157.317) [-2148.721] * [-2157.650] (-2159.378) (-2165.696) (-2156.551) -- 0:01:48 593500 -- (-2156.857) [-2154.045] (-2154.697) (-2156.921) * [-2154.782] (-2156.817) (-2154.241) (-2153.620) -- 0:01:48 594000 -- (-2156.131) (-2153.217) (-2159.487) [-2163.342] * (-2156.262) (-2151.850) (-2158.887) [-2154.950] -- 0:01:48 594500 -- (-2168.946) (-2156.473) (-2157.217) [-2155.505] * (-2155.420) [-2152.535] (-2157.526) (-2168.202) -- 0:01:48 595000 -- (-2165.158) [-2157.080] (-2162.792) (-2155.334) * [-2152.247] (-2156.390) (-2151.182) (-2162.504) -- 0:01:48 Average standard deviation of split frequencies: 0.004350 595500 -- (-2162.060) (-2156.996) [-2154.612] (-2163.157) * [-2156.913] (-2156.466) (-2160.043) (-2157.961) -- 0:01:48 596000 -- (-2170.407) [-2161.216] (-2171.620) (-2152.944) * (-2156.056) [-2157.349] (-2154.142) (-2160.596) -- 0:01:47 596500 -- (-2166.886) (-2161.007) [-2158.645] (-2152.379) * [-2166.510] (-2158.134) (-2154.401) (-2155.692) -- 0:01:47 597000 -- (-2160.914) (-2157.043) (-2155.365) [-2156.099] * [-2157.018] (-2152.270) (-2157.055) (-2153.246) -- 0:01:47 597500 -- (-2162.805) (-2165.175) (-2159.890) [-2152.692] * (-2166.113) (-2155.254) [-2164.860] (-2169.479) -- 0:01:47 598000 -- [-2153.390] (-2156.394) (-2156.029) (-2154.590) * (-2160.271) (-2156.469) [-2158.536] (-2158.978) -- 0:01:47 598500 -- (-2158.817) [-2155.576] (-2158.169) (-2154.102) * [-2156.366] (-2159.183) (-2156.919) (-2165.835) -- 0:01:47 599000 -- (-2154.067) [-2153.311] (-2159.997) (-2152.960) * (-2157.517) [-2159.363] (-2169.945) (-2163.371) -- 0:01:47 599500 -- [-2163.585] (-2155.769) (-2154.917) (-2163.770) * [-2160.316] (-2158.329) (-2157.461) (-2157.011) -- 0:01:46 600000 -- [-2158.766] (-2152.934) (-2159.731) (-2158.667) * [-2156.255] (-2158.676) (-2156.682) (-2159.289) -- 0:01:46 Average standard deviation of split frequencies: 0.005101 600500 -- (-2159.256) (-2159.448) [-2153.246] (-2154.561) * [-2160.247] (-2158.641) (-2159.362) (-2151.917) -- 0:01:46 601000 -- [-2156.532] (-2154.384) (-2156.476) (-2159.729) * (-2157.131) (-2154.671) [-2158.391] (-2154.603) -- 0:01:46 601500 -- [-2162.110] (-2156.797) (-2158.258) (-2152.451) * (-2153.497) (-2159.720) [-2158.945] (-2154.695) -- 0:01:46 602000 -- (-2160.987) (-2168.149) (-2167.532) [-2152.913] * (-2154.254) [-2161.502] (-2154.219) (-2156.330) -- 0:01:46 602500 -- [-2158.594] (-2159.317) (-2156.702) (-2157.232) * (-2155.159) [-2163.875] (-2153.024) (-2153.358) -- 0:01:46 603000 -- (-2157.196) (-2161.409) (-2154.409) [-2158.046] * [-2150.257] (-2169.672) (-2156.454) (-2161.204) -- 0:01:45 603500 -- (-2159.611) (-2172.255) [-2154.127] (-2157.637) * (-2160.092) [-2152.701] (-2153.458) (-2161.876) -- 0:01:45 604000 -- (-2161.740) (-2162.440) [-2152.242] (-2155.945) * [-2161.029] (-2168.378) (-2151.421) (-2166.063) -- 0:01:45 604500 -- (-2157.430) [-2158.987] (-2155.660) (-2155.769) * [-2160.209] (-2157.086) (-2149.999) (-2166.005) -- 0:01:45 605000 -- [-2157.308] (-2157.135) (-2158.835) (-2153.212) * (-2160.212) (-2160.892) [-2154.746] (-2159.716) -- 0:01:45 Average standard deviation of split frequencies: 0.004862 605500 -- (-2157.448) [-2161.225] (-2158.073) (-2167.635) * (-2160.740) [-2158.586] (-2157.991) (-2167.422) -- 0:01:45 606000 -- (-2152.547) (-2161.780) (-2159.725) [-2154.987] * [-2158.688] (-2164.208) (-2158.217) (-2158.923) -- 0:01:45 606500 -- (-2159.397) (-2155.554) (-2158.464) [-2157.515] * (-2161.296) (-2160.236) [-2152.585] (-2165.207) -- 0:01:45 607000 -- [-2155.780] (-2154.246) (-2166.159) (-2158.030) * (-2163.202) (-2160.391) [-2153.937] (-2160.310) -- 0:01:44 607500 -- [-2154.702] (-2156.957) (-2151.504) (-2159.107) * (-2166.087) (-2158.820) [-2152.774] (-2156.682) -- 0:01:44 608000 -- (-2157.306) [-2159.522] (-2155.141) (-2155.296) * (-2167.696) (-2164.143) [-2158.866] (-2164.558) -- 0:01:44 608500 -- [-2159.654] (-2159.745) (-2158.324) (-2157.982) * (-2157.484) (-2157.823) (-2152.276) [-2160.738] -- 0:01:44 609000 -- (-2154.016) (-2156.114) [-2150.117] (-2163.998) * (-2151.742) (-2153.133) [-2151.746] (-2162.765) -- 0:01:44 609500 -- (-2161.791) [-2156.359] (-2159.312) (-2157.930) * (-2154.987) [-2152.610] (-2157.992) (-2159.976) -- 0:01:44 610000 -- (-2158.154) (-2162.743) (-2154.830) [-2158.809] * (-2158.582) [-2154.583] (-2157.348) (-2155.418) -- 0:01:44 Average standard deviation of split frequencies: 0.005597 610500 -- (-2155.715) (-2156.719) (-2160.760) [-2157.611] * (-2156.059) (-2155.845) (-2154.143) [-2156.875] -- 0:01:43 611000 -- (-2155.402) (-2157.802) (-2154.674) [-2153.571] * (-2152.947) (-2152.954) [-2157.310] (-2154.825) -- 0:01:43 611500 -- (-2157.705) (-2156.941) (-2152.067) [-2158.229] * (-2159.524) [-2153.027] (-2162.753) (-2160.453) -- 0:01:43 612000 -- (-2160.036) (-2165.837) [-2150.369] (-2162.626) * [-2158.725] (-2153.107) (-2156.049) (-2150.854) -- 0:01:43 612500 -- [-2152.177] (-2159.974) (-2165.189) (-2154.108) * (-2157.696) [-2154.858] (-2156.204) (-2157.497) -- 0:01:43 613000 -- [-2155.883] (-2163.688) (-2152.093) (-2153.638) * [-2158.717] (-2159.404) (-2157.407) (-2151.796) -- 0:01:43 613500 -- (-2166.597) (-2160.868) (-2159.719) [-2155.468] * (-2158.013) (-2156.462) [-2153.709] (-2159.522) -- 0:01:43 614000 -- [-2154.069] (-2154.645) (-2155.983) (-2158.515) * [-2153.140] (-2153.980) (-2160.583) (-2159.882) -- 0:01:43 614500 -- (-2153.560) [-2157.359] (-2165.366) (-2155.610) * (-2161.869) (-2155.325) (-2162.103) [-2154.994] -- 0:01:42 615000 -- [-2160.750] (-2154.047) (-2158.473) (-2157.373) * (-2157.082) (-2160.391) [-2152.286] (-2163.354) -- 0:01:42 Average standard deviation of split frequencies: 0.007079 615500 -- (-2154.777) [-2155.706] (-2160.270) (-2158.608) * [-2159.412] (-2158.043) (-2156.783) (-2157.464) -- 0:01:42 616000 -- (-2154.960) [-2151.842] (-2160.618) (-2158.668) * [-2160.939] (-2153.509) (-2156.412) (-2154.845) -- 0:01:42 616500 -- (-2159.233) [-2154.701] (-2155.431) (-2154.197) * [-2157.720] (-2161.261) (-2156.725) (-2153.693) -- 0:01:42 617000 -- [-2154.769] (-2159.948) (-2160.003) (-2166.104) * (-2165.030) [-2159.092] (-2155.603) (-2159.567) -- 0:01:42 617500 -- [-2151.314] (-2157.330) (-2161.838) (-2157.478) * [-2160.337] (-2165.551) (-2154.148) (-2159.877) -- 0:01:42 618000 -- (-2162.386) (-2163.023) (-2159.112) [-2159.535] * (-2155.786) (-2162.099) (-2155.708) [-2157.012] -- 0:01:41 618500 -- (-2160.955) [-2157.513] (-2153.845) (-2164.501) * [-2153.741] (-2158.557) (-2158.552) (-2153.091) -- 0:01:41 619000 -- (-2162.663) (-2163.018) (-2160.153) [-2156.642] * (-2160.309) (-2153.665) (-2163.235) [-2157.101] -- 0:01:41 619500 -- [-2155.516] (-2151.726) (-2160.938) (-2157.113) * [-2153.179] (-2156.383) (-2156.512) (-2159.126) -- 0:01:41 620000 -- [-2157.458] (-2161.660) (-2158.001) (-2152.552) * (-2161.747) (-2161.745) [-2156.683] (-2156.662) -- 0:01:41 Average standard deviation of split frequencies: 0.007025 620500 -- (-2158.000) (-2156.507) (-2163.508) [-2156.676] * [-2154.030] (-2156.965) (-2159.671) (-2157.833) -- 0:01:41 621000 -- (-2154.358) (-2158.841) [-2155.541] (-2153.141) * [-2152.438] (-2152.203) (-2160.539) (-2157.342) -- 0:01:41 621500 -- (-2159.329) [-2153.340] (-2158.862) (-2157.803) * [-2156.781] (-2154.676) (-2156.690) (-2162.604) -- 0:01:41 622000 -- (-2157.929) [-2154.044] (-2159.969) (-2160.895) * (-2163.070) (-2156.902) (-2155.377) [-2154.089] -- 0:01:40 622500 -- (-2159.354) (-2158.642) (-2155.975) [-2153.274] * (-2157.656) (-2160.291) (-2158.038) [-2158.054] -- 0:01:40 623000 -- (-2156.479) (-2164.134) [-2160.690] (-2152.926) * (-2163.775) (-2160.054) (-2155.983) [-2162.355] -- 0:01:40 623500 -- (-2156.120) (-2168.567) [-2157.888] (-2163.397) * [-2152.963] (-2161.781) (-2157.208) (-2159.625) -- 0:01:40 624000 -- (-2157.732) (-2161.338) [-2159.397] (-2152.506) * (-2154.884) (-2158.430) (-2158.435) [-2155.945] -- 0:01:40 624500 -- (-2154.309) (-2173.460) [-2156.066] (-2156.678) * [-2155.736] (-2159.715) (-2151.977) (-2159.280) -- 0:01:40 625000 -- (-2152.153) (-2163.239) [-2154.961] (-2157.710) * [-2158.981] (-2155.607) (-2159.949) (-2155.337) -- 0:01:40 Average standard deviation of split frequencies: 0.007342 625500 -- (-2162.248) (-2159.147) (-2164.668) [-2154.258] * [-2156.643] (-2153.435) (-2153.033) (-2155.103) -- 0:01:39 626000 -- (-2154.926) (-2154.028) (-2164.494) [-2154.751] * [-2157.990] (-2154.279) (-2153.341) (-2159.438) -- 0:01:39 626500 -- (-2151.911) [-2157.498] (-2161.226) (-2163.393) * (-2159.368) [-2153.738] (-2154.027) (-2163.513) -- 0:01:39 627000 -- [-2151.959] (-2159.830) (-2161.629) (-2154.191) * [-2155.334] (-2161.632) (-2157.026) (-2167.390) -- 0:01:39 627500 -- [-2152.678] (-2155.333) (-2159.701) (-2154.854) * [-2156.134] (-2149.662) (-2154.961) (-2168.914) -- 0:01:39 628000 -- (-2164.494) (-2155.300) (-2162.241) [-2151.131] * (-2153.689) [-2150.779] (-2161.153) (-2166.321) -- 0:01:39 628500 -- (-2158.121) (-2152.272) [-2160.456] (-2155.344) * [-2154.715] (-2161.033) (-2163.781) (-2162.181) -- 0:01:39 629000 -- [-2153.735] (-2164.407) (-2163.606) (-2157.315) * (-2154.820) (-2155.513) [-2158.539] (-2168.694) -- 0:01:39 629500 -- [-2158.855] (-2155.206) (-2161.381) (-2155.847) * (-2154.232) [-2153.180] (-2153.953) (-2168.070) -- 0:01:38 630000 -- (-2155.199) (-2154.770) (-2164.243) [-2152.675] * (-2158.870) [-2153.673] (-2157.511) (-2157.913) -- 0:01:38 Average standard deviation of split frequencies: 0.008035 630500 -- [-2154.224] (-2158.682) (-2152.066) (-2152.731) * (-2159.307) (-2156.767) (-2157.351) [-2156.819] -- 0:01:38 631000 -- (-2161.807) (-2162.889) [-2151.776] (-2152.561) * [-2153.254] (-2157.763) (-2161.037) (-2157.135) -- 0:01:38 631500 -- [-2155.589] (-2158.676) (-2149.917) (-2156.425) * (-2162.583) (-2157.251) [-2153.328] (-2156.940) -- 0:01:38 632000 -- (-2159.218) [-2153.652] (-2153.467) (-2152.459) * (-2155.607) (-2159.068) [-2158.889] (-2158.443) -- 0:01:38 632500 -- (-2159.357) [-2152.222] (-2156.876) (-2155.872) * (-2159.157) [-2154.837] (-2156.579) (-2158.014) -- 0:01:38 633000 -- (-2158.013) (-2154.371) (-2154.651) [-2155.671] * [-2155.181] (-2162.141) (-2156.500) (-2152.032) -- 0:01:37 633500 -- (-2156.996) [-2155.425] (-2164.943) (-2151.862) * (-2163.736) (-2154.929) (-2160.937) [-2160.738] -- 0:01:37 634000 -- (-2157.760) (-2156.131) [-2156.764] (-2159.909) * (-2158.203) (-2152.463) [-2155.375] (-2157.224) -- 0:01:37 634500 -- (-2156.015) [-2154.961] (-2155.456) (-2155.450) * (-2160.496) [-2155.257] (-2159.758) (-2161.269) -- 0:01:37 635000 -- (-2153.006) (-2157.944) [-2154.488] (-2155.984) * (-2160.288) (-2159.513) (-2171.347) [-2164.310] -- 0:01:37 Average standard deviation of split frequencies: 0.006671 635500 -- [-2156.082] (-2162.143) (-2151.413) (-2157.333) * (-2153.548) [-2156.189] (-2159.697) (-2159.743) -- 0:01:37 636000 -- [-2153.456] (-2152.044) (-2155.806) (-2154.859) * [-2159.930] (-2163.241) (-2157.243) (-2155.175) -- 0:01:37 636500 -- (-2156.507) (-2154.797) (-2152.661) [-2155.473] * (-2161.486) (-2155.691) (-2161.194) [-2157.132] -- 0:01:37 637000 -- (-2166.389) [-2153.485] (-2153.500) (-2159.951) * (-2153.578) (-2159.352) [-2159.466] (-2153.399) -- 0:01:36 637500 -- [-2159.770] (-2153.888) (-2156.434) (-2153.105) * (-2158.567) [-2160.051] (-2155.849) (-2154.155) -- 0:01:36 638000 -- (-2160.902) [-2159.942] (-2158.837) (-2157.119) * (-2158.404) (-2164.759) (-2158.415) [-2156.406] -- 0:01:36 638500 -- (-2163.737) (-2161.349) [-2157.214] (-2154.731) * [-2155.086] (-2160.052) (-2155.416) (-2168.506) -- 0:01:36 639000 -- (-2163.481) (-2152.289) (-2166.074) [-2153.860] * (-2153.352) (-2162.275) (-2164.285) [-2157.001] -- 0:01:36 639500 -- (-2157.697) (-2162.400) (-2158.981) [-2158.634] * (-2152.982) (-2165.237) [-2158.948] (-2157.802) -- 0:01:36 640000 -- [-2151.151] (-2162.203) (-2169.800) (-2162.894) * (-2158.435) (-2167.203) (-2155.090) [-2151.955] -- 0:01:36 Average standard deviation of split frequencies: 0.005151 640500 -- (-2154.210) (-2160.337) (-2162.079) [-2158.981] * (-2157.582) (-2157.331) (-2161.393) [-2157.290] -- 0:01:35 641000 -- (-2154.319) (-2159.268) [-2155.865] (-2157.596) * (-2154.857) (-2159.694) (-2163.637) [-2154.608] -- 0:01:35 641500 -- (-2154.394) (-2159.196) [-2155.898] (-2158.829) * (-2160.509) (-2165.934) [-2157.933] (-2155.929) -- 0:01:35 642000 -- [-2158.611] (-2167.705) (-2153.513) (-2155.736) * (-2158.857) (-2163.588) [-2154.070] (-2153.275) -- 0:01:35 642500 -- (-2158.261) (-2159.227) (-2161.201) [-2159.706] * (-2160.544) (-2164.132) [-2155.792] (-2168.187) -- 0:01:35 643000 -- (-2161.831) (-2159.563) (-2159.278) [-2154.224] * (-2157.953) (-2165.919) [-2154.568] (-2162.454) -- 0:01:35 643500 -- (-2160.125) [-2154.508] (-2160.185) (-2154.099) * (-2152.890) (-2158.133) (-2154.745) [-2159.205] -- 0:01:35 644000 -- [-2154.922] (-2156.477) (-2157.115) (-2156.649) * (-2155.832) (-2158.868) [-2152.776] (-2154.163) -- 0:01:35 644500 -- (-2159.238) (-2162.266) [-2160.212] (-2155.411) * (-2159.398) [-2157.753] (-2153.460) (-2157.640) -- 0:01:34 645000 -- (-2153.594) [-2164.412] (-2159.305) (-2163.188) * (-2159.745) [-2157.011] (-2157.129) (-2157.988) -- 0:01:34 Average standard deviation of split frequencies: 0.005655 645500 -- (-2158.916) (-2159.853) (-2159.706) [-2158.779] * (-2167.891) [-2154.506] (-2154.610) (-2156.471) -- 0:01:34 646000 -- (-2159.150) (-2163.301) [-2162.044] (-2157.911) * (-2157.244) [-2156.789] (-2150.209) (-2158.631) -- 0:01:34 646500 -- (-2156.453) [-2162.370] (-2162.389) (-2157.617) * (-2160.320) (-2157.332) (-2158.614) [-2157.130] -- 0:01:34 647000 -- (-2159.578) (-2159.037) (-2151.307) [-2159.010] * (-2153.862) (-2157.335) (-2159.336) [-2152.364] -- 0:01:34 647500 -- (-2163.781) (-2156.677) [-2155.799] (-2164.784) * (-2154.390) [-2152.981] (-2154.483) (-2158.947) -- 0:01:34 648000 -- [-2154.762] (-2162.723) (-2163.058) (-2160.130) * (-2161.080) (-2157.469) (-2158.286) [-2156.423] -- 0:01:33 648500 -- (-2154.195) (-2163.351) (-2158.488) [-2158.956] * (-2153.908) (-2154.630) (-2153.008) [-2157.128] -- 0:01:33 649000 -- (-2151.719) (-2155.780) [-2159.911] (-2154.871) * (-2153.787) (-2161.701) (-2158.237) [-2156.810] -- 0:01:33 649500 -- [-2152.273] (-2155.352) (-2156.927) (-2155.273) * [-2153.515] (-2157.058) (-2155.669) (-2168.777) -- 0:01:33 650000 -- (-2160.250) (-2154.183) (-2156.839) [-2159.334] * [-2155.967] (-2157.606) (-2157.413) (-2156.914) -- 0:01:33 Average standard deviation of split frequencies: 0.004347 650500 -- (-2156.658) (-2164.865) [-2157.934] (-2157.867) * (-2160.292) [-2156.191] (-2162.910) (-2157.839) -- 0:01:33 651000 -- (-2152.147) (-2156.235) [-2153.613] (-2159.380) * (-2157.433) (-2162.806) (-2161.791) [-2153.227] -- 0:01:33 651500 -- (-2156.604) [-2154.698] (-2157.188) (-2159.315) * (-2155.848) (-2159.431) [-2158.334] (-2159.352) -- 0:01:33 652000 -- (-2152.062) (-2156.321) [-2156.946] (-2156.845) * (-2160.018) (-2164.023) [-2155.839] (-2157.481) -- 0:01:32 652500 -- (-2149.362) (-2154.934) [-2153.837] (-2158.188) * (-2165.097) (-2155.222) (-2158.298) [-2156.545] -- 0:01:32 653000 -- (-2159.425) [-2160.618] (-2161.024) (-2157.889) * (-2158.894) (-2161.498) [-2154.475] (-2156.515) -- 0:01:32 653500 -- (-2159.666) [-2159.924] (-2156.497) (-2162.041) * (-2158.779) (-2163.213) [-2163.106] (-2160.762) -- 0:01:32 654000 -- [-2154.624] (-2158.021) (-2156.558) (-2160.271) * [-2163.503] (-2164.216) (-2151.004) (-2160.209) -- 0:01:32 654500 -- (-2159.691) (-2154.082) [-2161.114] (-2158.427) * (-2159.147) [-2155.373] (-2155.359) (-2151.014) -- 0:01:32 655000 -- [-2158.296] (-2157.318) (-2154.125) (-2160.289) * (-2163.560) (-2153.016) [-2153.001] (-2156.414) -- 0:01:32 Average standard deviation of split frequencies: 0.004132 655500 -- (-2154.837) (-2157.195) [-2153.272] (-2163.826) * (-2159.905) (-2158.389) (-2154.019) [-2155.149] -- 0:01:31 656000 -- [-2161.403] (-2156.756) (-2160.514) (-2154.594) * [-2154.759] (-2156.959) (-2150.902) (-2160.454) -- 0:01:31 656500 -- (-2157.287) (-2158.886) (-2160.561) [-2156.632] * (-2152.724) [-2162.691] (-2160.338) (-2169.821) -- 0:01:31 657000 -- [-2155.498] (-2157.446) (-2158.321) (-2162.094) * (-2155.450) (-2159.905) (-2153.580) [-2161.075] -- 0:01:31 657500 -- (-2158.159) (-2161.668) [-2158.197] (-2152.090) * (-2159.511) (-2159.486) (-2158.257) [-2155.774] -- 0:01:31 658000 -- (-2156.736) (-2156.193) (-2155.090) [-2151.906] * (-2159.434) (-2155.986) [-2158.074] (-2151.781) -- 0:01:31 658500 -- [-2152.626] (-2153.799) (-2160.339) (-2153.225) * (-2166.366) (-2162.366) (-2154.690) [-2154.173] -- 0:01:31 659000 -- [-2154.872] (-2161.600) (-2160.060) (-2159.861) * [-2159.004] (-2160.733) (-2164.439) (-2157.306) -- 0:01:31 659500 -- [-2155.955] (-2158.165) (-2160.274) (-2157.370) * (-2156.319) [-2160.578] (-2166.154) (-2155.921) -- 0:01:30 660000 -- [-2159.909] (-2160.915) (-2160.687) (-2157.495) * (-2161.861) [-2161.731] (-2155.643) (-2161.516) -- 0:01:30 Average standard deviation of split frequencies: 0.004281 660500 -- (-2166.673) (-2163.215) (-2158.238) [-2153.065] * [-2157.117] (-2162.733) (-2160.831) (-2162.094) -- 0:01:30 661000 -- [-2169.460] (-2152.409) (-2165.128) (-2153.857) * (-2162.024) (-2160.074) [-2152.216] (-2158.223) -- 0:01:30 661500 -- [-2156.696] (-2157.915) (-2153.031) (-2154.259) * [-2157.358] (-2155.449) (-2159.536) (-2157.282) -- 0:01:30 662000 -- [-2163.496] (-2159.442) (-2159.361) (-2156.524) * [-2163.291] (-2157.835) (-2153.610) (-2162.261) -- 0:01:30 662500 -- (-2155.525) (-2161.599) [-2160.894] (-2156.097) * (-2165.045) (-2156.327) (-2159.085) [-2155.073] -- 0:01:30 663000 -- [-2154.281] (-2162.889) (-2159.298) (-2152.561) * (-2159.387) [-2161.977] (-2159.728) (-2163.248) -- 0:01:29 663500 -- (-2154.517) [-2152.861] (-2158.032) (-2164.193) * (-2157.765) (-2158.743) [-2156.448] (-2160.846) -- 0:01:29 664000 -- (-2156.223) [-2152.424] (-2159.497) (-2158.458) * (-2155.441) (-2155.146) (-2155.585) [-2154.319] -- 0:01:29 664500 -- [-2154.172] (-2155.966) (-2151.647) (-2155.086) * (-2161.761) [-2155.054] (-2157.746) (-2163.616) -- 0:01:29 665000 -- [-2154.746] (-2156.528) (-2154.235) (-2156.873) * (-2160.195) (-2162.281) [-2159.132] (-2158.594) -- 0:01:29 Average standard deviation of split frequencies: 0.004247 665500 -- (-2163.943) (-2156.947) (-2152.074) [-2158.277] * (-2151.337) (-2154.656) (-2158.102) [-2158.359] -- 0:01:28 666000 -- (-2154.561) [-2156.357] (-2155.551) (-2155.530) * (-2157.501) (-2161.221) (-2154.442) [-2155.807] -- 0:01:29 666500 -- [-2154.434] (-2154.233) (-2159.300) (-2155.993) * (-2156.925) [-2155.522] (-2156.510) (-2158.135) -- 0:01:29 667000 -- (-2160.198) (-2154.347) [-2154.670] (-2151.344) * [-2154.494] (-2156.284) (-2161.774) (-2156.149) -- 0:01:28 667500 -- [-2151.797] (-2165.564) (-2159.262) (-2162.156) * [-2153.802] (-2156.157) (-2155.459) (-2151.314) -- 0:01:28 668000 -- [-2151.863] (-2165.178) (-2157.350) (-2156.380) * (-2154.775) (-2157.596) [-2161.938] (-2163.459) -- 0:01:28 668500 -- (-2161.063) (-2159.345) (-2154.409) [-2154.045] * (-2155.295) (-2156.093) (-2160.477) [-2157.340] -- 0:01:28 669000 -- (-2159.154) (-2155.531) [-2158.573] (-2156.721) * (-2156.101) (-2161.585) [-2153.770] (-2162.938) -- 0:01:28 669500 -- (-2154.314) (-2156.788) (-2157.250) [-2155.319] * (-2160.139) [-2154.439] (-2155.375) (-2163.947) -- 0:01:28 670000 -- (-2162.723) (-2153.224) [-2155.918] (-2158.371) * (-2170.811) (-2159.271) (-2153.645) [-2157.321] -- 0:01:28 Average standard deviation of split frequencies: 0.004217 670500 -- (-2154.945) (-2156.904) [-2158.702] (-2156.066) * (-2156.761) [-2154.858] (-2169.241) (-2161.861) -- 0:01:27 671000 -- [-2159.831] (-2154.263) (-2158.660) (-2155.541) * (-2166.791) (-2153.257) [-2156.718] (-2161.393) -- 0:01:27 671500 -- (-2158.524) (-2159.164) [-2162.850] (-2163.836) * (-2159.532) (-2156.049) (-2156.413) [-2159.523] -- 0:01:27 672000 -- (-2156.487) (-2158.166) [-2157.278] (-2158.401) * [-2158.718] (-2158.977) (-2152.071) (-2161.645) -- 0:01:27 672500 -- (-2152.582) [-2153.504] (-2160.806) (-2155.134) * (-2161.560) (-2154.639) [-2153.673] (-2159.559) -- 0:01:27 673000 -- [-2154.805] (-2159.601) (-2159.060) (-2154.068) * [-2155.605] (-2158.891) (-2155.976) (-2155.805) -- 0:01:26 673500 -- [-2155.397] (-2156.080) (-2168.432) (-2160.441) * [-2153.961] (-2159.977) (-2154.746) (-2159.577) -- 0:01:27 674000 -- [-2160.477] (-2153.814) (-2156.088) (-2158.516) * (-2159.914) (-2166.141) (-2156.887) [-2160.925] -- 0:01:27 674500 -- (-2155.811) [-2160.302] (-2158.137) (-2159.862) * (-2162.065) (-2159.350) (-2159.779) [-2160.029] -- 0:01:26 675000 -- (-2155.826) (-2155.477) [-2153.889] (-2158.143) * [-2159.141] (-2161.988) (-2158.451) (-2165.127) -- 0:01:26 Average standard deviation of split frequencies: 0.004184 675500 -- [-2153.524] (-2157.693) (-2154.471) (-2156.648) * (-2156.153) (-2161.008) (-2161.683) [-2150.220] -- 0:01:26 676000 -- (-2154.031) (-2160.235) (-2167.098) [-2158.843] * (-2163.563) [-2158.751] (-2159.487) (-2154.131) -- 0:01:26 676500 -- [-2156.914] (-2156.262) (-2157.569) (-2158.043) * (-2158.352) [-2165.307] (-2160.179) (-2159.000) -- 0:01:26 677000 -- (-2159.510) (-2159.333) [-2152.951] (-2162.669) * [-2155.013] (-2154.730) (-2159.087) (-2155.228) -- 0:01:26 677500 -- [-2157.489] (-2156.485) (-2153.012) (-2161.914) * (-2155.926) (-2155.476) (-2157.276) [-2159.831] -- 0:01:26 678000 -- [-2162.257] (-2154.057) (-2156.756) (-2154.938) * (-2156.269) (-2156.348) (-2165.644) [-2157.764] -- 0:01:25 678500 -- [-2156.457] (-2161.390) (-2158.056) (-2155.368) * (-2153.584) (-2158.563) (-2159.483) [-2160.204] -- 0:01:25 679000 -- (-2160.546) [-2160.573] (-2168.000) (-2156.450) * (-2158.277) (-2154.239) [-2155.714] (-2160.139) -- 0:01:25 679500 -- (-2160.477) [-2154.998] (-2159.277) (-2154.057) * (-2153.663) (-2152.731) (-2161.923) [-2155.307] -- 0:01:25 680000 -- (-2164.848) [-2155.090] (-2168.927) (-2157.584) * (-2155.768) (-2157.823) (-2155.642) [-2156.412] -- 0:01:25 Average standard deviation of split frequencies: 0.004329 680500 -- [-2161.083] (-2159.658) (-2165.809) (-2154.630) * (-2160.925) (-2153.376) [-2159.843] (-2155.097) -- 0:01:24 681000 -- (-2154.541) (-2159.142) (-2160.234) [-2155.621] * (-2157.357) [-2156.931] (-2157.968) (-2163.815) -- 0:01:25 681500 -- (-2151.279) (-2161.237) (-2158.768) [-2155.799] * (-2156.763) (-2161.752) [-2157.532] (-2162.441) -- 0:01:25 682000 -- (-2157.178) [-2157.172] (-2156.133) (-2154.630) * (-2158.911) (-2159.731) (-2160.569) [-2160.948] -- 0:01:24 682500 -- (-2159.035) (-2154.168) (-2162.202) [-2154.105] * [-2157.322] (-2163.537) (-2152.771) (-2156.811) -- 0:01:24 683000 -- (-2158.729) (-2161.779) (-2161.310) [-2154.406] * (-2155.075) (-2158.922) (-2152.706) [-2157.096] -- 0:01:24 683500 -- (-2159.094) (-2164.007) (-2161.181) [-2157.064] * (-2161.600) (-2157.440) (-2157.859) [-2153.816] -- 0:01:24 684000 -- (-2156.295) (-2161.161) [-2156.378] (-2156.672) * [-2154.747] (-2159.029) (-2161.065) (-2156.856) -- 0:01:24 684500 -- (-2164.795) (-2157.725) [-2154.940] (-2154.805) * (-2154.468) (-2158.316) [-2155.409] (-2149.414) -- 0:01:24 685000 -- (-2157.375) (-2159.296) (-2159.052) [-2156.508] * [-2155.442] (-2163.015) (-2155.265) (-2156.933) -- 0:01:24 Average standard deviation of split frequencies: 0.004295 685500 -- (-2160.710) [-2159.306] (-2160.677) (-2155.122) * (-2154.660) (-2159.028) (-2157.455) [-2156.909] -- 0:01:23 686000 -- (-2156.442) (-2162.751) (-2153.261) [-2161.622] * [-2157.280] (-2158.231) (-2156.455) (-2155.770) -- 0:01:23 686500 -- (-2151.068) [-2158.984] (-2152.301) (-2158.974) * [-2160.585] (-2156.091) (-2158.861) (-2157.056) -- 0:01:23 687000 -- (-2157.733) [-2156.582] (-2155.513) (-2165.832) * [-2160.259] (-2159.603) (-2158.912) (-2159.194) -- 0:01:23 687500 -- (-2154.568) (-2150.859) [-2163.950] (-2158.584) * (-2157.315) [-2157.676] (-2152.663) (-2162.542) -- 0:01:23 688000 -- (-2159.861) [-2154.202] (-2160.061) (-2152.224) * [-2160.561] (-2152.946) (-2159.753) (-2157.906) -- 0:01:22 688500 -- [-2161.479] (-2156.604) (-2161.891) (-2159.026) * (-2156.246) (-2159.680) (-2163.119) [-2164.549] -- 0:01:23 689000 -- (-2155.255) [-2151.481] (-2163.424) (-2151.456) * [-2167.284] (-2156.059) (-2173.844) (-2164.380) -- 0:01:23 689500 -- (-2157.177) [-2157.900] (-2165.574) (-2159.137) * (-2155.417) (-2158.593) (-2166.266) [-2165.893] -- 0:01:22 690000 -- (-2172.325) (-2159.127) (-2152.118) [-2156.574] * (-2155.836) [-2155.740] (-2151.672) (-2166.041) -- 0:01:22 Average standard deviation of split frequencies: 0.004266 690500 -- (-2161.243) (-2157.387) (-2160.648) [-2153.805] * (-2159.674) (-2152.304) [-2154.554] (-2161.761) -- 0:01:22 691000 -- (-2160.137) (-2162.453) [-2152.794] (-2154.530) * (-2159.554) [-2159.330] (-2156.753) (-2156.462) -- 0:01:22 691500 -- (-2161.085) [-2156.573] (-2157.367) (-2150.854) * (-2154.793) (-2158.889) (-2155.955) [-2158.322] -- 0:01:22 692000 -- [-2164.576] (-2158.349) (-2159.858) (-2157.344) * (-2155.338) (-2159.059) (-2160.825) [-2156.117] -- 0:01:21 692500 -- [-2157.857] (-2151.507) (-2166.219) (-2157.410) * (-2154.208) (-2159.718) [-2157.508] (-2166.847) -- 0:01:22 693000 -- [-2168.795] (-2155.109) (-2158.792) (-2158.025) * (-2157.961) (-2151.221) (-2156.153) [-2155.493] -- 0:01:21 693500 -- (-2156.711) (-2160.732) [-2162.530] (-2158.525) * (-2155.050) [-2154.677] (-2161.864) (-2157.562) -- 0:01:21 694000 -- (-2155.911) (-2153.351) (-2157.720) [-2163.674] * [-2153.340] (-2163.040) (-2158.837) (-2157.692) -- 0:01:21 694500 -- (-2165.064) (-2156.962) [-2158.819] (-2157.250) * (-2158.824) (-2163.200) [-2164.284] (-2157.361) -- 0:01:21 695000 -- (-2151.961) [-2158.401] (-2156.827) (-2170.631) * (-2157.333) (-2156.881) (-2154.047) [-2154.498] -- 0:01:21 Average standard deviation of split frequencies: 0.004233 695500 -- (-2155.964) [-2153.533] (-2151.977) (-2160.784) * [-2158.323] (-2157.361) (-2156.734) (-2152.820) -- 0:01:20 696000 -- (-2157.279) [-2156.979] (-2154.941) (-2159.600) * [-2149.628] (-2161.474) (-2171.274) (-2150.721) -- 0:01:21 696500 -- (-2153.155) [-2154.546] (-2154.309) (-2158.805) * [-2154.352] (-2168.508) (-2162.074) (-2154.156) -- 0:01:21 697000 -- [-2161.251] (-2156.054) (-2154.244) (-2160.119) * (-2156.967) (-2156.858) (-2154.058) [-2154.307] -- 0:01:20 697500 -- (-2160.665) (-2152.420) (-2159.088) [-2156.957] * (-2163.225) (-2162.386) [-2156.222] (-2160.135) -- 0:01:20 698000 -- [-2153.907] (-2159.214) (-2163.207) (-2157.356) * [-2160.976] (-2158.954) (-2154.271) (-2159.579) -- 0:01:20 698500 -- (-2160.793) (-2155.995) (-2159.601) [-2153.702] * (-2162.590) (-2162.217) (-2153.804) [-2161.864] -- 0:01:20 699000 -- (-2163.635) (-2152.705) (-2162.355) [-2152.936] * (-2161.774) (-2156.547) (-2162.641) [-2156.323] -- 0:01:20 699500 -- [-2155.844] (-2165.791) (-2156.919) (-2153.817) * (-2156.742) (-2157.659) (-2154.565) [-2156.411] -- 0:01:19 700000 -- (-2160.773) [-2157.942] (-2160.684) (-2157.141) * (-2159.804) (-2155.553) (-2159.825) [-2158.990] -- 0:01:20 Average standard deviation of split frequencies: 0.004205 700500 -- (-2163.657) [-2153.591] (-2154.070) (-2159.131) * (-2152.320) (-2162.222) (-2155.012) [-2152.118] -- 0:01:19 701000 -- [-2154.131] (-2160.039) (-2170.206) (-2163.486) * (-2159.295) (-2155.707) [-2155.152] (-2157.593) -- 0:01:19 701500 -- (-2159.482) (-2154.183) (-2155.780) [-2161.758] * (-2153.461) [-2158.849] (-2156.396) (-2157.394) -- 0:01:19 702000 -- (-2158.391) (-2160.635) [-2160.118] (-2157.168) * (-2158.969) (-2158.089) [-2160.523] (-2163.303) -- 0:01:19 702500 -- (-2153.812) (-2156.534) (-2153.301) [-2159.507] * (-2155.805) [-2157.915] (-2163.925) (-2152.404) -- 0:01:19 703000 -- (-2154.628) (-2158.850) (-2159.926) [-2157.897] * (-2152.409) (-2155.317) (-2171.679) [-2155.301] -- 0:01:19 703500 -- (-2158.735) (-2157.968) (-2154.091) [-2166.326] * (-2156.553) [-2158.238] (-2159.913) (-2160.105) -- 0:01:19 704000 -- (-2167.257) [-2158.515] (-2150.504) (-2156.667) * (-2156.074) (-2154.148) [-2155.403] (-2159.767) -- 0:01:19 704500 -- (-2154.156) (-2156.163) (-2155.605) [-2154.296] * (-2161.138) (-2163.024) (-2156.446) [-2162.864] -- 0:01:18 705000 -- [-2155.170] (-2155.607) (-2152.992) (-2156.307) * (-2156.196) (-2159.906) [-2156.917] (-2167.316) -- 0:01:18 Average standard deviation of split frequencies: 0.004006 705500 -- (-2158.846) [-2152.076] (-2166.563) (-2156.481) * [-2158.765] (-2153.668) (-2157.355) (-2167.266) -- 0:01:18 706000 -- (-2150.899) (-2155.651) (-2161.147) [-2155.981] * (-2161.485) (-2159.520) [-2158.367] (-2160.330) -- 0:01:18 706500 -- [-2153.145] (-2155.416) (-2162.287) (-2163.973) * (-2165.001) (-2165.614) [-2158.410] (-2158.613) -- 0:01:18 707000 -- (-2152.578) [-2152.470] (-2156.191) (-2157.891) * [-2153.000] (-2152.801) (-2161.328) (-2159.444) -- 0:01:17 707500 -- (-2162.125) (-2156.871) [-2151.620] (-2160.533) * [-2153.519] (-2158.392) (-2156.217) (-2157.533) -- 0:01:18 708000 -- (-2153.128) (-2161.930) [-2151.809] (-2157.911) * (-2158.321) (-2159.464) (-2155.513) [-2158.467] -- 0:01:17 708500 -- (-2159.275) (-2154.235) [-2156.113] (-2163.572) * (-2154.437) [-2153.361] (-2157.606) (-2158.033) -- 0:01:17 709000 -- [-2161.926] (-2162.945) (-2153.289) (-2163.456) * [-2161.147] (-2159.377) (-2155.043) (-2152.210) -- 0:01:17 709500 -- (-2164.267) (-2163.516) [-2158.163] (-2157.911) * (-2160.598) [-2160.793] (-2154.010) (-2155.813) -- 0:01:17 710000 -- (-2154.831) (-2153.798) (-2158.812) [-2157.375] * (-2152.303) (-2153.746) [-2153.400] (-2155.419) -- 0:01:17 Average standard deviation of split frequencies: 0.003980 710500 -- [-2151.089] (-2157.536) (-2160.288) (-2159.687) * (-2156.731) (-2160.133) (-2175.446) [-2152.785] -- 0:01:17 711000 -- (-2154.406) (-2163.946) [-2152.528] (-2151.814) * [-2160.890] (-2155.119) (-2158.256) (-2156.661) -- 0:01:17 711500 -- (-2153.397) [-2164.707] (-2163.387) (-2154.056) * (-2160.637) (-2156.765) (-2162.746) [-2154.252] -- 0:01:17 712000 -- (-2155.122) [-2160.372] (-2163.630) (-2169.421) * (-2158.254) [-2152.784] (-2158.411) (-2158.185) -- 0:01:16 712500 -- (-2159.616) [-2151.688] (-2163.181) (-2160.298) * [-2159.107] (-2161.090) (-2176.988) (-2161.824) -- 0:01:16 713000 -- (-2157.286) (-2155.983) [-2154.404] (-2156.949) * (-2157.987) (-2159.565) (-2166.024) [-2154.151] -- 0:01:16 713500 -- (-2154.774) [-2154.322] (-2158.742) (-2156.331) * (-2160.457) [-2157.922] (-2166.653) (-2155.343) -- 0:01:16 714000 -- (-2156.129) [-2160.037] (-2162.651) (-2162.954) * (-2159.298) (-2160.325) [-2163.118] (-2159.404) -- 0:01:16 714500 -- (-2165.180) (-2172.364) (-2154.340) [-2154.486] * (-2160.876) (-2162.332) (-2154.368) [-2157.259] -- 0:01:15 715000 -- (-2167.862) (-2162.930) (-2153.069) [-2148.573] * (-2156.225) (-2162.236) (-2158.871) [-2153.085] -- 0:01:16 Average standard deviation of split frequencies: 0.003950 715500 -- [-2159.097] (-2166.823) (-2159.138) (-2159.582) * (-2155.411) (-2161.339) [-2151.580] (-2156.809) -- 0:01:15 716000 -- (-2153.916) [-2158.233] (-2154.817) (-2153.286) * (-2159.431) [-2157.543] (-2156.341) (-2155.330) -- 0:01:15 716500 -- (-2156.628) [-2154.094] (-2158.649) (-2160.914) * (-2168.132) (-2154.679) (-2157.712) [-2151.852] -- 0:01:15 717000 -- (-2153.562) (-2163.180) (-2158.346) [-2158.182] * (-2160.458) (-2158.416) [-2155.585] (-2156.985) -- 0:01:15 717500 -- (-2159.695) [-2160.104] (-2161.287) (-2156.997) * (-2167.531) [-2152.301] (-2163.071) (-2156.753) -- 0:01:15 718000 -- (-2161.020) (-2156.548) (-2161.403) [-2160.226] * (-2160.777) [-2156.023] (-2160.559) (-2159.650) -- 0:01:15 718500 -- (-2154.692) (-2162.002) [-2156.695] (-2163.859) * (-2155.626) (-2157.718) [-2157.008] (-2158.823) -- 0:01:14 719000 -- (-2152.197) [-2153.488] (-2156.785) (-2154.215) * (-2156.951) [-2157.520] (-2160.307) (-2155.548) -- 0:01:15 719500 -- [-2155.685] (-2164.961) (-2157.386) (-2167.806) * (-2161.921) [-2154.202] (-2156.234) (-2161.007) -- 0:01:14 720000 -- (-2165.733) [-2155.092] (-2155.321) (-2165.571) * (-2155.872) [-2156.272] (-2154.156) (-2161.896) -- 0:01:14 Average standard deviation of split frequencies: 0.003925 720500 -- (-2158.639) (-2158.427) [-2157.693] (-2157.417) * (-2161.835) [-2154.631] (-2153.651) (-2154.708) -- 0:01:14 721000 -- (-2161.774) [-2166.608] (-2159.913) (-2154.128) * [-2162.731] (-2157.531) (-2156.455) (-2152.824) -- 0:01:14 721500 -- [-2159.564] (-2162.718) (-2159.503) (-2154.316) * (-2166.007) [-2163.007] (-2156.739) (-2163.491) -- 0:01:14 722000 -- (-2154.734) [-2157.904] (-2165.456) (-2156.760) * [-2156.346] (-2164.257) (-2154.855) (-2159.338) -- 0:01:13 722500 -- (-2152.894) [-2154.718] (-2158.893) (-2159.653) * (-2156.969) [-2153.735] (-2159.704) (-2157.135) -- 0:01:14 723000 -- [-2156.597] (-2153.403) (-2157.819) (-2156.304) * (-2154.113) (-2161.106) (-2165.863) [-2152.746] -- 0:01:13 723500 -- [-2152.685] (-2163.495) (-2162.619) (-2155.640) * (-2162.221) (-2158.315) (-2164.280) [-2156.851] -- 0:01:13 724000 -- (-2153.426) (-2152.472) (-2159.097) [-2156.049] * (-2153.818) (-2159.505) (-2162.161) [-2161.126] -- 0:01:13 724500 -- (-2157.250) [-2159.071] (-2152.066) (-2162.828) * (-2152.226) (-2157.801) [-2156.387] (-2157.211) -- 0:01:13 725000 -- (-2159.703) (-2158.421) (-2154.036) [-2163.466] * (-2156.289) (-2157.347) [-2154.893] (-2157.325) -- 0:01:13 Average standard deviation of split frequencies: 0.003896 725500 -- [-2155.080] (-2158.804) (-2159.902) (-2165.264) * (-2160.064) (-2155.025) [-2153.230] (-2162.703) -- 0:01:13 726000 -- (-2153.639) (-2157.814) (-2160.396) [-2155.283] * (-2155.875) [-2159.508] (-2160.502) (-2160.980) -- 0:01:12 726500 -- [-2160.595] (-2159.247) (-2152.595) (-2157.951) * (-2152.826) [-2155.395] (-2163.587) (-2158.462) -- 0:01:13 727000 -- (-2154.003) (-2165.558) (-2153.392) [-2154.725] * (-2157.653) [-2153.813] (-2158.354) (-2161.984) -- 0:01:12 727500 -- (-2159.090) (-2165.833) (-2156.789) [-2157.039] * (-2155.033) [-2150.341] (-2157.378) (-2159.156) -- 0:01:12 728000 -- (-2160.585) (-2154.033) (-2159.089) [-2156.703] * (-2154.045) (-2155.769) (-2151.302) [-2158.595] -- 0:01:12 728500 -- (-2151.615) (-2161.927) [-2156.445] (-2156.097) * (-2159.729) (-2157.731) (-2156.844) [-2163.904] -- 0:01:12 729000 -- (-2153.321) (-2160.556) [-2165.564] (-2163.620) * (-2160.120) (-2154.824) (-2155.879) [-2157.233] -- 0:01:12 729500 -- (-2156.701) (-2159.841) (-2162.414) [-2154.535] * (-2162.041) (-2160.044) (-2159.202) [-2158.314] -- 0:01:11 730000 -- [-2157.591] (-2163.536) (-2166.394) (-2159.745) * (-2160.966) (-2155.175) [-2160.143] (-2167.823) -- 0:01:12 Average standard deviation of split frequencies: 0.003710 730500 -- [-2155.604] (-2151.601) (-2156.252) (-2163.094) * (-2157.051) (-2155.130) [-2157.327] (-2162.333) -- 0:01:11 731000 -- (-2156.226) [-2155.693] (-2154.629) (-2160.247) * (-2155.879) (-2154.209) (-2155.627) [-2155.930] -- 0:01:11 731500 -- [-2156.194] (-2163.143) (-2161.967) (-2159.220) * (-2158.147) [-2152.826] (-2159.411) (-2157.510) -- 0:01:11 732000 -- [-2155.511] (-2161.617) (-2154.696) (-2157.495) * (-2157.171) [-2163.315] (-2161.724) (-2163.886) -- 0:01:11 732500 -- [-2155.315] (-2156.262) (-2160.850) (-2155.263) * (-2158.714) (-2161.527) [-2155.284] (-2159.748) -- 0:01:11 733000 -- (-2162.014) (-2157.470) [-2160.982] (-2157.929) * (-2156.326) [-2162.073] (-2157.429) (-2157.281) -- 0:01:11 733500 -- (-2159.753) [-2158.005] (-2160.361) (-2162.613) * [-2154.712] (-2158.352) (-2166.800) (-2156.113) -- 0:01:10 734000 -- (-2154.982) (-2159.436) (-2164.265) [-2156.321] * (-2159.841) [-2152.064] (-2153.696) (-2164.536) -- 0:01:11 734500 -- [-2157.282] (-2161.546) (-2157.703) (-2158.801) * (-2158.316) [-2154.578] (-2157.459) (-2160.814) -- 0:01:10 735000 -- (-2160.869) [-2162.561] (-2161.889) (-2170.742) * (-2153.173) (-2155.322) (-2161.374) [-2155.740] -- 0:01:10 Average standard deviation of split frequencies: 0.003683 735500 -- (-2155.923) (-2159.960) (-2166.326) [-2160.700] * (-2161.483) (-2157.363) (-2153.714) [-2152.836] -- 0:01:10 736000 -- (-2159.224) (-2157.777) [-2158.805] (-2158.281) * (-2155.805) [-2156.737] (-2163.152) (-2162.356) -- 0:01:10 736500 -- (-2157.028) (-2153.080) (-2156.919) [-2164.511] * [-2157.186] (-2161.391) (-2158.769) (-2159.963) -- 0:01:10 737000 -- [-2153.720] (-2159.604) (-2155.297) (-2158.553) * (-2154.163) (-2156.362) (-2154.702) [-2153.400] -- 0:01:09 737500 -- (-2155.870) (-2156.152) (-2155.375) [-2155.686] * [-2158.116] (-2157.274) (-2164.588) (-2164.070) -- 0:01:10 738000 -- (-2166.518) [-2156.850] (-2156.963) (-2159.281) * (-2159.269) [-2153.086] (-2161.346) (-2154.367) -- 0:01:09 738500 -- (-2161.167) (-2157.127) [-2156.515] (-2166.252) * (-2162.269) [-2152.498] (-2158.585) (-2160.278) -- 0:01:09 739000 -- (-2159.725) (-2157.260) (-2158.094) [-2159.124] * (-2160.982) (-2156.052) (-2163.003) [-2157.538] -- 0:01:09 739500 -- [-2159.123] (-2159.314) (-2151.086) (-2163.071) * [-2155.887] (-2153.156) (-2161.446) (-2156.969) -- 0:01:09 740000 -- (-2162.076) (-2156.084) [-2154.545] (-2158.576) * [-2157.780] (-2152.250) (-2161.237) (-2153.101) -- 0:01:09 Average standard deviation of split frequencies: 0.003660 740500 -- (-2157.790) [-2156.965] (-2157.000) (-2154.065) * [-2153.900] (-2158.331) (-2156.187) (-2160.910) -- 0:01:09 741000 -- (-2161.080) (-2158.883) (-2155.210) [-2155.058] * [-2154.548] (-2155.046) (-2151.010) (-2153.002) -- 0:01:08 741500 -- (-2155.033) [-2159.929] (-2154.115) (-2162.089) * (-2155.905) (-2163.702) (-2156.904) [-2153.684] -- 0:01:09 742000 -- (-2157.843) (-2156.972) [-2161.197] (-2156.998) * (-2162.033) [-2153.385] (-2162.836) (-2162.437) -- 0:01:08 742500 -- (-2152.935) [-2157.382] (-2158.411) (-2162.598) * [-2153.629] (-2159.345) (-2159.125) (-2162.870) -- 0:01:08 743000 -- (-2162.245) [-2153.220] (-2155.840) (-2153.744) * [-2157.976] (-2153.726) (-2164.967) (-2156.071) -- 0:01:08 743500 -- [-2156.546] (-2160.547) (-2156.743) (-2158.973) * (-2162.428) (-2153.107) [-2169.343] (-2160.809) -- 0:01:08 744000 -- (-2156.565) (-2158.085) (-2153.664) [-2153.670] * (-2161.124) [-2163.642] (-2167.109) (-2156.851) -- 0:01:08 744500 -- (-2153.427) [-2155.245] (-2163.568) (-2158.120) * [-2152.689] (-2154.131) (-2156.409) (-2155.340) -- 0:01:07 745000 -- (-2152.785) (-2156.671) (-2161.753) [-2153.804] * (-2157.183) (-2157.968) [-2156.389] (-2153.115) -- 0:01:07 Average standard deviation of split frequencies: 0.003633 745500 -- (-2156.498) (-2162.757) (-2153.074) [-2156.207] * (-2156.083) (-2153.657) (-2154.472) [-2155.277] -- 0:01:07 746000 -- [-2152.987] (-2163.477) (-2153.089) (-2160.078) * (-2161.522) [-2152.528] (-2158.415) (-2158.282) -- 0:01:07 746500 -- [-2156.627] (-2160.794) (-2155.074) (-2164.796) * [-2158.475] (-2152.297) (-2154.058) (-2155.688) -- 0:01:07 747000 -- (-2162.829) [-2158.193] (-2160.410) (-2161.661) * (-2159.842) (-2162.375) (-2151.906) [-2159.748] -- 0:01:07 747500 -- (-2159.672) (-2158.370) (-2159.151) [-2162.845] * (-2157.908) (-2157.754) [-2151.773] (-2160.393) -- 0:01:07 748000 -- (-2162.819) (-2155.942) [-2161.111] (-2152.993) * (-2153.876) (-2157.823) (-2159.033) [-2153.041] -- 0:01:07 748500 -- [-2163.201] (-2153.179) (-2162.807) (-2154.894) * (-2154.644) (-2158.373) [-2156.470] (-2158.505) -- 0:01:06 749000 -- (-2164.898) (-2151.777) [-2152.080] (-2159.096) * (-2152.245) (-2157.801) [-2157.687] (-2157.534) -- 0:01:07 749500 -- [-2155.798] (-2158.925) (-2153.620) (-2151.677) * (-2156.891) (-2156.817) [-2154.988] (-2155.831) -- 0:01:06 750000 -- [-2152.087] (-2152.973) (-2162.532) (-2154.069) * (-2155.089) (-2161.164) (-2159.621) [-2156.733] -- 0:01:06 Average standard deviation of split frequencies: 0.003611 750500 -- [-2152.676] (-2153.899) (-2160.280) (-2155.534) * (-2156.640) (-2160.345) [-2156.797] (-2163.046) -- 0:01:06 751000 -- (-2157.993) [-2158.354] (-2155.940) (-2153.213) * [-2162.769] (-2158.022) (-2165.126) (-2156.904) -- 0:01:06 751500 -- (-2155.871) (-2161.362) (-2154.575) [-2151.713] * (-2158.986) (-2159.220) [-2156.483] (-2155.735) -- 0:01:06 752000 -- (-2157.438) (-2156.213) (-2153.936) [-2152.791] * (-2160.487) (-2161.081) [-2154.693] (-2152.233) -- 0:01:05 752500 -- [-2157.565] (-2160.686) (-2152.305) (-2155.507) * (-2155.994) [-2164.764] (-2158.635) (-2153.803) -- 0:01:05 753000 -- (-2161.199) [-2163.027] (-2158.448) (-2156.703) * (-2168.576) (-2158.937) [-2154.723] (-2157.500) -- 0:01:05 753500 -- (-2155.710) [-2158.369] (-2153.353) (-2154.600) * (-2157.162) [-2152.361] (-2152.469) (-2160.766) -- 0:01:05 754000 -- (-2161.963) (-2155.131) [-2159.545] (-2154.711) * (-2156.903) (-2161.727) (-2154.279) [-2157.083] -- 0:01:05 754500 -- (-2154.946) (-2161.246) (-2157.801) [-2156.785] * (-2157.018) (-2157.766) (-2154.850) [-2166.043] -- 0:01:05 755000 -- [-2157.879] (-2163.810) (-2162.721) (-2155.354) * [-2157.748] (-2157.819) (-2159.817) (-2156.647) -- 0:01:05 Average standard deviation of split frequencies: 0.003741 755500 -- (-2154.856) [-2154.546] (-2164.727) (-2159.519) * [-2163.893] (-2158.797) (-2152.935) (-2154.271) -- 0:01:05 756000 -- [-2156.078] (-2154.773) (-2166.456) (-2160.970) * [-2154.924] (-2155.360) (-2165.353) (-2153.786) -- 0:01:04 756500 -- (-2158.440) [-2149.024] (-2155.729) (-2153.969) * [-2153.702] (-2159.577) (-2163.599) (-2156.131) -- 0:01:05 757000 -- (-2159.545) [-2150.770] (-2158.647) (-2152.805) * (-2151.000) (-2166.458) [-2160.897] (-2151.470) -- 0:01:04 757500 -- (-2158.739) (-2155.140) [-2157.368] (-2158.983) * (-2157.685) (-2160.685) [-2160.361] (-2155.860) -- 0:01:04 758000 -- (-2150.940) (-2156.285) (-2161.299) [-2151.758] * (-2164.364) (-2161.287) [-2164.596] (-2157.562) -- 0:01:04 758500 -- (-2165.020) [-2153.905] (-2168.989) (-2153.155) * (-2159.142) [-2157.730] (-2155.786) (-2162.438) -- 0:01:04 759000 -- (-2156.775) (-2153.499) (-2159.261) [-2153.965] * (-2157.974) (-2157.454) [-2157.799] (-2161.354) -- 0:01:04 759500 -- (-2155.107) [-2155.365] (-2156.745) (-2162.159) * (-2162.702) (-2159.468) (-2160.207) [-2157.815] -- 0:01:03 760000 -- (-2158.183) (-2165.803) (-2157.298) [-2152.198] * [-2157.176] (-2153.547) (-2162.731) (-2157.048) -- 0:01:03 Average standard deviation of split frequencies: 0.003718 760500 -- [-2159.157] (-2163.123) (-2164.032) (-2159.669) * (-2153.110) (-2159.017) (-2161.152) [-2153.199] -- 0:01:03 761000 -- (-2154.449) (-2154.612) [-2160.047] (-2159.429) * (-2157.445) [-2155.177] (-2159.452) (-2163.390) -- 0:01:03 761500 -- [-2156.964] (-2157.126) (-2160.849) (-2163.899) * (-2154.638) (-2158.906) (-2155.599) [-2155.824] -- 0:01:03 762000 -- (-2152.041) (-2157.103) [-2153.203] (-2160.083) * (-2158.934) [-2155.824] (-2154.565) (-2160.486) -- 0:01:03 762500 -- [-2155.732] (-2167.029) (-2153.289) (-2168.719) * [-2158.941] (-2157.831) (-2156.711) (-2152.355) -- 0:01:03 763000 -- [-2159.999] (-2162.426) (-2161.529) (-2166.309) * (-2158.207) [-2158.849] (-2161.469) (-2157.190) -- 0:01:03 763500 -- (-2154.234) [-2155.494] (-2157.194) (-2159.445) * [-2152.645] (-2160.355) (-2157.734) (-2162.736) -- 0:01:02 764000 -- (-2159.613) (-2155.633) [-2159.528] (-2155.897) * (-2162.223) [-2157.583] (-2155.998) (-2162.195) -- 0:01:03 764500 -- (-2159.966) [-2154.658] (-2157.127) (-2164.116) * (-2151.412) (-2158.421) (-2156.014) [-2153.189] -- 0:01:02 765000 -- [-2161.080] (-2159.750) (-2156.178) (-2161.141) * (-2152.121) (-2157.425) [-2153.853] (-2158.971) -- 0:01:02 Average standard deviation of split frequencies: 0.003692 765500 -- [-2158.087] (-2155.741) (-2154.019) (-2157.682) * [-2154.118] (-2154.563) (-2163.374) (-2152.654) -- 0:01:02 766000 -- (-2164.207) (-2154.047) (-2155.119) [-2157.425] * [-2152.240] (-2167.918) (-2160.764) (-2161.650) -- 0:01:02 766500 -- (-2158.230) (-2150.915) (-2159.006) [-2155.677] * [-2157.938] (-2153.057) (-2164.176) (-2165.295) -- 0:01:02 767000 -- (-2159.122) [-2155.180] (-2153.614) (-2160.861) * (-2154.664) (-2154.239) [-2160.894] (-2159.588) -- 0:01:01 767500 -- (-2162.370) (-2162.547) [-2153.870] (-2162.801) * (-2153.688) (-2161.371) [-2154.680] (-2151.186) -- 0:01:01 768000 -- [-2156.300] (-2155.692) (-2158.946) (-2159.431) * (-2157.537) (-2156.304) [-2158.345] (-2161.352) -- 0:01:01 768500 -- (-2163.391) [-2158.300] (-2159.876) (-2157.221) * (-2165.244) (-2157.626) (-2159.747) [-2160.386] -- 0:01:01 769000 -- (-2160.294) (-2155.892) [-2153.240] (-2160.830) * [-2155.662] (-2153.693) (-2158.346) (-2157.916) -- 0:01:01 769500 -- (-2151.825) (-2156.023) [-2155.185] (-2158.653) * (-2155.611) [-2154.040] (-2157.903) (-2160.268) -- 0:01:01 770000 -- (-2159.141) [-2157.295] (-2154.393) (-2161.040) * (-2151.552) [-2156.495] (-2158.562) (-2156.944) -- 0:01:01 Average standard deviation of split frequencies: 0.003670 770500 -- (-2154.462) (-2154.196) [-2160.007] (-2157.667) * (-2155.659) (-2162.488) (-2157.008) [-2160.576] -- 0:01:01 771000 -- (-2164.708) (-2160.859) [-2151.443] (-2158.545) * (-2155.133) (-2157.308) [-2156.276] (-2157.884) -- 0:01:00 771500 -- (-2153.263) (-2160.745) (-2160.994) [-2152.943] * (-2155.895) (-2156.760) (-2156.577) [-2155.514] -- 0:01:01 772000 -- (-2154.163) (-2155.799) (-2156.031) [-2152.928] * (-2161.012) [-2157.587] (-2163.821) (-2155.235) -- 0:01:00 772500 -- (-2154.088) (-2160.994) [-2155.689] (-2159.453) * (-2155.089) (-2161.318) (-2157.523) [-2160.803] -- 0:01:00 773000 -- (-2158.076) (-2157.326) (-2159.811) [-2163.083] * (-2158.435) (-2158.840) [-2162.510] (-2153.539) -- 0:01:00 773500 -- (-2157.547) (-2157.968) [-2154.548] (-2157.981) * (-2161.345) (-2156.958) (-2159.394) [-2157.560] -- 0:01:00 774000 -- [-2152.192] (-2159.704) (-2153.511) (-2162.007) * (-2159.642) (-2161.615) (-2162.235) [-2158.534] -- 0:01:00 774500 -- [-2156.069] (-2156.581) (-2152.941) (-2156.443) * (-2161.905) [-2159.960] (-2166.580) (-2155.700) -- 0:00:59 775000 -- (-2158.933) [-2156.505] (-2154.471) (-2159.359) * (-2162.314) (-2159.625) (-2158.706) [-2159.356] -- 0:00:59 Average standard deviation of split frequencies: 0.003645 775500 -- (-2167.343) (-2154.826) (-2164.951) [-2159.680] * (-2161.054) [-2156.909] (-2160.695) (-2157.271) -- 0:00:59 776000 -- (-2162.965) (-2157.854) (-2161.011) [-2160.045] * (-2163.669) [-2153.657] (-2158.329) (-2154.301) -- 0:00:59 776500 -- [-2155.809] (-2153.832) (-2157.187) (-2154.827) * [-2155.498] (-2165.459) (-2161.434) (-2158.739) -- 0:00:59 777000 -- (-2159.583) [-2157.552] (-2155.669) (-2156.120) * [-2157.460] (-2153.266) (-2158.192) (-2161.173) -- 0:00:59 777500 -- (-2157.544) (-2153.964) [-2154.076] (-2159.590) * [-2154.047] (-2154.478) (-2156.936) (-2155.643) -- 0:00:59 778000 -- (-2159.107) (-2160.952) [-2159.494] (-2155.089) * (-2154.984) (-2162.285) [-2155.362] (-2162.028) -- 0:00:59 778500 -- (-2158.214) (-2156.156) (-2160.298) [-2158.122] * [-2156.199] (-2156.301) (-2158.027) (-2153.971) -- 0:00:58 779000 -- [-2156.397] (-2153.600) (-2155.932) (-2153.092) * (-2157.981) (-2163.359) (-2160.596) [-2151.240] -- 0:00:58 779500 -- (-2158.042) (-2161.344) [-2151.104] (-2156.672) * (-2159.664) (-2157.918) (-2155.586) [-2154.711] -- 0:00:58 780000 -- (-2160.996) (-2159.097) (-2156.976) [-2150.973] * [-2164.759] (-2158.992) (-2162.566) (-2158.401) -- 0:00:58 Average standard deviation of split frequencies: 0.003472 780500 -- (-2155.329) (-2157.939) [-2157.302] (-2161.158) * (-2158.402) (-2156.779) [-2156.455] (-2154.613) -- 0:00:58 781000 -- [-2160.075] (-2160.241) (-2154.945) (-2158.668) * [-2164.210] (-2155.238) (-2157.950) (-2157.954) -- 0:00:58 781500 -- (-2154.358) (-2163.780) [-2158.052] (-2153.224) * (-2162.439) (-2153.034) [-2159.037] (-2156.591) -- 0:00:58 782000 -- (-2158.896) (-2154.965) [-2160.131] (-2157.670) * (-2156.393) (-2158.228) [-2163.949] (-2160.397) -- 0:00:57 782500 -- (-2160.619) [-2162.649] (-2164.096) (-2159.166) * (-2164.700) [-2159.938] (-2161.281) (-2153.426) -- 0:00:57 783000 -- (-2164.330) (-2157.140) [-2152.377] (-2157.705) * (-2157.312) (-2163.632) (-2156.961) [-2156.512] -- 0:00:57 783500 -- (-2159.346) (-2157.290) [-2151.871] (-2156.870) * [-2159.546] (-2160.657) (-2153.719) (-2158.470) -- 0:00:57 784000 -- [-2152.365] (-2152.354) (-2156.330) (-2160.033) * (-2161.387) (-2157.633) (-2152.367) [-2154.235] -- 0:00:57 784500 -- (-2162.431) [-2157.094] (-2159.521) (-2167.272) * (-2160.585) (-2159.605) (-2160.099) [-2153.895] -- 0:00:57 785000 -- [-2161.165] (-2157.920) (-2151.359) (-2153.781) * [-2155.178] (-2161.902) (-2161.121) (-2157.843) -- 0:00:57 Average standard deviation of split frequencies: 0.003449 785500 -- (-2158.743) [-2159.224] (-2157.292) (-2162.824) * (-2160.453) (-2161.996) (-2161.697) [-2152.907] -- 0:00:57 786000 -- (-2160.192) (-2155.551) [-2157.640] (-2156.591) * (-2156.015) [-2162.312] (-2158.450) (-2157.840) -- 0:00:56 786500 -- (-2160.407) (-2161.641) (-2155.966) [-2157.080] * (-2160.089) [-2160.381] (-2160.469) (-2152.856) -- 0:00:56 787000 -- (-2155.852) [-2160.672] (-2158.922) (-2155.897) * [-2157.024] (-2157.665) (-2159.537) (-2156.271) -- 0:00:56 787500 -- (-2154.721) (-2159.700) (-2154.984) [-2154.058] * [-2152.425] (-2160.815) (-2163.091) (-2157.871) -- 0:00:56 788000 -- (-2153.456) (-2158.596) (-2162.085) [-2160.519] * (-2158.263) (-2158.283) (-2152.763) [-2155.584] -- 0:00:56 788500 -- (-2165.700) (-2172.216) [-2152.724] (-2154.972) * [-2158.095] (-2154.044) (-2159.096) (-2161.542) -- 0:00:56 789000 -- (-2152.271) (-2169.865) [-2150.642] (-2159.045) * (-2157.307) (-2161.360) [-2155.675] (-2156.200) -- 0:00:56 789500 -- [-2158.190] (-2157.072) (-2154.283) (-2156.655) * [-2158.206] (-2159.837) (-2160.808) (-2159.857) -- 0:00:55 790000 -- (-2165.369) (-2161.224) [-2152.075] (-2152.334) * (-2163.501) (-2157.016) [-2152.808] (-2152.894) -- 0:00:55 Average standard deviation of split frequencies: 0.003279 790500 -- [-2154.052] (-2155.326) (-2158.669) (-2158.074) * (-2155.757) (-2160.449) (-2156.940) [-2161.581] -- 0:00:55 791000 -- (-2156.961) (-2159.358) [-2155.701] (-2152.285) * (-2155.468) (-2158.214) [-2158.907] (-2157.882) -- 0:00:55 791500 -- [-2157.307] (-2155.311) (-2156.642) (-2161.303) * (-2157.049) (-2163.039) (-2154.275) [-2151.574] -- 0:00:55 792000 -- (-2160.329) (-2163.551) [-2155.638] (-2156.451) * [-2162.350] (-2167.428) (-2156.754) (-2155.682) -- 0:00:55 792500 -- [-2155.038] (-2159.042) (-2155.392) (-2153.205) * (-2162.193) [-2161.834] (-2166.385) (-2162.258) -- 0:00:55 793000 -- [-2156.019] (-2155.827) (-2162.520) (-2156.344) * (-2154.439) (-2153.049) (-2158.886) [-2157.777] -- 0:00:55 793500 -- (-2154.968) [-2153.517] (-2161.125) (-2157.308) * (-2156.406) [-2158.860] (-2152.651) (-2160.158) -- 0:00:54 794000 -- (-2158.239) (-2155.256) [-2154.511] (-2155.479) * (-2156.875) (-2159.586) (-2154.193) [-2155.520] -- 0:00:54 794500 -- (-2151.676) (-2159.763) (-2155.657) [-2158.994] * [-2151.873] (-2160.737) (-2157.079) (-2160.778) -- 0:00:54 795000 -- (-2151.951) (-2154.031) [-2149.900] (-2155.380) * (-2154.276) (-2163.350) (-2153.488) [-2162.030] -- 0:00:54 Average standard deviation of split frequencies: 0.003257 795500 -- (-2157.686) (-2156.201) [-2159.773] (-2157.594) * (-2159.095) [-2157.326] (-2151.304) (-2156.556) -- 0:00:54 796000 -- (-2154.914) (-2156.250) [-2160.916] (-2159.370) * (-2161.498) [-2155.300] (-2153.067) (-2156.841) -- 0:00:54 796500 -- (-2164.583) [-2155.414] (-2156.954) (-2157.564) * (-2163.913) (-2157.295) (-2157.732) [-2154.245] -- 0:00:54 797000 -- (-2157.275) (-2158.888) [-2156.978] (-2161.733) * (-2165.754) (-2152.237) [-2158.724] (-2157.647) -- 0:00:53 797500 -- [-2153.448] (-2153.200) (-2155.157) (-2154.570) * (-2158.653) [-2158.288] (-2155.828) (-2157.564) -- 0:00:53 798000 -- [-2153.865] (-2153.180) (-2159.358) (-2162.812) * (-2155.911) [-2158.047] (-2157.605) (-2157.942) -- 0:00:53 798500 -- (-2153.745) (-2161.160) [-2154.329] (-2154.421) * [-2151.240] (-2158.646) (-2154.510) (-2163.562) -- 0:00:53 799000 -- (-2159.239) (-2156.547) [-2156.524] (-2157.027) * [-2152.842] (-2153.376) (-2159.731) (-2163.281) -- 0:00:53 799500 -- (-2153.453) (-2153.718) (-2161.256) [-2160.249] * [-2153.578] (-2156.771) (-2160.217) (-2157.995) -- 0:00:53 800000 -- (-2156.301) (-2156.536) [-2161.150] (-2165.897) * (-2155.195) (-2159.153) (-2154.306) [-2156.386] -- 0:00:53 Average standard deviation of split frequencies: 0.003091 800500 -- (-2155.415) (-2168.808) [-2168.816] (-2162.739) * (-2156.345) [-2151.251] (-2160.866) (-2157.939) -- 0:00:53 801000 -- (-2154.564) (-2159.021) [-2159.311] (-2154.546) * (-2159.016) [-2160.371] (-2156.176) (-2166.331) -- 0:00:52 801500 -- (-2153.235) [-2156.422] (-2157.523) (-2155.371) * (-2156.292) [-2154.381] (-2155.978) (-2152.916) -- 0:00:52 802000 -- (-2154.317) [-2152.421] (-2157.387) (-2156.377) * (-2163.413) (-2151.143) (-2152.285) [-2152.092] -- 0:00:52 802500 -- [-2162.999] (-2154.722) (-2152.874) (-2157.795) * (-2151.671) [-2154.864] (-2153.528) (-2154.105) -- 0:00:52 803000 -- (-2154.057) (-2158.698) [-2154.679] (-2156.925) * (-2158.919) [-2154.347] (-2149.590) (-2158.498) -- 0:00:52 803500 -- (-2158.091) (-2155.974) [-2159.050] (-2157.996) * [-2157.760] (-2163.273) (-2157.912) (-2154.116) -- 0:00:52 804000 -- [-2153.583] (-2160.219) (-2157.020) (-2158.650) * (-2159.109) (-2158.093) [-2151.745] (-2152.222) -- 0:00:52 804500 -- (-2153.676) (-2153.010) [-2159.530] (-2159.070) * (-2156.361) (-2157.561) [-2159.264] (-2161.074) -- 0:00:52 805000 -- (-2158.484) (-2153.393) [-2156.104] (-2162.894) * [-2156.192] (-2154.519) (-2155.631) (-2161.246) -- 0:00:51 Average standard deviation of split frequencies: 0.003217 805500 -- (-2156.034) (-2158.510) [-2161.131] (-2159.097) * (-2158.953) (-2159.328) [-2154.502] (-2165.151) -- 0:00:51 806000 -- (-2159.364) (-2153.679) [-2156.798] (-2166.096) * (-2156.357) (-2157.795) [-2157.286] (-2156.709) -- 0:00:51 806500 -- [-2156.325] (-2155.144) (-2164.529) (-2161.106) * [-2164.024] (-2160.949) (-2158.603) (-2159.516) -- 0:00:51 807000 -- (-2152.465) (-2156.993) (-2166.201) [-2154.987] * (-2154.488) (-2156.123) (-2160.818) [-2159.314] -- 0:00:51 807500 -- [-2155.898] (-2164.687) (-2164.450) (-2160.502) * [-2153.019] (-2154.194) (-2167.010) (-2157.912) -- 0:00:51 808000 -- [-2155.223] (-2161.997) (-2156.415) (-2160.701) * (-2158.192) [-2157.744] (-2155.018) (-2159.662) -- 0:00:51 808500 -- [-2154.894] (-2160.153) (-2155.786) (-2156.168) * (-2158.736) (-2155.439) [-2153.370] (-2154.675) -- 0:00:50 809000 -- (-2157.551) [-2152.170] (-2158.023) (-2159.819) * (-2158.339) (-2158.847) [-2153.543] (-2156.096) -- 0:00:50 809500 -- (-2158.102) (-2152.879) [-2156.906] (-2152.214) * [-2158.108] (-2158.208) (-2162.915) (-2162.151) -- 0:00:50 810000 -- (-2156.856) (-2153.493) (-2158.647) [-2152.169] * [-2151.846] (-2156.601) (-2155.275) (-2158.281) -- 0:00:50 Average standard deviation of split frequencies: 0.003053 810500 -- (-2152.699) (-2157.079) [-2161.625] (-2153.990) * [-2154.404] (-2163.482) (-2157.316) (-2161.125) -- 0:00:50 811000 -- (-2163.712) (-2161.303) [-2151.440] (-2151.282) * (-2159.457) [-2152.331] (-2155.375) (-2160.019) -- 0:00:50 811500 -- (-2159.081) (-2164.741) [-2152.168] (-2159.343) * (-2157.736) [-2154.571] (-2165.197) (-2157.493) -- 0:00:50 812000 -- (-2165.086) (-2156.577) (-2159.436) [-2158.161] * (-2158.299) [-2154.322] (-2156.720) (-2156.699) -- 0:00:50 812500 -- [-2160.245] (-2161.792) (-2158.166) (-2161.870) * (-2154.279) (-2162.038) [-2153.742] (-2155.934) -- 0:00:49 813000 -- (-2158.432) [-2156.650] (-2161.021) (-2157.798) * (-2166.443) [-2151.877] (-2157.500) (-2157.441) -- 0:00:49 813500 -- (-2149.470) [-2154.198] (-2158.456) (-2157.560) * (-2155.115) (-2156.799) [-2154.573] (-2156.264) -- 0:00:49 814000 -- (-2156.439) (-2155.667) [-2155.717] (-2155.536) * (-2160.023) [-2154.990] (-2154.578) (-2161.490) -- 0:00:49 814500 -- (-2157.226) (-2153.813) (-2157.710) [-2158.471] * (-2164.698) (-2157.992) (-2151.381) [-2157.204] -- 0:00:49 815000 -- (-2156.253) (-2157.285) (-2150.639) [-2159.361] * [-2156.403] (-2159.267) (-2160.830) (-2155.602) -- 0:00:49 Average standard deviation of split frequencies: 0.003177 815500 -- (-2153.484) (-2156.129) [-2154.528] (-2160.763) * (-2154.537) (-2163.896) (-2158.709) [-2159.425] -- 0:00:49 816000 -- (-2160.568) [-2154.469] (-2151.165) (-2161.407) * (-2158.732) (-2156.404) (-2155.431) [-2154.051] -- 0:00:48 816500 -- (-2156.542) (-2158.936) (-2160.689) [-2158.588] * [-2158.774] (-2160.037) (-2152.690) (-2157.275) -- 0:00:48 817000 -- (-2155.842) (-2154.004) (-2161.467) [-2154.075] * [-2158.869] (-2157.873) (-2162.032) (-2157.118) -- 0:00:48 817500 -- (-2154.832) (-2159.203) [-2159.692] (-2161.913) * (-2157.591) (-2155.821) [-2157.409] (-2158.870) -- 0:00:48 818000 -- (-2156.819) [-2158.528] (-2167.508) (-2160.222) * (-2156.247) (-2150.547) [-2162.429] (-2161.641) -- 0:00:48 818500 -- (-2160.246) (-2158.875) [-2156.890] (-2158.592) * (-2163.433) (-2155.096) [-2157.693] (-2155.130) -- 0:00:48 819000 -- (-2162.480) (-2159.238) [-2152.392] (-2156.693) * (-2161.299) (-2157.326) [-2153.866] (-2156.479) -- 0:00:48 819500 -- (-2160.886) (-2152.898) (-2158.653) [-2155.978] * (-2161.585) (-2158.382) (-2153.329) [-2157.665] -- 0:00:48 820000 -- (-2160.494) (-2152.223) [-2162.901] (-2166.277) * (-2153.513) [-2151.789] (-2160.712) (-2158.755) -- 0:00:47 Average standard deviation of split frequencies: 0.003159 820500 -- (-2159.483) (-2162.333) (-2165.045) [-2154.648] * (-2161.545) [-2154.568] (-2157.352) (-2159.651) -- 0:00:47 821000 -- [-2157.267] (-2162.241) (-2153.634) (-2156.614) * [-2152.114] (-2151.072) (-2163.106) (-2159.066) -- 0:00:47 821500 -- (-2159.087) (-2175.435) (-2159.707) [-2152.475] * [-2150.371] (-2153.027) (-2161.920) (-2153.647) -- 0:00:47 822000 -- [-2156.538] (-2177.698) (-2156.727) (-2156.581) * [-2157.388] (-2157.659) (-2159.085) (-2159.479) -- 0:00:47 822500 -- (-2156.288) (-2167.490) (-2161.807) [-2155.411] * [-2155.919] (-2162.165) (-2155.083) (-2161.523) -- 0:00:47 823000 -- (-2157.363) [-2155.399] (-2159.633) (-2158.978) * (-2159.037) [-2161.720] (-2159.734) (-2155.277) -- 0:00:47 823500 -- (-2151.980) [-2156.324] (-2153.830) (-2159.084) * (-2154.248) (-2163.607) (-2155.783) [-2157.562] -- 0:00:46 824000 -- (-2158.473) (-2154.212) [-2157.534] (-2153.489) * [-2160.826] (-2179.627) (-2165.500) (-2157.974) -- 0:00:46 824500 -- (-2158.959) (-2157.135) (-2158.720) [-2156.195] * (-2158.110) [-2170.212] (-2152.289) (-2156.184) -- 0:00:46 825000 -- (-2156.290) (-2155.361) [-2158.382] (-2164.055) * (-2160.075) (-2160.887) (-2156.816) [-2157.542] -- 0:00:46 Average standard deviation of split frequencies: 0.002996 825500 -- [-2154.040] (-2153.084) (-2160.310) (-2164.730) * [-2162.149] (-2162.271) (-2159.259) (-2163.333) -- 0:00:46 826000 -- [-2156.499] (-2160.278) (-2156.152) (-2160.903) * (-2164.212) (-2155.435) (-2160.397) [-2160.209] -- 0:00:46 826500 -- (-2153.325) [-2154.101] (-2161.417) (-2162.644) * (-2160.243) (-2153.720) (-2168.492) [-2162.798] -- 0:00:46 827000 -- (-2158.490) [-2153.499] (-2154.950) (-2157.721) * [-2161.469] (-2156.022) (-2159.379) (-2162.202) -- 0:00:46 827500 -- (-2155.834) [-2154.460] (-2160.561) (-2154.973) * (-2157.934) [-2155.693] (-2157.465) (-2161.195) -- 0:00:45 828000 -- (-2159.177) (-2156.999) (-2161.359) [-2154.950] * (-2162.065) [-2154.237] (-2157.233) (-2159.413) -- 0:00:45 828500 -- (-2155.072) [-2157.065] (-2159.572) (-2159.193) * (-2163.058) [-2154.538] (-2157.954) (-2157.398) -- 0:00:45 829000 -- (-2156.348) (-2161.791) [-2159.980] (-2162.327) * (-2162.290) [-2154.118] (-2157.052) (-2149.897) -- 0:00:45 829500 -- (-2165.250) (-2156.595) (-2154.457) [-2154.766] * [-2156.818] (-2156.741) (-2156.180) (-2162.247) -- 0:00:45 830000 -- (-2167.765) (-2154.643) (-2163.086) [-2156.512] * (-2154.646) (-2152.551) [-2156.889] (-2157.656) -- 0:00:45 Average standard deviation of split frequencies: 0.002838 830500 -- (-2158.187) [-2154.460] (-2159.322) (-2160.936) * (-2155.708) (-2156.162) (-2157.528) [-2158.321] -- 0:00:45 831000 -- (-2160.617) (-2157.767) (-2151.758) [-2154.560] * [-2162.408] (-2160.164) (-2156.410) (-2157.945) -- 0:00:44 831500 -- (-2153.799) (-2159.285) [-2149.935] (-2166.296) * (-2152.504) (-2154.128) [-2155.935] (-2160.228) -- 0:00:44 832000 -- (-2164.321) [-2153.159] (-2157.872) (-2158.687) * [-2158.094] (-2163.715) (-2158.472) (-2158.207) -- 0:00:44 832500 -- [-2155.606] (-2159.081) (-2162.881) (-2156.184) * [-2151.875] (-2164.745) (-2161.058) (-2163.120) -- 0:00:44 833000 -- [-2157.580] (-2150.404) (-2165.134) (-2156.310) * (-2153.126) [-2151.893] (-2157.151) (-2153.592) -- 0:00:44 833500 -- (-2152.573) (-2153.664) (-2159.060) [-2159.958] * (-2158.147) [-2154.825] (-2157.518) (-2156.761) -- 0:00:44 834000 -- (-2160.236) (-2157.954) [-2158.140] (-2152.965) * (-2154.225) [-2156.753] (-2155.250) (-2160.758) -- 0:00:44 834500 -- (-2159.906) (-2161.922) (-2160.489) [-2154.924] * [-2155.157] (-2156.168) (-2157.210) (-2168.214) -- 0:00:44 835000 -- [-2156.552] (-2160.229) (-2159.858) (-2155.007) * (-2157.641) (-2155.712) (-2155.798) [-2154.214] -- 0:00:43 Average standard deviation of split frequencies: 0.002960 835500 -- [-2156.002] (-2162.478) (-2157.558) (-2153.944) * (-2156.712) [-2155.473] (-2158.746) (-2159.073) -- 0:00:43 836000 -- (-2152.991) (-2160.209) [-2158.107] (-2158.835) * (-2159.187) (-2157.765) [-2153.773] (-2164.871) -- 0:00:43 836500 -- (-2156.014) (-2160.311) (-2156.386) [-2162.662] * (-2153.305) (-2154.340) [-2161.844] (-2161.355) -- 0:00:43 837000 -- (-2158.562) (-2161.024) (-2155.461) [-2163.809] * (-2154.062) (-2158.623) (-2156.696) [-2152.481] -- 0:00:43 837500 -- [-2155.800] (-2155.727) (-2162.874) (-2153.856) * [-2154.835] (-2154.329) (-2161.207) (-2160.651) -- 0:00:43 838000 -- (-2154.900) [-2158.609] (-2153.672) (-2157.156) * (-2156.031) [-2158.756] (-2157.610) (-2159.799) -- 0:00:43 838500 -- [-2152.074] (-2156.010) (-2154.425) (-2159.683) * (-2156.607) [-2158.554] (-2154.954) (-2170.682) -- 0:00:42 839000 -- [-2154.129] (-2149.561) (-2159.107) (-2154.906) * (-2160.001) (-2156.726) (-2167.473) [-2158.280] -- 0:00:42 839500 -- [-2152.973] (-2157.105) (-2152.279) (-2155.822) * (-2156.825) (-2159.625) (-2155.509) [-2154.293] -- 0:00:42 840000 -- (-2162.676) (-2155.306) (-2154.797) [-2154.433] * (-2155.755) [-2153.515] (-2156.592) (-2158.271) -- 0:00:42 Average standard deviation of split frequencies: 0.002944 840500 -- (-2164.009) (-2154.433) [-2152.404] (-2155.638) * (-2154.926) (-2156.034) (-2157.870) [-2153.685] -- 0:00:42 841000 -- (-2166.266) (-2153.550) (-2163.477) [-2153.692] * (-2163.725) (-2159.215) (-2157.221) [-2156.998] -- 0:00:42 841500 -- (-2162.503) [-2154.210] (-2153.943) (-2152.352) * (-2158.498) [-2155.919] (-2155.902) (-2166.147) -- 0:00:42 842000 -- [-2159.604] (-2155.528) (-2164.216) (-2153.811) * (-2169.163) (-2158.288) [-2155.007] (-2156.639) -- 0:00:42 842500 -- (-2159.202) [-2165.471] (-2160.400) (-2161.330) * (-2170.161) (-2163.808) (-2154.024) [-2158.069] -- 0:00:41 843000 -- (-2152.895) (-2156.343) (-2160.665) [-2156.928] * (-2165.949) [-2159.227] (-2158.680) (-2162.803) -- 0:00:41 843500 -- [-2152.035] (-2160.252) (-2161.020) (-2160.879) * (-2165.911) (-2158.205) [-2155.540] (-2164.391) -- 0:00:41 844000 -- (-2156.672) [-2158.025] (-2158.718) (-2157.290) * (-2155.167) [-2162.079] (-2157.558) (-2159.973) -- 0:00:41 844500 -- (-2157.873) (-2164.903) (-2158.305) [-2153.484] * (-2154.603) (-2154.207) (-2154.851) [-2157.041] -- 0:00:41 845000 -- (-2162.645) [-2153.769] (-2156.362) (-2154.661) * (-2156.821) [-2164.442] (-2156.427) (-2167.059) -- 0:00:41 Average standard deviation of split frequencies: 0.003065 845500 -- (-2167.955) [-2155.042] (-2155.061) (-2153.299) * [-2152.936] (-2153.125) (-2155.415) (-2157.930) -- 0:00:41 846000 -- (-2165.301) [-2159.116] (-2156.951) (-2150.085) * (-2158.064) [-2154.925] (-2155.423) (-2165.447) -- 0:00:40 846500 -- (-2164.952) [-2159.999] (-2155.440) (-2157.326) * (-2162.201) [-2153.868] (-2153.278) (-2160.351) -- 0:00:40 847000 -- (-2162.473) (-2158.029) (-2160.939) [-2151.066] * [-2151.267] (-2151.246) (-2152.196) (-2164.721) -- 0:00:40 847500 -- (-2157.474) [-2153.148] (-2160.626) (-2154.804) * (-2157.910) (-2164.437) [-2153.199] (-2160.478) -- 0:00:40 848000 -- (-2156.661) (-2152.088) [-2153.863] (-2152.413) * [-2156.824] (-2157.656) (-2166.751) (-2158.232) -- 0:00:40 848500 -- [-2153.772] (-2157.534) (-2157.515) (-2158.371) * (-2153.712) (-2159.427) [-2155.956] (-2158.452) -- 0:00:40 849000 -- (-2157.968) [-2157.765] (-2158.209) (-2163.980) * (-2153.556) (-2161.724) (-2154.366) [-2162.707] -- 0:00:40 849500 -- [-2157.527] (-2157.684) (-2154.126) (-2156.668) * (-2156.067) [-2154.879] (-2156.330) (-2158.643) -- 0:00:40 850000 -- [-2155.185] (-2156.187) (-2157.975) (-2157.473) * (-2160.095) [-2158.538] (-2166.623) (-2159.532) -- 0:00:39 Average standard deviation of split frequencies: 0.003325 850500 -- (-2158.562) (-2153.988) (-2156.356) [-2154.900] * (-2165.951) [-2158.706] (-2157.991) (-2159.034) -- 0:00:39 851000 -- (-2158.956) (-2159.161) (-2155.877) [-2160.791] * (-2165.924) [-2161.379] (-2158.153) (-2161.382) -- 0:00:39 851500 -- (-2155.260) (-2161.422) [-2155.499] (-2158.425) * (-2157.385) (-2159.228) (-2169.118) [-2161.810] -- 0:00:39 852000 -- [-2154.083] (-2156.058) (-2159.639) (-2155.871) * (-2159.095) [-2160.305] (-2153.381) (-2163.899) -- 0:00:39 852500 -- (-2155.298) (-2156.411) (-2153.352) [-2152.148] * (-2156.247) (-2161.471) [-2152.302] (-2155.170) -- 0:00:39 853000 -- (-2155.968) (-2155.339) [-2154.764] (-2152.792) * (-2157.331) (-2158.208) [-2161.942] (-2154.729) -- 0:00:39 853500 -- (-2156.245) (-2162.804) [-2157.165] (-2164.822) * (-2156.427) (-2154.220) (-2156.077) [-2156.012] -- 0:00:38 854000 -- (-2168.417) (-2158.882) [-2155.624] (-2157.396) * (-2158.214) [-2156.892] (-2154.615) (-2156.570) -- 0:00:38 854500 -- [-2162.745] (-2156.929) (-2158.176) (-2158.276) * (-2153.562) (-2156.834) [-2154.547] (-2159.506) -- 0:00:38 855000 -- (-2163.402) [-2157.301] (-2155.334) (-2159.765) * (-2159.346) (-2165.588) [-2152.262] (-2157.596) -- 0:00:38 Average standard deviation of split frequencies: 0.003029 855500 -- [-2153.674] (-2155.184) (-2167.240) (-2156.891) * (-2155.392) [-2156.307] (-2158.106) (-2157.797) -- 0:00:38 856000 -- (-2154.856) [-2158.015] (-2157.647) (-2162.996) * (-2153.852) (-2161.297) [-2156.925] (-2159.747) -- 0:00:38 856500 -- (-2156.653) (-2152.886) [-2158.937] (-2154.311) * (-2153.262) [-2154.169] (-2160.080) (-2154.845) -- 0:00:38 857000 -- [-2155.475] (-2161.361) (-2161.174) (-2160.480) * (-2156.741) [-2156.000] (-2166.690) (-2154.242) -- 0:00:38 857500 -- (-2160.096) (-2158.235) [-2153.142] (-2162.084) * (-2157.875) (-2158.367) (-2163.390) [-2155.914] -- 0:00:37 858000 -- [-2160.628] (-2159.884) (-2158.635) (-2158.681) * (-2161.465) [-2160.116] (-2161.629) (-2158.051) -- 0:00:37 858500 -- (-2153.950) (-2164.503) [-2157.463] (-2162.300) * (-2163.578) (-2151.718) (-2158.990) [-2155.655] -- 0:00:37 859000 -- (-2160.260) [-2156.094] (-2154.551) (-2165.001) * (-2157.288) (-2153.505) [-2157.336] (-2153.524) -- 0:00:37 859500 -- (-2156.271) (-2157.584) (-2161.929) [-2155.814] * (-2157.018) (-2154.196) (-2157.286) [-2156.109] -- 0:00:37 860000 -- [-2162.529] (-2161.425) (-2167.371) (-2163.246) * (-2166.336) (-2159.472) (-2155.774) [-2155.846] -- 0:00:37 Average standard deviation of split frequencies: 0.002876 860500 -- (-2161.799) (-2162.857) [-2159.967] (-2157.012) * (-2170.372) (-2153.273) (-2160.886) [-2153.648] -- 0:00:37 861000 -- [-2151.966] (-2165.222) (-2168.767) (-2158.928) * (-2154.712) (-2161.225) [-2155.687] (-2158.551) -- 0:00:36 861500 -- (-2154.001) [-2156.102] (-2154.306) (-2153.481) * (-2155.186) (-2167.975) [-2158.078] (-2165.639) -- 0:00:36 862000 -- [-2154.223] (-2160.128) (-2154.776) (-2162.896) * (-2156.804) (-2161.588) [-2151.850] (-2166.232) -- 0:00:36 862500 -- (-2157.185) (-2159.166) (-2158.264) [-2155.009] * (-2162.322) (-2159.081) (-2155.609) [-2153.249] -- 0:00:36 863000 -- (-2152.944) [-2157.295] (-2158.875) (-2157.432) * (-2156.208) (-2153.673) [-2155.107] (-2158.251) -- 0:00:36 863500 -- (-2155.856) (-2160.373) (-2156.989) [-2150.542] * (-2155.933) [-2156.526] (-2159.085) (-2161.687) -- 0:00:36 864000 -- (-2152.402) (-2158.336) (-2156.010) [-2152.725] * (-2152.943) (-2156.387) [-2157.252] (-2160.189) -- 0:00:36 864500 -- (-2155.790) [-2153.657] (-2156.993) (-2155.624) * (-2156.612) (-2153.680) (-2159.010) [-2156.254] -- 0:00:36 865000 -- (-2158.571) (-2156.447) (-2156.990) [-2159.003] * (-2157.716) [-2152.233] (-2156.905) (-2159.421) -- 0:00:35 Average standard deviation of split frequencies: 0.002858 865500 -- [-2156.631] (-2156.936) (-2155.408) (-2162.146) * (-2164.941) (-2157.987) (-2157.945) [-2155.159] -- 0:00:35 866000 -- (-2158.285) [-2155.497] (-2159.838) (-2157.870) * (-2165.502) (-2159.058) [-2157.660] (-2153.277) -- 0:00:35 866500 -- [-2157.117] (-2156.935) (-2156.656) (-2163.149) * [-2154.360] (-2156.305) (-2166.838) (-2161.548) -- 0:00:35 867000 -- (-2159.580) (-2161.408) (-2158.127) [-2162.355] * [-2153.112] (-2157.102) (-2156.720) (-2151.647) -- 0:00:35 867500 -- [-2155.317] (-2154.409) (-2156.330) (-2159.982) * [-2153.027] (-2160.154) (-2156.127) (-2155.381) -- 0:00:35 868000 -- (-2156.902) [-2154.700] (-2158.688) (-2162.696) * (-2159.200) (-2156.814) [-2156.167] (-2161.297) -- 0:00:35 868500 -- (-2165.946) (-2154.161) (-2154.232) [-2159.401] * [-2155.297] (-2156.463) (-2156.690) (-2158.239) -- 0:00:34 869000 -- (-2161.041) (-2161.933) [-2151.609] (-2156.960) * (-2156.018) (-2158.888) (-2155.996) [-2158.898] -- 0:00:34 869500 -- (-2162.020) (-2162.806) [-2152.591] (-2154.188) * [-2156.556] (-2151.429) (-2158.728) (-2158.318) -- 0:00:34 870000 -- (-2155.391) (-2162.109) [-2156.936] (-2158.617) * [-2151.629] (-2156.666) (-2152.548) (-2156.227) -- 0:00:34 Average standard deviation of split frequencies: 0.003113 870500 -- (-2159.733) (-2163.645) [-2159.104] (-2157.778) * (-2158.017) (-2157.701) [-2153.214] (-2155.366) -- 0:00:34 871000 -- (-2157.796) (-2165.677) (-2164.284) [-2155.793] * [-2153.788] (-2155.738) (-2157.052) (-2164.226) -- 0:00:34 871500 -- (-2152.879) (-2159.950) [-2160.472] (-2166.522) * [-2156.586] (-2163.320) (-2155.756) (-2151.967) -- 0:00:34 872000 -- (-2155.383) (-2154.362) [-2151.747] (-2152.639) * [-2154.109] (-2168.012) (-2161.028) (-2162.035) -- 0:00:34 872500 -- (-2157.222) [-2160.599] (-2157.127) (-2166.817) * (-2156.872) [-2157.117] (-2159.163) (-2156.051) -- 0:00:33 873000 -- [-2156.726] (-2166.334) (-2163.383) (-2155.801) * [-2151.886] (-2157.331) (-2167.983) (-2151.681) -- 0:00:33 873500 -- (-2155.798) (-2155.253) (-2159.419) [-2151.182] * [-2153.565] (-2159.053) (-2158.414) (-2157.357) -- 0:00:33 874000 -- (-2160.562) (-2159.546) (-2160.369) [-2155.911] * (-2155.181) (-2158.912) [-2157.592] (-2165.972) -- 0:00:33 874500 -- (-2160.339) (-2157.675) [-2158.154] (-2153.162) * (-2158.636) (-2160.123) [-2152.884] (-2158.682) -- 0:00:33 875000 -- (-2163.339) (-2155.814) [-2156.732] (-2158.080) * (-2156.912) (-2152.867) (-2154.384) [-2158.869] -- 0:00:33 Average standard deviation of split frequencies: 0.003094 875500 -- (-2156.531) (-2155.222) [-2155.018] (-2154.412) * (-2157.397) (-2152.838) [-2159.057] (-2160.215) -- 0:00:33 876000 -- (-2155.854) [-2151.222] (-2162.602) (-2156.872) * (-2157.031) [-2151.965] (-2158.222) (-2157.435) -- 0:00:32 876500 -- (-2155.808) (-2165.196) (-2152.237) [-2155.523] * [-2153.506] (-2153.077) (-2154.600) (-2154.464) -- 0:00:32 877000 -- (-2156.480) [-2161.366] (-2155.993) (-2157.110) * (-2153.686) [-2151.655] (-2159.270) (-2159.171) -- 0:00:32 877500 -- (-2155.129) (-2165.182) [-2154.602] (-2159.414) * (-2162.259) (-2159.270) [-2161.565] (-2161.093) -- 0:00:32 878000 -- (-2159.245) [-2153.793] (-2161.380) (-2154.000) * [-2151.424] (-2162.673) (-2156.459) (-2160.718) -- 0:00:32 878500 -- [-2159.137] (-2153.341) (-2160.860) (-2154.675) * [-2155.677] (-2163.292) (-2158.862) (-2158.859) -- 0:00:32 879000 -- (-2165.252) (-2163.300) [-2153.126] (-2162.000) * (-2163.153) (-2155.487) (-2159.006) [-2160.100] -- 0:00:32 879500 -- (-2160.682) [-2159.104] (-2162.035) (-2167.667) * (-2159.241) (-2156.855) (-2164.274) [-2152.098] -- 0:00:32 880000 -- [-2154.828] (-2157.493) (-2163.024) (-2154.227) * (-2154.076) [-2155.616] (-2164.316) (-2159.293) -- 0:00:31 Average standard deviation of split frequencies: 0.002944 880500 -- [-2153.552] (-2159.830) (-2155.709) (-2151.226) * (-2157.694) (-2157.241) [-2153.922] (-2156.799) -- 0:00:31 881000 -- (-2158.891) (-2158.301) [-2157.925] (-2166.048) * (-2159.549) (-2157.674) (-2153.013) [-2158.251] -- 0:00:31 881500 -- (-2150.779) (-2155.959) (-2155.406) [-2150.847] * (-2162.266) (-2156.878) [-2154.459] (-2157.341) -- 0:00:31 882000 -- (-2169.863) (-2158.700) (-2155.934) [-2155.533] * (-2154.314) (-2159.028) (-2157.432) [-2155.712] -- 0:00:31 882500 -- (-2160.549) (-2156.911) [-2160.032] (-2163.437) * [-2157.690] (-2156.216) (-2159.504) (-2159.399) -- 0:00:31 883000 -- (-2159.488) (-2156.212) [-2156.822] (-2161.337) * [-2153.492] (-2159.984) (-2159.406) (-2160.621) -- 0:00:31 883500 -- (-2161.838) (-2152.151) (-2161.217) [-2159.037] * [-2153.185] (-2158.130) (-2155.387) (-2159.761) -- 0:00:30 884000 -- (-2153.547) (-2161.829) [-2156.837] (-2161.434) * (-2159.435) (-2155.237) [-2154.501] (-2162.222) -- 0:00:30 884500 -- (-2160.330) (-2158.419) [-2156.453] (-2154.189) * (-2166.163) (-2158.021) [-2156.471] (-2157.174) -- 0:00:30 885000 -- (-2156.974) (-2152.999) (-2157.583) [-2159.681] * (-2150.139) (-2160.600) (-2156.295) [-2151.495] -- 0:00:30 Average standard deviation of split frequencies: 0.003059 885500 -- (-2158.240) (-2154.767) (-2163.457) [-2160.406] * (-2153.971) (-2160.887) [-2154.653] (-2159.040) -- 0:00:30 886000 -- [-2162.379] (-2155.504) (-2156.495) (-2156.003) * (-2156.656) (-2153.926) [-2159.651] (-2162.606) -- 0:00:30 886500 -- [-2158.751] (-2162.355) (-2162.985) (-2156.411) * (-2158.765) [-2157.173] (-2155.174) (-2153.397) -- 0:00:30 887000 -- [-2153.931] (-2156.841) (-2161.474) (-2160.435) * (-2155.157) (-2166.504) (-2166.157) [-2154.278] -- 0:00:30 887500 -- (-2153.645) (-2160.952) [-2157.459] (-2160.483) * (-2159.421) (-2162.391) [-2156.412] (-2154.493) -- 0:00:29 888000 -- (-2162.066) (-2153.847) (-2162.528) [-2155.388] * [-2159.268] (-2161.716) (-2157.782) (-2155.187) -- 0:00:29 888500 -- (-2160.516) (-2159.176) [-2153.966] (-2157.180) * (-2159.428) (-2156.138) [-2151.949] (-2157.796) -- 0:00:29 889000 -- [-2154.802] (-2156.643) (-2159.718) (-2162.373) * (-2157.585) [-2156.129] (-2157.069) (-2149.551) -- 0:00:29 889500 -- (-2156.253) (-2158.160) [-2152.671] (-2166.903) * (-2164.949) (-2155.767) (-2154.400) [-2153.664] -- 0:00:29 890000 -- (-2153.378) [-2155.018] (-2152.937) (-2156.599) * (-2154.670) (-2163.544) (-2156.686) [-2152.805] -- 0:00:29 Average standard deviation of split frequencies: 0.003176 890500 -- (-2159.209) (-2155.765) (-2153.993) [-2155.364] * [-2155.155] (-2153.337) (-2161.655) (-2157.081) -- 0:00:29 891000 -- (-2157.694) (-2164.770) (-2160.110) [-2157.076] * (-2162.341) (-2155.808) (-2157.203) [-2154.777] -- 0:00:28 891500 -- [-2157.174] (-2158.281) (-2152.911) (-2161.486) * (-2154.732) (-2165.501) (-2151.256) [-2156.409] -- 0:00:28 892000 -- (-2161.997) (-2165.266) (-2153.797) [-2157.649] * (-2156.014) (-2155.694) (-2155.447) [-2162.051] -- 0:00:28 892500 -- (-2159.786) (-2172.637) (-2162.198) [-2154.841] * (-2158.772) (-2161.861) [-2154.402] (-2155.095) -- 0:00:28 893000 -- (-2154.621) (-2158.942) (-2157.182) [-2153.256] * (-2155.709) (-2158.185) [-2157.386] (-2164.041) -- 0:00:28 893500 -- [-2153.947] (-2154.637) (-2155.746) (-2156.673) * [-2154.801] (-2155.678) (-2154.963) (-2151.434) -- 0:00:28 894000 -- (-2153.105) (-2158.677) [-2160.787] (-2155.468) * (-2152.984) (-2157.740) (-2156.522) [-2155.286] -- 0:00:28 894500 -- (-2161.309) (-2158.662) (-2152.899) [-2155.997] * (-2155.675) (-2161.405) (-2157.186) [-2158.922] -- 0:00:28 895000 -- (-2158.951) (-2157.776) (-2155.220) [-2157.376] * (-2162.432) (-2156.252) [-2157.364] (-2158.301) -- 0:00:27 Average standard deviation of split frequencies: 0.003157 895500 -- (-2162.254) [-2151.775] (-2162.583) (-2158.218) * (-2155.433) [-2156.584] (-2153.877) (-2159.827) -- 0:00:27 896000 -- (-2154.371) [-2151.851] (-2159.668) (-2158.931) * (-2169.621) (-2161.083) (-2160.966) [-2158.725] -- 0:00:27 896500 -- (-2155.142) [-2154.442] (-2166.557) (-2155.008) * (-2155.010) [-2154.644] (-2164.503) (-2156.354) -- 0:00:27 897000 -- (-2151.045) (-2159.544) (-2158.318) [-2156.474] * [-2155.471] (-2152.280) (-2163.954) (-2158.631) -- 0:00:27 897500 -- (-2153.240) (-2156.164) (-2154.231) [-2157.402] * (-2152.985) (-2163.350) [-2157.725] (-2153.402) -- 0:00:27 898000 -- (-2159.482) [-2157.452] (-2155.862) (-2157.185) * (-2156.486) (-2156.019) (-2155.348) [-2157.186] -- 0:00:27 898500 -- (-2157.381) [-2163.820] (-2153.348) (-2159.364) * (-2165.599) [-2154.533] (-2151.367) (-2164.451) -- 0:00:26 899000 -- [-2156.644] (-2164.076) (-2162.273) (-2153.362) * (-2161.002) (-2159.446) [-2152.831] (-2157.272) -- 0:00:26 899500 -- (-2162.975) [-2158.191] (-2157.566) (-2159.164) * [-2152.049] (-2163.259) (-2153.123) (-2160.820) -- 0:00:26 900000 -- [-2151.401] (-2156.782) (-2155.431) (-2157.257) * [-2155.791] (-2151.011) (-2160.406) (-2165.306) -- 0:00:26 Average standard deviation of split frequencies: 0.003271 900500 -- (-2158.623) (-2156.063) [-2155.150] (-2163.336) * [-2155.607] (-2153.452) (-2155.490) (-2164.661) -- 0:00:26 901000 -- (-2154.546) [-2157.425] (-2160.393) (-2161.453) * (-2154.171) (-2158.270) [-2157.547] (-2159.328) -- 0:00:26 901500 -- [-2158.598] (-2160.777) (-2163.523) (-2160.099) * (-2155.218) [-2168.429] (-2153.646) (-2157.645) -- 0:00:26 902000 -- (-2154.996) (-2156.558) [-2155.020] (-2161.757) * [-2161.996] (-2155.573) (-2156.811) (-2158.944) -- 0:00:26 902500 -- [-2154.038] (-2161.299) (-2154.774) (-2161.744) * [-2154.084] (-2159.156) (-2158.146) (-2154.431) -- 0:00:25 903000 -- (-2159.377) [-2159.314] (-2155.701) (-2161.087) * [-2153.083] (-2160.816) (-2160.268) (-2154.387) -- 0:00:25 903500 -- (-2160.228) [-2157.406] (-2161.088) (-2153.041) * (-2159.697) (-2164.956) (-2163.115) [-2156.085] -- 0:00:25 904000 -- (-2156.279) (-2165.947) [-2161.535] (-2150.839) * (-2154.765) (-2160.117) (-2156.122) [-2156.433] -- 0:00:25 904500 -- (-2156.149) [-2157.108] (-2154.455) (-2168.857) * (-2161.610) (-2166.639) [-2155.251] (-2152.624) -- 0:00:25 905000 -- (-2156.730) [-2159.418] (-2153.318) (-2164.261) * (-2163.353) (-2161.153) (-2156.738) [-2161.597] -- 0:00:25 Average standard deviation of split frequencies: 0.003252 905500 -- (-2150.696) [-2157.537] (-2152.268) (-2164.782) * (-2167.633) (-2158.055) [-2152.786] (-2153.207) -- 0:00:25 906000 -- (-2154.930) (-2157.229) [-2160.655] (-2164.460) * (-2156.228) [-2158.452] (-2157.362) (-2154.026) -- 0:00:25 906500 -- (-2157.679) (-2151.941) (-2160.063) [-2164.234] * (-2163.707) (-2157.773) [-2153.752] (-2158.583) -- 0:00:24 907000 -- (-2156.569) [-2156.165] (-2159.301) (-2157.896) * (-2162.686) (-2159.829) (-2156.533) [-2152.299] -- 0:00:24 907500 -- (-2152.486) [-2155.506] (-2157.172) (-2153.599) * (-2163.841) (-2158.102) [-2154.012] (-2151.235) -- 0:00:24 908000 -- (-2162.290) (-2155.877) [-2158.087] (-2157.473) * (-2153.178) (-2160.438) [-2158.762] (-2158.997) -- 0:00:24 908500 -- (-2162.617) (-2156.327) (-2155.392) [-2156.481] * (-2159.366) (-2154.739) [-2151.224] (-2151.847) -- 0:00:24 909000 -- (-2156.194) (-2155.850) [-2161.235] (-2157.593) * (-2153.259) (-2168.117) [-2153.882] (-2152.819) -- 0:00:24 909500 -- (-2159.616) [-2157.093] (-2157.202) (-2155.200) * [-2154.104] (-2172.778) (-2159.673) (-2159.546) -- 0:00:24 910000 -- (-2156.144) (-2162.065) [-2157.067] (-2156.963) * [-2154.249] (-2172.013) (-2156.611) (-2160.238) -- 0:00:23 Average standard deviation of split frequencies: 0.003235 910500 -- (-2155.701) (-2152.449) [-2167.067] (-2154.480) * (-2155.278) (-2159.020) [-2155.653] (-2158.196) -- 0:00:23 911000 -- (-2155.132) (-2158.168) [-2151.580] (-2153.941) * [-2153.363] (-2154.668) (-2152.852) (-2159.644) -- 0:00:23 911500 -- (-2151.377) (-2157.549) (-2156.044) [-2164.008] * [-2153.724] (-2157.295) (-2160.043) (-2157.559) -- 0:00:23 912000 -- [-2161.455] (-2161.880) (-2169.290) (-2156.566) * [-2158.961] (-2161.331) (-2157.998) (-2157.179) -- 0:00:23 912500 -- (-2154.242) [-2159.928] (-2161.561) (-2157.700) * (-2158.046) (-2164.643) [-2153.884] (-2160.211) -- 0:00:23 913000 -- (-2152.614) [-2159.420] (-2159.341) (-2160.407) * (-2153.540) (-2162.581) (-2158.905) [-2157.094] -- 0:00:23 913500 -- (-2164.731) [-2155.868] (-2155.392) (-2155.951) * (-2155.955) (-2151.728) [-2161.004] (-2153.145) -- 0:00:23 914000 -- (-2155.178) (-2157.889) (-2155.006) [-2149.390] * [-2156.189] (-2155.805) (-2157.396) (-2155.113) -- 0:00:22 914500 -- (-2159.699) (-2156.845) [-2161.084] (-2162.436) * (-2154.036) (-2161.857) (-2156.624) [-2150.789] -- 0:00:22 915000 -- (-2153.208) [-2154.945] (-2153.303) (-2152.973) * (-2152.516) [-2157.102] (-2154.884) (-2156.996) -- 0:00:22 Average standard deviation of split frequencies: 0.003345 915500 -- (-2158.216) [-2153.618] (-2155.682) (-2149.453) * (-2161.987) (-2165.137) (-2162.630) [-2155.999] -- 0:00:22 916000 -- (-2160.507) (-2157.444) [-2154.117] (-2157.507) * [-2165.288] (-2165.990) (-2160.830) (-2155.348) -- 0:00:22 916500 -- [-2162.661] (-2157.478) (-2152.869) (-2151.509) * [-2159.739] (-2159.216) (-2158.455) (-2156.907) -- 0:00:22 917000 -- (-2151.660) (-2154.272) (-2153.586) [-2160.779] * (-2158.492) [-2156.761] (-2154.930) (-2157.649) -- 0:00:22 917500 -- [-2154.574] (-2157.347) (-2161.818) (-2157.185) * (-2156.611) (-2157.348) [-2153.779] (-2157.777) -- 0:00:21 918000 -- [-2165.763] (-2155.521) (-2155.941) (-2157.851) * (-2154.674) (-2152.852) (-2154.920) [-2153.198] -- 0:00:21 918500 -- [-2159.479] (-2157.110) (-2161.644) (-2154.825) * (-2156.888) (-2158.582) (-2160.767) [-2159.792] -- 0:00:21 919000 -- (-2160.393) [-2153.688] (-2164.241) (-2162.276) * (-2155.350) (-2157.613) (-2157.978) [-2159.753] -- 0:00:21 919500 -- [-2155.105] (-2157.024) (-2164.437) (-2157.228) * (-2158.510) (-2156.229) (-2155.012) [-2154.760] -- 0:00:21 920000 -- (-2156.996) (-2159.760) [-2160.663] (-2155.832) * (-2153.950) (-2156.636) (-2164.915) [-2154.624] -- 0:00:21 Average standard deviation of split frequencies: 0.003328 920500 -- [-2155.093] (-2159.188) (-2161.307) (-2158.820) * [-2158.379] (-2158.345) (-2163.055) (-2152.879) -- 0:00:21 921000 -- [-2153.768] (-2159.002) (-2168.503) (-2157.470) * (-2159.169) (-2159.581) (-2155.636) [-2156.707] -- 0:00:21 921500 -- (-2159.871) (-2157.425) [-2153.238] (-2154.359) * (-2157.800) (-2162.897) (-2154.671) [-2155.240] -- 0:00:20 922000 -- (-2165.810) [-2152.827] (-2154.223) (-2156.328) * (-2158.212) (-2170.407) [-2157.803] (-2161.710) -- 0:00:20 922500 -- [-2159.075] (-2155.937) (-2155.788) (-2159.697) * [-2155.806] (-2160.536) (-2159.649) (-2160.932) -- 0:00:20 923000 -- (-2157.249) [-2158.998] (-2156.422) (-2157.997) * [-2155.383] (-2158.411) (-2154.038) (-2156.845) -- 0:00:20 923500 -- (-2154.968) (-2163.491) (-2161.629) [-2154.613] * (-2162.539) [-2155.251] (-2163.280) (-2156.940) -- 0:00:20 924000 -- [-2156.523] (-2158.089) (-2160.288) (-2160.742) * [-2163.820] (-2155.743) (-2167.513) (-2155.952) -- 0:00:20 924500 -- [-2159.681] (-2157.344) (-2152.857) (-2160.632) * (-2159.787) (-2159.181) [-2160.063] (-2159.269) -- 0:00:20 925000 -- (-2157.108) (-2164.942) (-2156.701) [-2152.155] * [-2154.790] (-2165.204) (-2166.303) (-2157.988) -- 0:00:19 Average standard deviation of split frequencies: 0.003564 925500 -- (-2157.797) (-2154.367) [-2163.383] (-2160.185) * [-2160.989] (-2162.156) (-2160.836) (-2157.179) -- 0:00:19 926000 -- (-2157.801) (-2157.061) (-2161.351) [-2156.603] * (-2159.147) [-2158.654] (-2162.222) (-2158.741) -- 0:00:19 926500 -- (-2156.076) [-2152.201] (-2166.459) (-2159.966) * (-2160.195) [-2153.304] (-2150.517) (-2153.976) -- 0:00:19 927000 -- (-2156.608) (-2153.930) [-2157.018] (-2151.994) * (-2156.806) (-2163.493) [-2158.533] (-2156.067) -- 0:00:19 927500 -- (-2156.577) (-2160.633) (-2151.877) [-2151.935] * (-2152.228) (-2157.834) (-2163.018) [-2150.702] -- 0:00:19 928000 -- [-2152.689] (-2159.801) (-2163.165) (-2155.074) * [-2151.231] (-2157.808) (-2157.243) (-2154.622) -- 0:00:19 928500 -- (-2166.516) (-2157.339) [-2149.846] (-2162.373) * [-2152.104] (-2151.955) (-2152.006) (-2153.975) -- 0:00:19 929000 -- [-2160.484] (-2163.414) (-2151.167) (-2160.295) * (-2159.867) [-2158.987] (-2159.150) (-2162.876) -- 0:00:18 929500 -- [-2156.633] (-2159.794) (-2154.390) (-2155.313) * [-2156.725] (-2154.964) (-2155.043) (-2160.861) -- 0:00:18 930000 -- [-2153.433] (-2160.996) (-2160.089) (-2156.671) * (-2152.298) [-2153.166] (-2152.435) (-2160.802) -- 0:00:18 Average standard deviation of split frequencies: 0.003419 930500 -- (-2158.650) (-2159.631) (-2158.237) [-2152.012] * (-2156.583) [-2151.639] (-2156.476) (-2152.009) -- 0:00:18 931000 -- (-2153.515) (-2160.609) [-2153.131] (-2159.636) * (-2155.677) (-2162.254) [-2157.142] (-2152.805) -- 0:00:18 931500 -- (-2154.501) [-2158.485] (-2159.547) (-2159.576) * (-2159.911) (-2163.979) [-2160.848] (-2157.897) -- 0:00:18 932000 -- (-2152.502) (-2156.798) (-2152.814) [-2157.114] * (-2163.940) (-2158.730) (-2154.634) [-2162.386] -- 0:00:18 932500 -- (-2156.291) [-2160.593] (-2155.306) (-2158.848) * (-2161.778) (-2158.467) [-2158.502] (-2160.832) -- 0:00:17 933000 -- (-2154.078) (-2162.379) (-2162.587) [-2156.279] * (-2160.910) (-2158.609) [-2157.959] (-2154.283) -- 0:00:17 933500 -- (-2157.159) (-2155.852) (-2156.819) [-2156.374] * (-2163.016) (-2157.673) (-2161.135) [-2164.658] -- 0:00:17 934000 -- (-2156.795) (-2153.806) (-2157.224) [-2155.886] * [-2154.253] (-2156.859) (-2164.497) (-2163.105) -- 0:00:17 934500 -- [-2155.528] (-2155.552) (-2152.861) (-2159.708) * [-2157.292] (-2155.787) (-2158.264) (-2165.564) -- 0:00:17 935000 -- (-2162.588) (-2163.676) [-2155.353] (-2155.536) * [-2158.209] (-2155.578) (-2163.429) (-2157.636) -- 0:00:17 Average standard deviation of split frequencies: 0.003525 935500 -- [-2154.376] (-2155.225) (-2154.437) (-2153.017) * (-2156.039) [-2151.726] (-2160.184) (-2157.550) -- 0:00:17 936000 -- (-2165.206) (-2159.339) (-2161.113) [-2154.659] * (-2156.622) (-2155.795) [-2159.229] (-2167.470) -- 0:00:17 936500 -- (-2150.953) (-2161.919) (-2157.492) [-2151.445] * (-2157.158) (-2156.791) [-2153.324] (-2153.554) -- 0:00:16 937000 -- (-2160.635) [-2150.571] (-2158.564) (-2153.475) * (-2155.908) [-2160.963] (-2158.034) (-2153.841) -- 0:00:16 937500 -- [-2160.287] (-2152.808) (-2159.559) (-2156.527) * (-2162.304) [-2154.548] (-2154.890) (-2160.083) -- 0:00:16 938000 -- (-2159.777) (-2152.860) (-2157.061) [-2153.672] * (-2156.838) (-2161.219) [-2155.608] (-2162.775) -- 0:00:16 938500 -- (-2165.167) [-2156.203] (-2158.256) (-2153.581) * (-2154.827) (-2155.070) (-2162.209) [-2158.825] -- 0:00:16 939000 -- (-2164.893) [-2159.670] (-2165.189) (-2156.729) * [-2158.823] (-2155.047) (-2154.585) (-2158.077) -- 0:00:16 939500 -- [-2159.850] (-2157.857) (-2156.155) (-2155.927) * (-2152.611) (-2161.655) [-2157.856] (-2156.947) -- 0:00:16 940000 -- (-2157.061) (-2155.755) (-2161.489) [-2153.792] * (-2156.926) [-2157.529] (-2156.486) (-2158.104) -- 0:00:15 Average standard deviation of split frequencies: 0.003508 940500 -- (-2159.306) [-2153.277] (-2158.771) (-2159.410) * (-2153.816) (-2162.821) (-2156.774) [-2154.120] -- 0:00:15 941000 -- (-2155.574) [-2154.933] (-2158.684) (-2158.101) * (-2154.850) (-2163.319) (-2158.006) [-2160.511] -- 0:00:15 941500 -- (-2163.469) [-2153.485] (-2160.596) (-2155.925) * (-2167.028) [-2160.857] (-2155.629) (-2162.633) -- 0:00:15 942000 -- [-2155.409] (-2156.610) (-2162.052) (-2159.077) * [-2161.394] (-2161.921) (-2163.186) (-2155.079) -- 0:00:15 942500 -- [-2154.374] (-2153.832) (-2155.819) (-2153.581) * (-2166.242) (-2159.422) [-2158.564] (-2163.792) -- 0:00:15 943000 -- (-2155.999) (-2153.640) [-2154.771] (-2157.209) * (-2162.771) (-2162.725) [-2163.269] (-2157.943) -- 0:00:15 943500 -- (-2155.908) [-2156.665] (-2154.001) (-2159.635) * (-2154.729) (-2163.630) (-2154.857) [-2157.025] -- 0:00:15 944000 -- (-2153.677) (-2156.640) (-2163.087) [-2159.911] * (-2165.999) (-2161.479) [-2161.890] (-2158.689) -- 0:00:14 944500 -- (-2157.943) (-2158.341) [-2153.460] (-2160.725) * [-2159.730] (-2158.760) (-2152.120) (-2154.868) -- 0:00:14 945000 -- (-2165.998) (-2159.398) [-2153.772] (-2162.534) * (-2164.361) (-2160.773) (-2154.260) [-2160.143] -- 0:00:14 Average standard deviation of split frequencies: 0.003488 945500 -- [-2161.913] (-2159.436) (-2154.326) (-2156.352) * (-2159.340) (-2161.461) [-2158.335] (-2158.756) -- 0:00:14 946000 -- (-2159.274) (-2160.839) (-2154.847) [-2162.195] * (-2155.977) (-2161.142) [-2153.912] (-2160.982) -- 0:00:14 946500 -- (-2162.204) (-2159.361) (-2153.949) [-2148.690] * (-2159.032) (-2156.952) (-2157.921) [-2158.475] -- 0:00:14 947000 -- (-2158.455) [-2153.121] (-2154.241) (-2154.578) * (-2155.795) [-2156.005] (-2156.482) (-2155.058) -- 0:00:14 947500 -- (-2157.573) (-2155.165) [-2154.722] (-2161.472) * [-2158.017] (-2163.051) (-2151.564) (-2155.765) -- 0:00:13 948000 -- [-2156.950] (-2155.092) (-2156.268) (-2158.413) * (-2157.767) (-2156.945) [-2158.365] (-2157.462) -- 0:00:13 948500 -- (-2157.704) (-2156.046) (-2158.050) [-2157.913] * (-2158.087) (-2157.066) [-2161.964] (-2155.165) -- 0:00:13 949000 -- (-2161.140) (-2161.525) (-2157.134) [-2154.662] * (-2162.990) (-2159.414) (-2159.258) [-2160.119] -- 0:00:13 949500 -- (-2164.466) (-2157.892) [-2157.150] (-2157.649) * (-2155.972) (-2158.718) [-2154.623] (-2164.932) -- 0:00:13 950000 -- (-2156.015) (-2165.346) (-2160.278) [-2156.356] * (-2163.016) (-2160.537) [-2156.245] (-2158.252) -- 0:00:13 Average standard deviation of split frequencies: 0.003595 950500 -- (-2154.537) (-2156.229) [-2154.338] (-2161.211) * (-2159.070) (-2170.485) [-2154.406] (-2155.803) -- 0:00:13 951000 -- (-2158.849) (-2165.068) (-2157.840) [-2161.837] * (-2164.056) (-2169.068) [-2155.090] (-2157.288) -- 0:00:13 951500 -- (-2165.054) [-2160.339] (-2157.784) (-2158.395) * (-2164.536) (-2154.474) (-2157.687) [-2159.503] -- 0:00:12 952000 -- (-2155.422) (-2154.103) [-2155.398] (-2164.106) * (-2157.345) (-2155.143) [-2161.922] (-2153.962) -- 0:00:12 952500 -- (-2154.302) (-2164.901) [-2155.667] (-2152.024) * (-2155.873) (-2162.564) (-2156.704) [-2162.048] -- 0:00:12 953000 -- (-2163.494) (-2165.961) (-2159.997) [-2153.471] * (-2157.440) [-2153.324] (-2164.063) (-2159.204) -- 0:00:12 953500 -- [-2156.646] (-2160.385) (-2156.977) (-2156.263) * (-2156.751) (-2155.615) [-2153.254] (-2162.301) -- 0:00:12 954000 -- (-2163.327) (-2163.270) (-2164.604) [-2158.051] * (-2159.972) [-2153.079] (-2163.619) (-2160.983) -- 0:00:12 954500 -- [-2154.114] (-2159.438) (-2160.678) (-2153.240) * (-2160.788) (-2155.619) (-2155.736) [-2156.923] -- 0:00:12 955000 -- (-2154.563) (-2153.374) (-2153.585) [-2158.247] * [-2156.524] (-2156.676) (-2156.086) (-2163.005) -- 0:00:11 Average standard deviation of split frequencies: 0.003452 955500 -- [-2154.183] (-2156.543) (-2154.537) (-2156.617) * [-2154.917] (-2159.983) (-2161.065) (-2159.283) -- 0:00:11 956000 -- (-2157.869) (-2162.779) (-2159.338) [-2152.919] * [-2157.219] (-2160.716) (-2157.600) (-2161.378) -- 0:00:11 956500 -- (-2156.246) (-2159.774) [-2157.399] (-2162.818) * (-2158.971) [-2154.150] (-2158.782) (-2166.375) -- 0:00:11 957000 -- (-2161.640) (-2155.866) [-2157.320] (-2154.916) * [-2158.192] (-2156.250) (-2153.583) (-2160.758) -- 0:00:11 957500 -- (-2157.512) (-2155.216) [-2162.414] (-2162.926) * (-2161.569) (-2159.810) (-2150.903) [-2157.837] -- 0:00:11 958000 -- (-2159.706) (-2152.849) (-2164.358) [-2160.428] * [-2153.057] (-2154.323) (-2152.420) (-2161.260) -- 0:00:11 958500 -- (-2155.988) [-2150.803] (-2165.371) (-2151.308) * [-2152.581] (-2159.048) (-2159.057) (-2157.812) -- 0:00:11 959000 -- (-2159.875) (-2153.873) [-2154.703] (-2165.692) * (-2156.785) (-2153.962) (-2158.531) [-2159.214] -- 0:00:10 959500 -- (-2155.354) [-2161.394] (-2154.063) (-2161.222) * [-2159.157] (-2162.538) (-2153.949) (-2157.914) -- 0:00:10 960000 -- (-2158.707) (-2156.135) [-2156.676] (-2160.717) * [-2158.330] (-2155.804) (-2155.016) (-2158.400) -- 0:00:10 Average standard deviation of split frequencies: 0.003312 960500 -- (-2158.899) [-2158.382] (-2151.505) (-2160.095) * (-2162.743) [-2155.805] (-2164.400) (-2160.314) -- 0:00:10 961000 -- (-2158.334) (-2157.519) (-2153.278) [-2157.078] * [-2160.840] (-2162.486) (-2156.723) (-2160.337) -- 0:00:10 961500 -- (-2157.781) [-2152.296] (-2152.925) (-2158.030) * [-2152.415] (-2155.477) (-2157.776) (-2160.044) -- 0:00:10 962000 -- [-2155.530] (-2155.386) (-2156.468) (-2156.465) * (-2153.352) [-2161.216] (-2152.844) (-2156.569) -- 0:00:10 962500 -- (-2154.181) (-2159.429) [-2158.050] (-2157.021) * (-2158.365) [-2155.629] (-2155.114) (-2161.244) -- 0:00:09 963000 -- (-2152.842) (-2157.871) (-2161.143) [-2156.048] * (-2156.026) [-2158.216] (-2161.453) (-2160.026) -- 0:00:09 963500 -- (-2154.686) (-2156.129) (-2156.157) [-2151.164] * (-2156.639) [-2156.683] (-2154.176) (-2159.929) -- 0:00:09 964000 -- (-2154.058) [-2156.856] (-2156.384) (-2158.164) * (-2163.460) (-2153.698) (-2162.548) [-2156.916] -- 0:00:09 964500 -- (-2158.691) (-2158.157) [-2156.193] (-2155.033) * [-2157.467] (-2157.525) (-2158.953) (-2155.687) -- 0:00:09 965000 -- [-2162.359] (-2164.145) (-2158.662) (-2160.872) * (-2152.440) (-2158.341) (-2158.682) [-2158.704] -- 0:00:09 Average standard deviation of split frequencies: 0.003294 965500 -- (-2156.594) [-2157.766] (-2166.644) (-2169.160) * [-2157.207] (-2158.196) (-2170.701) (-2160.582) -- 0:00:09 966000 -- (-2157.639) (-2160.566) (-2160.933) [-2154.629] * (-2165.499) (-2162.859) [-2155.148] (-2154.998) -- 0:00:09 966500 -- (-2165.992) [-2154.143] (-2163.445) (-2159.832) * (-2163.788) [-2157.684] (-2154.863) (-2158.010) -- 0:00:08 967000 -- (-2157.353) (-2158.162) (-2160.045) [-2151.098] * [-2161.274] (-2159.412) (-2153.668) (-2157.399) -- 0:00:08 967500 -- (-2157.557) (-2165.705) (-2152.784) [-2155.219] * [-2158.122] (-2160.996) (-2163.752) (-2157.037) -- 0:00:08 968000 -- (-2169.317) [-2157.423] (-2152.002) (-2153.770) * [-2155.543] (-2154.891) (-2158.673) (-2164.058) -- 0:00:08 968500 -- (-2155.904) (-2159.376) [-2157.052] (-2155.184) * [-2154.865] (-2167.690) (-2157.859) (-2157.538) -- 0:00:08 969000 -- (-2156.245) (-2158.955) (-2174.665) [-2157.830] * (-2155.975) [-2152.711] (-2156.015) (-2160.985) -- 0:00:08 969500 -- (-2159.041) [-2155.366] (-2155.256) (-2158.359) * [-2155.695] (-2164.222) (-2159.800) (-2155.975) -- 0:00:08 970000 -- (-2161.156) (-2156.825) (-2156.611) [-2158.017] * [-2160.001] (-2156.550) (-2152.231) (-2157.544) -- 0:00:07 Average standard deviation of split frequencies: 0.003157 970500 -- (-2160.255) [-2157.903] (-2158.726) (-2160.508) * (-2151.803) (-2152.668) (-2158.141) [-2158.685] -- 0:00:07 971000 -- (-2154.848) [-2152.846] (-2159.735) (-2155.326) * (-2155.095) [-2154.841] (-2151.517) (-2156.582) -- 0:00:07 971500 -- (-2153.706) (-2153.300) (-2166.918) [-2156.307] * (-2164.928) (-2164.065) (-2154.454) [-2154.341] -- 0:00:07 972000 -- (-2154.429) [-2153.102] (-2156.106) (-2154.188) * (-2153.342) (-2160.953) [-2157.000] (-2156.016) -- 0:00:07 972500 -- (-2155.493) [-2157.013] (-2156.425) (-2156.457) * [-2158.730] (-2159.729) (-2151.907) (-2157.469) -- 0:00:07 973000 -- (-2162.795) (-2154.990) (-2157.111) [-2158.398] * [-2159.713] (-2154.108) (-2156.354) (-2160.711) -- 0:00:07 973500 -- [-2164.327] (-2155.562) (-2156.403) (-2161.707) * (-2159.801) (-2159.592) (-2158.449) [-2157.450] -- 0:00:07 974000 -- (-2159.813) (-2159.658) (-2156.541) [-2156.745] * (-2160.167) (-2151.692) [-2152.744] (-2155.046) -- 0:00:06 974500 -- (-2154.042) [-2160.764] (-2161.376) (-2156.733) * [-2164.159] (-2157.314) (-2156.495) (-2157.244) -- 0:00:06 975000 -- (-2166.665) (-2159.108) (-2157.499) [-2153.791] * (-2166.888) [-2155.482] (-2164.341) (-2159.062) -- 0:00:06 Average standard deviation of split frequencies: 0.003139 975500 -- [-2161.128] (-2158.878) (-2159.450) (-2155.974) * (-2163.467) (-2152.054) [-2155.377] (-2160.801) -- 0:00:06 976000 -- (-2161.754) (-2157.050) [-2158.159] (-2160.566) * (-2166.140) [-2155.668] (-2162.724) (-2160.772) -- 0:00:06 976500 -- (-2154.939) (-2155.775) [-2156.592] (-2160.370) * (-2155.405) (-2151.541) [-2159.311] (-2158.739) -- 0:00:06 977000 -- [-2160.014] (-2155.246) (-2159.749) (-2162.908) * [-2151.236] (-2163.374) (-2159.556) (-2163.024) -- 0:00:06 977500 -- (-2156.118) (-2154.188) [-2150.230] (-2164.181) * [-2159.319] (-2152.627) (-2159.277) (-2158.799) -- 0:00:05 978000 -- (-2154.200) (-2155.148) [-2160.030] (-2157.033) * (-2157.438) (-2156.625) [-2154.537] (-2151.283) -- 0:00:05 978500 -- (-2157.019) (-2161.165) (-2155.925) [-2153.839] * (-2160.770) (-2152.774) [-2155.825] (-2154.648) -- 0:00:05 979000 -- (-2153.289) (-2156.185) (-2152.765) [-2158.335] * (-2152.096) [-2155.421] (-2160.110) (-2155.285) -- 0:00:05 979500 -- [-2154.709] (-2163.789) (-2159.666) (-2156.924) * (-2154.887) [-2153.059] (-2161.665) (-2158.489) -- 0:00:05 980000 -- (-2156.417) (-2159.366) [-2153.857] (-2157.021) * (-2153.916) [-2159.273] (-2156.281) (-2158.309) -- 0:00:05 Average standard deviation of split frequencies: 0.003125 980500 -- (-2160.220) [-2153.429] (-2155.165) (-2156.317) * (-2160.272) (-2152.028) (-2158.540) [-2157.925] -- 0:00:05 981000 -- (-2158.818) (-2160.863) (-2160.218) [-2158.828] * [-2152.797] (-2161.907) (-2155.307) (-2167.013) -- 0:00:05 981500 -- (-2156.752) [-2157.841] (-2158.655) (-2157.932) * (-2155.967) (-2158.383) [-2154.626] (-2155.698) -- 0:00:04 982000 -- (-2154.649) (-2159.283) [-2156.359] (-2159.342) * [-2155.679] (-2160.246) (-2161.689) (-2156.599) -- 0:00:04 982500 -- [-2152.553] (-2157.343) (-2161.361) (-2156.793) * [-2156.502] (-2168.073) (-2155.201) (-2159.557) -- 0:00:04 983000 -- (-2156.830) (-2159.795) (-2164.228) [-2161.515] * (-2156.995) (-2156.817) [-2153.517] (-2154.028) -- 0:00:04 983500 -- [-2157.382] (-2155.164) (-2155.514) (-2158.500) * (-2153.147) (-2155.413) (-2161.272) [-2152.738] -- 0:00:04 984000 -- (-2156.525) (-2163.313) [-2155.568] (-2161.313) * (-2158.211) (-2153.435) (-2162.387) [-2156.952] -- 0:00:04 984500 -- (-2154.865) [-2153.614] (-2153.702) (-2163.815) * (-2159.605) [-2151.247] (-2158.969) (-2158.417) -- 0:00:04 985000 -- (-2154.970) (-2158.869) (-2159.032) [-2161.075] * (-2164.326) [-2152.859] (-2157.717) (-2154.388) -- 0:00:03 Average standard deviation of split frequencies: 0.003227 985500 -- (-2158.105) [-2160.199] (-2164.102) (-2155.188) * (-2155.136) (-2150.500) [-2153.275] (-2156.909) -- 0:00:03 986000 -- (-2161.669) (-2156.275) (-2166.444) [-2158.916] * (-2159.554) [-2154.407] (-2159.898) (-2154.568) -- 0:00:03 986500 -- [-2155.263] (-2159.249) (-2162.211) (-2152.222) * (-2164.647) [-2151.305] (-2159.377) (-2159.164) -- 0:00:03 987000 -- (-2156.645) (-2157.406) [-2153.081] (-2166.923) * (-2159.357) (-2152.188) (-2163.657) [-2156.772] -- 0:00:03 987500 -- (-2153.400) [-2150.858] (-2155.970) (-2161.567) * [-2153.994] (-2160.890) (-2172.394) (-2158.753) -- 0:00:03 988000 -- [-2153.160] (-2151.181) (-2158.416) (-2159.064) * (-2158.407) [-2158.274] (-2162.671) (-2166.119) -- 0:00:03 988500 -- (-2159.290) [-2156.376] (-2154.288) (-2161.306) * (-2155.671) (-2151.468) (-2160.862) [-2156.657] -- 0:00:03 989000 -- [-2155.500] (-2158.162) (-2164.287) (-2155.939) * [-2155.285] (-2158.354) (-2167.969) (-2161.727) -- 0:00:02 989500 -- (-2154.779) [-2154.066] (-2169.859) (-2159.718) * (-2156.821) [-2160.377] (-2167.723) (-2161.296) -- 0:00:02 990000 -- [-2151.931] (-2160.879) (-2159.255) (-2156.243) * (-2156.591) (-2152.404) [-2155.467] (-2157.692) -- 0:00:02 Average standard deviation of split frequencies: 0.003450 990500 -- (-2156.154) (-2158.783) (-2157.233) [-2158.570] * (-2155.595) [-2156.012] (-2159.311) (-2162.077) -- 0:00:02 991000 -- (-2159.154) (-2156.944) [-2163.243] (-2158.922) * [-2154.712] (-2158.469) (-2159.831) (-2170.121) -- 0:00:02 991500 -- (-2157.087) [-2152.581] (-2160.169) (-2162.243) * (-2152.768) (-2155.398) (-2153.910) [-2160.904] -- 0:00:02 992000 -- (-2151.742) (-2165.597) [-2154.807] (-2165.296) * [-2159.394] (-2162.737) (-2162.648) (-2160.087) -- 0:00:02 992500 -- [-2160.629] (-2156.555) (-2159.407) (-2159.977) * (-2159.255) (-2160.052) [-2157.515] (-2162.915) -- 0:00:01 993000 -- (-2157.619) [-2151.250] (-2155.159) (-2158.256) * (-2153.082) [-2155.244] (-2157.119) (-2157.326) -- 0:00:01 993500 -- (-2157.550) (-2160.179) [-2159.390] (-2159.006) * (-2154.819) (-2153.391) [-2154.617] (-2155.033) -- 0:00:01 994000 -- [-2152.821] (-2154.353) (-2156.767) (-2156.812) * (-2161.756) (-2163.062) (-2162.120) [-2151.827] -- 0:00:01 994500 -- (-2156.533) (-2151.589) (-2153.304) [-2157.547] * (-2167.174) (-2153.581) [-2160.425] (-2160.581) -- 0:00:01 995000 -- (-2160.659) (-2161.060) [-2155.452] (-2159.058) * (-2163.783) (-2152.537) (-2159.439) [-2164.340] -- 0:00:01 Average standard deviation of split frequencies: 0.003431 995500 -- (-2161.624) (-2161.717) [-2156.438] (-2154.679) * (-2155.503) (-2154.652) [-2151.153] (-2158.019) -- 0:00:01 996000 -- (-2156.689) [-2164.901] (-2157.079) (-2158.044) * [-2156.200] (-2164.401) (-2155.040) (-2156.143) -- 0:00:01 996500 -- (-2156.298) (-2157.592) (-2161.275) [-2154.589] * (-2158.071) (-2165.541) [-2156.950] (-2155.603) -- 0:00:00 997000 -- (-2157.493) (-2161.411) (-2159.285) [-2159.413] * (-2156.527) (-2155.097) (-2159.276) [-2153.595] -- 0:00:00 997500 -- (-2162.466) [-2157.618] (-2158.819) (-2160.283) * (-2159.685) [-2152.941] (-2158.429) (-2158.237) -- 0:00:00 998000 -- (-2158.696) (-2165.170) (-2153.747) [-2157.579] * (-2157.623) (-2165.125) (-2159.431) [-2157.220] -- 0:00:00 998500 -- (-2162.295) (-2152.779) [-2157.982] (-2168.010) * (-2157.996) (-2155.927) (-2156.926) [-2158.283] -- 0:00:00 999000 -- (-2161.039) (-2158.238) (-2162.898) [-2152.592] * (-2163.264) (-2158.326) (-2157.875) [-2160.793] -- 0:00:00 999500 -- (-2160.067) (-2159.759) [-2162.609] (-2160.051) * (-2169.006) [-2158.040] (-2154.391) (-2164.447) -- 0:00:00 1000000 -- (-2159.915) (-2155.996) [-2158.513] (-2160.849) * (-2162.212) [-2154.149] (-2153.581) (-2160.843) -- 0:00:00 Average standard deviation of split frequencies: 0.003533 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -2159.915393 -- 15.909802 Chain 1 -- -2159.915397 -- 15.909802 Chain 2 -- -2155.995785 -- 13.663938 Chain 2 -- -2155.995785 -- 13.663938 Chain 3 -- -2158.512641 -- 12.393601 Chain 3 -- -2158.512638 -- 12.393601 Chain 4 -- -2160.848725 -- 17.840213 Chain 4 -- -2160.848725 -- 17.840213 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -2162.212257 -- 17.244510 Chain 1 -- -2162.212257 -- 17.244510 Chain 2 -- -2154.148733 -- 16.313803 Chain 2 -- -2154.148731 -- 16.313803 Chain 3 -- -2153.581008 -- 16.846465 Chain 3 -- -2153.581011 -- 16.846465 Chain 4 -- -2160.842668 -- 14.620872 Chain 4 -- -2160.842668 -- 14.620872 Analysis completed in 4 mins 26 seconds Analysis used 266.14 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -2147.30 Likelihood of best state for "cold" chain of run 2 was -2147.26 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 50.4 % ( 27 %) Dirichlet(Revmat{all}) 64.2 % ( 44 %) Slider(Revmat{all}) 25.4 % ( 33 %) Dirichlet(Pi{all}) 28.2 % ( 28 %) Slider(Pi{all}) 63.4 % ( 40 %) Multiplier(Alpha{1,2}) 47.6 % ( 23 %) Multiplier(Alpha{3}) 68.5 % ( 45 %) Slider(Pinvar{all}) 5.2 % ( 1 %) ExtSPR(Tau{all},V{all}) 2.6 % ( 3 %) ExtTBR(Tau{all},V{all}) 10.7 % ( 7 %) NNI(Tau{all},V{all}) 18.4 % ( 9 %) ParsSPR(Tau{all},V{all}) 26.2 % ( 22 %) Multiplier(V{all}) 29.5 % ( 35 %) Nodeslider(V{all}) 25.6 % ( 29 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 50.0 % ( 35 %) Dirichlet(Revmat{all}) 64.8 % ( 53 %) Slider(Revmat{all}) 25.0 % ( 24 %) Dirichlet(Pi{all}) 27.4 % ( 23 %) Slider(Pi{all}) 64.0 % ( 34 %) Multiplier(Alpha{1,2}) 47.4 % ( 32 %) Multiplier(Alpha{3}) 69.3 % ( 42 %) Slider(Pinvar{all}) 5.2 % ( 9 %) ExtSPR(Tau{all},V{all}) 2.6 % ( 4 %) ExtTBR(Tau{all},V{all}) 10.7 % ( 11 %) NNI(Tau{all},V{all}) 18.5 % ( 26 %) ParsSPR(Tau{all},V{all}) 26.2 % ( 34 %) Multiplier(V{all}) 29.5 % ( 33 %) Nodeslider(V{all}) 25.4 % ( 23 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.83 0.68 0.55 2 | 166288 0.84 0.70 3 | 167218 166411 0.85 4 | 166786 166286 167011 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.83 0.68 0.55 2 | 166175 0.84 0.70 3 | 167159 166053 0.85 4 | 167045 166892 166676 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -2154.65 | 1 2 | | 1 2 | | 12 1 2 1 2 2 | | 1 1 1 1 2 2 1 1 | | 2 12 1 1 1 1 2 1 *2 1 | |2 2 1 1 222 2 1 1 22 1 22 1 1 | |1*1 2 21 12 1 * 2 1 21 1 2 *11*| | 2 2 222 1 22 1 22 21 * 1 122 2 1 | | 1 * 11 2 2 2 21 2 2 | | 1 * 2 2 | | 1 1 1 | | 2 1 2 1 | | 2 | | | | 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2159.09 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2153.04 -2164.37 2 -2153.40 -2164.03 -------------------------------------- TOTAL -2153.20 -2164.21 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.363418 0.001861 0.283375 0.450777 0.360409 1285.16 1393.08 1.000 r(A<->C){all} 0.115627 0.000766 0.065770 0.173174 0.113733 807.76 833.12 1.000 r(A<->G){all} 0.251008 0.001740 0.171186 0.332182 0.247931 733.45 822.18 1.000 r(A<->T){all} 0.127527 0.001423 0.053400 0.197582 0.125618 829.78 831.18 1.002 r(C<->G){all} 0.081823 0.000416 0.041279 0.119534 0.080294 1059.46 1150.73 1.000 r(C<->T){all} 0.351152 0.002242 0.264134 0.451767 0.348859 826.57 888.74 1.001 r(G<->T){all} 0.072863 0.000596 0.025833 0.119734 0.071162 918.13 924.29 1.000 pi(A){all} 0.231014 0.000178 0.204743 0.256543 0.230715 1060.68 1123.89 1.000 pi(C){all} 0.290926 0.000216 0.261929 0.318381 0.290978 1213.42 1267.66 1.000 pi(G){all} 0.294921 0.000208 0.266537 0.322883 0.294676 1319.56 1340.53 1.000 pi(T){all} 0.183139 0.000152 0.159347 0.207566 0.182859 1155.97 1328.49 1.000 alpha{1,2} 0.070619 0.002386 0.000126 0.159606 0.063830 1188.12 1249.26 1.000 alpha{3} 2.109833 0.636378 0.798454 3.665272 1.974045 1382.83 1441.92 1.001 pinvar{all} 0.197111 0.009192 0.000239 0.359693 0.194418 1004.28 1042.20 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .**... 8 -- ...*** 9 -- ...**. 10 -- ...*.* ------------ Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 3002 1.000000 0.000000 1.000000 1.000000 2 8 3002 1.000000 0.000000 1.000000 1.000000 2 9 1525 0.507995 0.003298 0.505663 0.510326 2 10 1385 0.461359 0.010835 0.453698 0.469021 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.038959 0.000085 0.022775 0.057799 0.038306 1.000 2 length{all}[2] 0.014638 0.000025 0.005811 0.024185 0.014107 1.001 2 length{all}[3] 0.007396 0.000012 0.001351 0.014240 0.006870 1.000 2 length{all}[4] 0.032180 0.000094 0.014853 0.051681 0.031441 1.000 2 length{all}[5] 0.040093 0.000093 0.021441 0.058782 0.039045 1.000 2 length{all}[6] 0.152098 0.000797 0.101000 0.208862 0.149291 1.000 2 length{all}[7] 0.019768 0.000046 0.006866 0.032880 0.019136 1.000 2 length{all}[8] 0.045601 0.000161 0.020091 0.069603 0.044860 1.000 2 length{all}[9] 0.013486 0.000060 0.000158 0.028149 0.012334 0.999 2 length{all}[10] 0.012315 0.000050 0.000076 0.025480 0.011380 1.000 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.003533 Maximum standard deviation of split frequencies = 0.010835 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.001 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | | /------------------------ C4 (4) | /-----------51----------+ | | \------------------------ C5 (5) +----------100----------+ | \------------------------------------------------ C6 (6) | | /------------------------ C2 (2) \----------------------100----------------------+ \------------------------ C3 (3) Phylogram (based on average branch lengths): /-------------- C1 (1) | | /------------ C4 (4) | /---+ | | \--------------- C5 (5) +----------------+ | \------------------------------------------------------- C6 (6) | | /----- C2 (2) \------+ \--- C3 (3) |-----------------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (3 trees sampled): 90 % credible set contains 2 trees 95 % credible set contains 2 trees 99 % credible set contains 3 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 6 ls = 873 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sites with gaps or missing data are removed. 9 ambiguity characters in seq. 1 9 ambiguity characters in seq. 2 9 ambiguity characters in seq. 3 15 ambiguity characters in seq. 4 18 ambiguity characters in seq. 5 15 ambiguity characters in seq. 6 6 sites are removed. 266 267 268 289 290 291 codon 263: TCC TCC TCC TCT TCC AGC codon 264: AGC AGC AGC AGC AGC TCC Sequences read.. Counting site patterns.. 0:00 159 patterns at 285 / 285 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 155184 bytes for conP 21624 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, ((4, 5), 6), (2, 3)); MP score: 166 310368 bytes for conP, adjusted 0.075048 0.073976 0.021547 0.075318 0.089338 0.254734 0.040332 0.031775 0.014361 0.300000 1.300000 ntime & nrate & np: 9 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 11 lnL0 = -2224.562329 Iterating by ming2 Initial: fx= 2224.562329 x= 0.07505 0.07398 0.02155 0.07532 0.08934 0.25473 0.04033 0.03177 0.01436 0.30000 1.30000 1 h-m-p 0.0000 0.0054 261.1043 ++++YCCCCC 2188.602771 5 0.0017 29 | 0/11 2 h-m-p 0.0001 0.0004 446.8518 +YYYCYCCC 2171.393745 7 0.0003 54 | 0/11 3 h-m-p 0.0000 0.0000 5421.3913 +YCYCCC 2161.089445 5 0.0000 77 | 0/11 4 h-m-p 0.0000 0.0001 2054.5946 +YCYCCC 2148.112120 5 0.0001 100 | 0/11 5 h-m-p 0.0000 0.0001 2304.4132 +YYCCCC 2137.991110 5 0.0000 123 | 0/11 6 h-m-p 0.0001 0.0003 186.7741 YCCCC 2136.097210 4 0.0002 144 | 0/11 7 h-m-p 0.0002 0.0057 178.2288 ++YYCYYYYYYY 2067.438275 10 0.0050 171 | 0/11 8 h-m-p 0.0000 0.0001 1323.4007 YYCCCCC 2066.312075 6 0.0000 195 | 0/11 9 h-m-p 0.0015 0.0076 15.4717 CCC 2066.215758 2 0.0006 213 | 0/11 10 h-m-p 0.0003 0.0135 36.0662 +CYC 2065.857393 2 0.0011 231 | 0/11 11 h-m-p 0.0382 0.2053 1.0507 +YCYCCC 2057.363755 5 0.1140 254 | 0/11 12 h-m-p 0.0011 0.0057 52.5416 +YYCYCCC 2035.030572 6 0.0038 278 | 0/11 13 h-m-p 1.1138 5.5692 0.0909 CCYC 2031.863017 3 1.0936 297 | 0/11 14 h-m-p 0.4934 2.5387 0.2015 CCCC 2028.795013 3 0.6708 328 | 0/11 15 h-m-p 1.1830 8.0000 0.1142 YCCC 2028.040719 3 0.7029 358 | 0/11 16 h-m-p 0.6170 8.0000 0.1301 +YC 2026.786170 1 1.6187 385 | 0/11 17 h-m-p 1.6000 8.0000 0.0878 CC 2026.051872 1 1.6000 412 | 0/11 18 h-m-p 1.1872 8.0000 0.1184 YCCC 2025.614365 3 0.8311 442 | 0/11 19 h-m-p 1.3500 8.0000 0.0729 CCC 2025.249062 2 1.4921 471 | 0/11 20 h-m-p 1.6000 8.0000 0.0205 CCC 2025.153023 2 2.3972 500 | 0/11 21 h-m-p 1.6000 8.0000 0.0105 CC 2025.131337 1 2.2325 527 | 0/11 22 h-m-p 1.6000 8.0000 0.0020 CC 2025.125646 1 1.9193 554 | 0/11 23 h-m-p 1.6000 8.0000 0.0016 CC 2025.125247 1 1.2893 581 | 0/11 24 h-m-p 1.6000 8.0000 0.0006 C 2025.125204 0 2.2759 606 | 0/11 25 h-m-p 1.6000 8.0000 0.0001 C 2025.125190 0 1.8059 631 | 0/11 26 h-m-p 0.5105 8.0000 0.0002 +Y 2025.125189 0 1.3750 657 | 0/11 27 h-m-p 1.6000 8.0000 0.0000 Y 2025.125189 0 1.1564 682 | 0/11 28 h-m-p 1.6000 8.0000 0.0000 Y 2025.125189 0 3.1186 707 | 0/11 29 h-m-p 1.6000 8.0000 0.0000 Y 2025.125189 0 1.1506 732 | 0/11 30 h-m-p 1.6000 8.0000 0.0000 C 2025.125189 0 0.4509 757 | 0/11 31 h-m-p 0.8484 8.0000 0.0000 C 2025.125189 0 0.2121 782 | 0/11 32 h-m-p 0.2563 8.0000 0.0000 --Y 2025.125189 0 0.0040 809 Out.. lnL = -2025.125189 810 lfun, 810 eigenQcodon, 7290 P(t) Time used: 0:03 Model 1: NearlyNeutral TREE # 1 (1, ((4, 5), 6), (2, 3)); MP score: 166 0.075048 0.073976 0.021547 0.075318 0.089338 0.254734 0.040332 0.031775 0.014361 2.119432 0.747245 0.296991 ntime & nrate & np: 9 2 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 7.498153 np = 12 lnL0 = -2051.416620 Iterating by ming2 Initial: fx= 2051.416620 x= 0.07505 0.07398 0.02155 0.07532 0.08934 0.25473 0.04033 0.03177 0.01436 2.11943 0.74724 0.29699 1 h-m-p 0.0000 0.0022 180.7630 +++CYCYCCC 2024.765753 6 0.0017 31 | 0/12 2 h-m-p 0.0000 0.0001 559.2815 YCYCCC 2021.781735 5 0.0001 54 | 0/12 3 h-m-p 0.0004 0.0020 34.0781 CCCCC 2021.474348 4 0.0005 77 | 0/12 4 h-m-p 0.0005 0.0040 35.2951 YCC 2021.349121 2 0.0003 95 | 0/12 5 h-m-p 0.0008 0.0114 14.9848 CC 2021.274243 1 0.0008 112 | 0/12 6 h-m-p 0.0012 0.0183 9.9483 CC 2021.212168 1 0.0012 129 | 0/12 7 h-m-p 0.0016 0.0292 7.5940 CCC 2021.110805 2 0.0024 148 | 0/12 8 h-m-p 0.0007 0.0561 27.8357 +YCCC 2020.394686 3 0.0046 169 | 0/12 9 h-m-p 0.0020 0.0204 63.5497 +YYYCC 2017.057188 4 0.0076 190 | 0/12 10 h-m-p 0.0004 0.0022 943.8559 +YCCCC 2010.060428 4 0.0011 213 | 0/12 11 h-m-p 0.0005 0.0024 242.4233 CCCCC 2009.182432 4 0.0006 236 | 0/12 12 h-m-p 0.0054 0.0269 4.3407 CC 2009.134736 1 0.0016 253 | 0/12 13 h-m-p 0.0009 0.0694 7.5941 +++YYCCCC 2005.154505 5 0.0484 279 | 0/12 14 h-m-p 0.1595 1.5573 2.3052 +YYCCC 2000.015658 4 0.5284 301 | 0/12 15 h-m-p 1.0775 5.3875 0.4406 CC 1999.701513 1 0.4272 318 | 0/12 16 h-m-p 1.6000 8.0000 0.0813 YC 1999.545291 1 0.7445 346 | 0/12 17 h-m-p 1.6000 8.0000 0.0323 YC 1999.537304 1 0.6772 374 | 0/12 18 h-m-p 1.6000 8.0000 0.0047 YC 1999.536788 1 0.6670 402 | 0/12 19 h-m-p 1.6000 8.0000 0.0005 Y 1999.536758 0 0.7154 429 | 0/12 20 h-m-p 0.4239 8.0000 0.0008 C 1999.536754 0 0.5210 456 | 0/12 21 h-m-p 1.6000 8.0000 0.0000 Y 1999.536754 0 0.8387 483 | 0/12 22 h-m-p 1.6000 8.0000 0.0000 Y 1999.536754 0 0.6453 510 | 0/12 23 h-m-p 1.6000 8.0000 0.0000 C 1999.536754 0 0.5703 537 | 0/12 24 h-m-p 0.8523 8.0000 0.0000 -Y 1999.536754 0 0.0283 565 Out.. lnL = -1999.536754 566 lfun, 1698 eigenQcodon, 10188 P(t) Time used: 0:07 Model 2: PositiveSelection TREE # 1 (1, ((4, 5), 6), (2, 3)); MP score: 166 initial w for M2:NSpselection reset. 0.075048 0.073976 0.021547 0.075318 0.089338 0.254734 0.040332 0.031775 0.014361 2.221908 0.896732 0.199894 0.157918 2.073080 ntime & nrate & np: 9 3 14 Bounds (np=14): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 5.124885 np = 14 lnL0 = -2068.500499 Iterating by ming2 Initial: fx= 2068.500499 x= 0.07505 0.07398 0.02155 0.07532 0.08934 0.25473 0.04033 0.03177 0.01436 2.22191 0.89673 0.19989 0.15792 2.07308 1 h-m-p 0.0000 0.0017 197.7737 +++CYCCC 2062.776216 4 0.0004 30 | 0/14 2 h-m-p 0.0001 0.0006 240.4253 +YCYCCC 2050.326749 5 0.0005 56 | 0/14 3 h-m-p 0.0000 0.0000 1640.3277 ++ 2047.208504 m 0.0000 73 | 1/14 4 h-m-p 0.0001 0.0018 172.8074 ++YCCC 2043.867252 3 0.0010 97 | 1/14 5 h-m-p 0.0005 0.0027 84.5001 +CYCC 2040.270546 3 0.0020 120 | 1/14 6 h-m-p 0.0007 0.0037 68.2809 ++ 2034.063628 m 0.0037 137 | 1/14 7 h-m-p 0.0009 0.0044 154.5158 +YYCCC 2018.976377 4 0.0032 161 | 0/14 8 h-m-p 0.0000 0.0002 1018.6405 YCCC 2016.677390 3 0.0001 183 | 0/14 9 h-m-p 0.0002 0.0010 238.7980 YCCCCC 2014.032321 5 0.0004 209 | 0/14 10 h-m-p 0.0004 0.0022 36.4798 CCCC 2013.557902 3 0.0007 232 | 0/14 11 h-m-p 0.0006 0.0046 39.2965 CCCC 2012.971879 3 0.0008 255 | 0/14 12 h-m-p 0.0013 0.0277 24.2802 +CCC 2011.463252 2 0.0054 277 | 0/14 13 h-m-p 0.0005 0.0033 250.1907 +CYC 2005.661436 2 0.0021 298 | 0/14 14 h-m-p 0.0228 0.1140 2.2081 ++ 2003.849940 m 0.1140 315 | 1/14 15 h-m-p 0.1031 1.4246 1.1286 YCCC 2002.532612 3 0.1770 337 | 1/14 16 h-m-p 0.4459 2.5371 0.4479 CCCC 2001.680136 3 0.4712 360 | 1/14 17 h-m-p 0.1765 2.2481 1.1960 CCCC 2000.967449 3 0.2996 396 | 1/14 18 h-m-p 1.6000 8.0000 0.1608 YCCC 2000.499508 3 0.9652 418 | 0/14 19 h-m-p 0.0990 4.2976 1.5667 YCCC 2000.176285 3 0.2028 453 | 0/14 20 h-m-p 1.2064 8.0000 0.2634 YCC 1999.695343 2 0.9464 473 | 0/14 21 h-m-p 0.9467 8.0000 0.2633 YCC 1999.565058 2 0.6367 507 | 0/14 22 h-m-p 1.0330 8.0000 0.1623 YCCC 1999.439049 3 2.2117 543 | 0/14 23 h-m-p 1.5658 8.0000 0.2292 YCCC 1999.265271 3 2.9452 579 | 0/14 24 h-m-p 1.6000 8.0000 0.0757 CC 1999.204313 1 1.3539 612 | 0/14 25 h-m-p 0.4367 8.0000 0.2345 YC 1999.192792 1 0.7272 644 | 0/14 26 h-m-p 1.6000 8.0000 0.0606 YC 1999.188152 1 1.0974 676 | 0/14 27 h-m-p 1.6000 8.0000 0.0111 YC 1999.187588 1 1.0477 708 | 0/14 28 h-m-p 1.6000 8.0000 0.0045 C 1999.187511 0 1.3652 739 | 0/14 29 h-m-p 1.6000 8.0000 0.0018 ++ 1999.187302 m 8.0000 770 | 0/14 30 h-m-p 0.3041 8.0000 0.0472 +YC 1999.186616 1 2.5173 803 | 0/14 31 h-m-p 1.6000 8.0000 0.0616 ++ 1999.183069 m 8.0000 834 | 0/14 32 h-m-p 1.6000 8.0000 0.1876 YYC 1999.180392 2 2.2592 867 | 0/14 33 h-m-p 0.7617 8.0000 0.5565 YYC 1999.179191 2 0.6263 900 | 0/14 34 h-m-p 1.6000 8.0000 0.1781 C 1999.178055 0 1.4968 931 | 0/14 35 h-m-p 1.5396 8.0000 0.1732 YC 1999.176941 1 3.7854 963 | 0/14 36 h-m-p 1.6000 8.0000 0.1471 YC 1999.176522 1 1.1319 995 | 0/14 37 h-m-p 0.3082 8.0000 0.5400 +C 1999.176001 0 1.2330 1027 | 0/14 38 h-m-p 1.6000 8.0000 0.3403 YC 1999.175691 1 3.3080 1059 | 0/14 39 h-m-p 1.6000 8.0000 0.1741 Y 1999.175555 0 1.2178 1090 | 0/14 40 h-m-p 0.5533 8.0000 0.3833 +C 1999.175486 0 2.2132 1122 | 0/14 41 h-m-p 1.6000 8.0000 0.3557 C 1999.175442 0 2.4432 1153 | 0/14 42 h-m-p 1.6000 8.0000 0.3553 C 1999.175424 0 1.8820 1184 | 0/14 43 h-m-p 1.6000 8.0000 0.3475 Y 1999.175416 0 2.9995 1215 | 0/14 44 h-m-p 1.6000 8.0000 0.3400 C 1999.175412 0 2.0712 1246 | 0/14 45 h-m-p 1.6000 8.0000 0.3496 Y 1999.175411 0 3.1617 1277 | 0/14 46 h-m-p 1.6000 8.0000 0.3401 C 1999.175410 0 2.0701 1308 | 0/14 47 h-m-p 1.6000 8.0000 0.3458 Y 1999.175410 0 3.1027 1339 | 0/14 48 h-m-p 1.6000 8.0000 0.3544 C 1999.175410 0 2.1308 1370 | 0/14 49 h-m-p 1.6000 8.0000 0.3411 Y 1999.175410 0 2.8390 1401 | 0/14 50 h-m-p 1.6000 8.0000 0.3503 C 1999.175410 0 2.2890 1432 | 0/14 51 h-m-p 1.6000 8.0000 0.4303 Y 1999.175410 0 3.2231 1463 | 0/14 52 h-m-p 1.6000 8.0000 0.0671 Y 1999.175410 0 0.9669 1494 | 0/14 53 h-m-p 0.2278 8.0000 0.2846 +C 1999.175410 0 1.2444 1526 | 0/14 54 h-m-p 1.6000 8.0000 0.0680 Y 1999.175410 0 0.8671 1557 | 0/14 55 h-m-p 0.4235 8.0000 0.1393 Y 1999.175410 0 0.8848 1588 | 0/14 56 h-m-p 1.6000 8.0000 0.0460 C 1999.175410 0 0.4000 1619 | 0/14 57 h-m-p 0.8212 8.0000 0.0224 Y 1999.175410 0 0.5440 1650 | 0/14 58 h-m-p 1.0341 8.0000 0.0118 ++ 1999.175410 m 8.0000 1681 | 0/14 59 h-m-p 0.1220 8.0000 0.7729 -C 1999.175410 0 0.0076 1713 | 0/14 60 h-m-p 0.1427 8.0000 0.0413 --------------Y 1999.175410 0 0.0000 1758 | 0/14 61 h-m-p 0.0160 8.0000 0.0001 --Y 1999.175410 0 0.0003 1791 Out.. lnL = -1999.175410 1792 lfun, 7168 eigenQcodon, 48384 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2008.494202 S = -1905.926223 -94.005251 Calculating f(w|X), posterior probabilities of site classes. did 10 / 159 patterns 0:26 did 20 / 159 patterns 0:27 did 30 / 159 patterns 0:27 did 40 / 159 patterns 0:27 did 50 / 159 patterns 0:27 did 60 / 159 patterns 0:27 did 70 / 159 patterns 0:27 did 80 / 159 patterns 0:27 did 90 / 159 patterns 0:27 did 100 / 159 patterns 0:27 did 110 / 159 patterns 0:27 did 120 / 159 patterns 0:27 did 130 / 159 patterns 0:27 did 140 / 159 patterns 0:27 did 150 / 159 patterns 0:27 did 159 / 159 patterns 0:27 Time used: 0:27 Model 3: discrete TREE # 1 (1, ((4, 5), 6), (2, 3)); MP score: 166 0.075048 0.073976 0.021547 0.075318 0.089338 0.254734 0.040332 0.031775 0.014361 2.271134 0.215184 0.509770 0.061371 0.153730 0.222781 ntime & nrate & np: 9 4 15 Bounds (np=15): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 13.209018 np = 15 lnL0 = -2022.050484 Iterating by ming2 Initial: fx= 2022.050484 x= 0.07505 0.07398 0.02155 0.07532 0.08934 0.25473 0.04033 0.03177 0.01436 2.27113 0.21518 0.50977 0.06137 0.15373 0.22278 1 h-m-p 0.0000 0.0009 112.9700 ++YCCC 2020.116578 3 0.0004 27 | 0/15 2 h-m-p 0.0000 0.0002 202.6274 ++ 2017.290855 m 0.0002 45 | 1/15 3 h-m-p 0.0001 0.0012 150.0798 ++ 2011.911999 m 0.0012 63 | 1/15 4 h-m-p 0.0000 0.0000 146.2585 h-m-p: 2.12690520e-21 1.06345260e-20 1.46258550e+02 2011.911999 .. | 1/15 5 h-m-p 0.0000 0.0002 211.0424 ++YYYCCC 2008.006691 5 0.0001 105 | 1/15 6 h-m-p 0.0001 0.0003 294.0423 YCCC 2005.714812 3 0.0001 128 | 1/15 7 h-m-p 0.0002 0.0008 76.8762 CCCCC 2005.232598 4 0.0002 154 | 1/15 8 h-m-p 0.0001 0.0006 52.5138 ++ 2004.343858 m 0.0006 172 | 2/15 9 h-m-p 0.0004 0.0053 84.4635 YCCC 2003.509136 3 0.0007 195 | 2/15 10 h-m-p 0.0003 0.0015 73.3230 CCC 2003.277021 2 0.0003 217 | 2/15 11 h-m-p 0.0013 0.0088 16.0317 CC 2003.233122 1 0.0005 237 | 2/15 12 h-m-p 0.0007 0.0426 11.1603 CC 2003.202101 1 0.0008 257 | 2/15 13 h-m-p 0.0008 0.0164 11.2013 YC 2003.188646 1 0.0004 276 | 2/15 14 h-m-p 0.0027 0.8444 1.8780 ++YC 2003.006406 1 0.0835 297 | 1/15 15 h-m-p 0.0007 0.0053 222.1989 CCC 2002.821048 2 0.0009 319 | 1/15 16 h-m-p 0.0013 0.0064 18.3362 YC 2002.801797 1 0.0007 338 | 1/15 17 h-m-p 0.0007 0.2920 18.2455 ++CCC 2002.459135 2 0.0185 362 | 1/15 18 h-m-p 0.1507 4.7096 2.2399 YC 2001.871018 1 0.2572 381 | 1/15 19 h-m-p 0.6230 3.1150 0.7235 CYCC 2000.743102 3 0.5924 404 | 0/15 20 h-m-p 0.0017 0.0085 215.7016 CC 2000.554369 1 0.0005 438 | 0/15 21 h-m-p 0.7030 8.0000 0.1573 +CCC 1999.676666 2 2.5919 461 | 0/15 22 h-m-p 0.7280 8.0000 0.5600 CCCC 1999.413791 3 0.7799 500 | 0/15 23 h-m-p 1.6000 8.0000 0.1405 YC 1999.224726 1 1.0424 534 | 0/15 24 h-m-p 1.4883 8.0000 0.0984 C 1999.186465 0 1.4399 567 | 0/15 25 h-m-p 1.6000 8.0000 0.0274 YC 1999.181194 1 1.1580 601 | 0/15 26 h-m-p 1.6000 8.0000 0.0154 C 1999.180340 0 1.6000 634 | 0/15 27 h-m-p 1.6000 8.0000 0.0070 +C 1999.178669 0 6.5855 668 | 0/15 28 h-m-p 1.6000 8.0000 0.0194 YC 1999.175716 1 3.3107 702 | 0/15 29 h-m-p 1.6000 8.0000 0.0048 YC 1999.175475 1 0.7961 736 | 0/15 30 h-m-p 0.2622 8.0000 0.0146 +YC 1999.175414 1 0.6646 771 | 0/15 31 h-m-p 1.6000 8.0000 0.0011 Y 1999.175410 0 1.0737 804 | 0/15 32 h-m-p 1.6000 8.0000 0.0002 Y 1999.175410 0 1.2419 837 | 0/15 33 h-m-p 1.6000 8.0000 0.0000 Y 1999.175410 0 1.1133 870 | 0/15 34 h-m-p 1.6000 8.0000 0.0000 C 1999.175410 0 1.6753 903 | 0/15 35 h-m-p 1.6000 8.0000 0.0000 ---------------C 1999.175410 0 0.0000 951 Out.. lnL = -1999.175410 952 lfun, 3808 eigenQcodon, 25704 P(t) Time used: 0:37 Model 7: beta TREE # 1 (1, ((4, 5), 6), (2, 3)); MP score: 166 0.075048 0.073976 0.021547 0.075318 0.089338 0.254734 0.040332 0.031775 0.014361 2.271134 0.603915 1.022819 ntime & nrate & np: 9 1 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 8.420966 np = 12 lnL0 = -2035.006267 Iterating by ming2 Initial: fx= 2035.006267 x= 0.07505 0.07398 0.02155 0.07532 0.08934 0.25473 0.04033 0.03177 0.01436 2.27113 0.60392 1.02282 1 h-m-p 0.0000 0.0096 125.8091 ++YYCCC 2033.293243 4 0.0003 25 | 0/12 2 h-m-p 0.0001 0.0006 122.1101 +YCYCCC 2031.258020 5 0.0003 49 | 0/12 3 h-m-p 0.0000 0.0007 887.1240 +YYCYYCCC 2012.610503 7 0.0004 76 | 0/12 4 h-m-p 0.0001 0.0003 844.3214 CCCCC 2010.679521 4 0.0001 99 | 0/12 5 h-m-p 0.0003 0.0015 116.9434 YCC 2009.721580 2 0.0003 117 | 0/12 6 h-m-p 0.0016 0.0152 21.6709 C 2009.376314 0 0.0016 132 | 0/12 7 h-m-p 0.0007 0.0154 50.8624 +CCCCC 2007.747413 4 0.0037 156 | 0/12 8 h-m-p 0.0008 0.0038 141.1080 CYCCC 2006.452404 4 0.0011 178 | 0/12 9 h-m-p 0.0015 0.0075 43.5402 YCCC 2006.183395 3 0.0009 198 | 0/12 10 h-m-p 0.0013 0.0138 30.7614 YCC 2006.063148 2 0.0007 216 | 0/12 11 h-m-p 0.0036 0.0261 6.0477 YC 2006.053264 1 0.0006 232 | 0/12 12 h-m-p 0.0044 2.1779 1.0513 +++CCCCC 2005.064255 4 0.3582 258 | 0/12 13 h-m-p 0.2253 1.1266 1.0171 CCC 2003.797037 2 0.3335 277 | 0/12 14 h-m-p 0.6800 3.4001 0.2380 YCCC 2003.151090 3 1.3068 297 | 0/12 15 h-m-p 0.4180 2.0899 0.5769 YCYCCC 2001.386414 5 1.2066 333 | 0/12 16 h-m-p 0.4086 2.0430 0.1995 YCCCCC 2000.917390 5 0.5756 369 | 0/12 17 h-m-p 0.6251 6.1731 0.1837 YCCC 2000.642244 3 0.4412 401 | 0/12 18 h-m-p 1.6000 8.0000 0.0440 CC 2000.616232 1 0.6039 430 | 0/12 19 h-m-p 0.3106 6.0039 0.0856 CC 2000.606609 1 0.3753 459 | 0/12 20 h-m-p 1.6000 8.0000 0.0113 YC 2000.603216 1 0.8805 487 | 0/12 21 h-m-p 1.6000 8.0000 0.0013 YC 2000.602749 1 1.0491 515 | 0/12 22 h-m-p 1.6000 8.0000 0.0005 Y 2000.602724 0 1.1607 542 | 0/12 23 h-m-p 1.6000 8.0000 0.0001 Y 2000.602723 0 1.0519 569 | 0/12 24 h-m-p 1.6000 8.0000 0.0000 Y 2000.602722 0 1.0024 596 | 0/12 25 h-m-p 1.6000 8.0000 0.0000 Y 2000.602722 0 1.0414 623 | 0/12 26 h-m-p 1.6000 8.0000 0.0000 Y 2000.602722 0 0.4000 650 | 0/12 27 h-m-p 0.6238 8.0000 0.0000 Y 2000.602722 0 0.6238 677 | 0/12 28 h-m-p 1.5205 8.0000 0.0000 --Y 2000.602722 0 0.0238 706 Out.. lnL = -2000.602722 707 lfun, 7777 eigenQcodon, 63630 P(t) Time used: 1:02 Model 8: beta&w>1 TREE # 1 (1, ((4, 5), 6), (2, 3)); MP score: 166 initial w for M8:NSbetaw>1 reset. 0.075048 0.073976 0.021547 0.075318 0.089338 0.254734 0.040332 0.031775 0.014361 2.204145 0.900000 0.523761 1.873198 2.941449 ntime & nrate & np: 9 2 14 Bounds (np=14): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 7.209516 np = 14 lnL0 = -2027.650175 Iterating by ming2 Initial: fx= 2027.650175 x= 0.07505 0.07398 0.02155 0.07532 0.08934 0.25473 0.04033 0.03177 0.01436 2.20414 0.90000 0.52376 1.87320 2.94145 1 h-m-p 0.0000 0.0004 287.1260 ++YCCCC 2015.431683 4 0.0003 28 | 0/14 2 h-m-p 0.0001 0.0003 168.9862 YCYCCC 2013.315164 5 0.0002 53 | 0/14 3 h-m-p 0.0001 0.0003 112.1128 +YCCC 2012.504214 3 0.0002 76 | 0/14 4 h-m-p 0.0002 0.0057 94.1667 +YCCCCC 2007.333603 5 0.0021 103 | 0/14 5 h-m-p 0.0002 0.0009 374.5074 CYCCCC 2004.193251 5 0.0003 129 | 0/14 6 h-m-p 0.0011 0.0056 15.2696 CC 2004.152160 1 0.0004 148 | 0/14 7 h-m-p 0.0011 0.0597 5.3234 CC 2004.129499 1 0.0014 167 | 0/14 8 h-m-p 0.0005 0.0420 16.7250 +CC 2004.036529 1 0.0020 187 | 0/14 9 h-m-p 0.0010 0.0134 32.9099 CC 2003.904903 1 0.0015 206 | 0/14 10 h-m-p 0.0008 0.0263 59.0625 +CC 2003.458838 1 0.0030 226 | 0/14 11 h-m-p 0.0008 0.0131 212.8102 +YCCC 2002.260549 3 0.0021 249 | 0/14 12 h-m-p 0.0010 0.0051 363.3904 YYCC 2001.478225 3 0.0008 270 | 0/14 13 h-m-p 0.1381 0.7589 2.0850 YCCCC 2000.590038 4 0.2863 294 | 0/14 14 h-m-p 0.7477 3.7385 0.2951 CYC 1999.988037 2 0.7064 314 | 0/14 15 h-m-p 0.2941 3.9819 0.7090 YCC 1999.840204 2 0.2421 348 | 0/14 16 h-m-p 0.5232 2.8829 0.3280 YCCC 1999.592377 3 1.0211 384 | 0/14 17 h-m-p 1.6000 8.0000 0.0855 YC 1999.550740 1 1.0964 416 | 0/14 18 h-m-p 0.7674 6.0726 0.1222 CC 1999.538353 1 0.7733 449 | 0/14 19 h-m-p 1.6000 8.0000 0.0383 YC 1999.533674 1 0.9813 481 | 0/14 20 h-m-p 0.8710 8.0000 0.0431 YC 1999.529833 1 1.5902 513 | 0/14 21 h-m-p 0.9879 8.0000 0.0694 +YC 1999.513287 1 5.3400 546 | 0/14 22 h-m-p 1.2547 8.0000 0.2955 ++ 1999.416730 m 8.0000 577 | 0/14 23 h-m-p 1.6000 8.0000 0.6883 CC 1999.356016 1 1.4467 610 | 0/14 24 h-m-p 1.1839 8.0000 0.8412 +YC 1999.320295 1 3.3057 643 | 0/14 25 h-m-p 1.6000 8.0000 1.4345 CCC 1999.287534 2 2.1904 678 | 0/14 26 h-m-p 1.3704 8.0000 2.2928 CYC 1999.272162 2 1.2083 698 | 0/14 27 h-m-p 1.1134 8.0000 2.4884 CCC 1999.257077 2 1.6779 719 | 0/14 28 h-m-p 1.0474 8.0000 3.9864 CC 1999.244049 1 1.5694 738 | 0/14 29 h-m-p 1.6000 8.0000 3.5028 YCC 1999.233357 2 2.5215 758 | 0/14 30 h-m-p 1.6000 8.0000 5.2008 CC 1999.225613 1 2.2909 777 | 0/14 31 h-m-p 1.6000 8.0000 6.4111 CC 1999.220280 1 2.4033 796 | 0/14 32 h-m-p 0.8078 4.0390 9.1943 +YC 1999.215825 1 2.5782 815 | 0/14 33 h-m-p 0.2171 1.0857 12.3710 ++ 1999.213797 m 1.0857 832 | 1/14 34 h-m-p 0.1351 8.0000 4.7928 ---------------.. | 1/14 35 h-m-p 0.0001 0.0533 1.2406 C 1999.213698 0 0.0001 879 | 1/14 36 h-m-p 0.0002 0.0320 0.9486 Y 1999.213667 0 0.0001 896 | 1/14 37 h-m-p 0.0009 0.4342 0.3643 C 1999.213653 0 0.0003 926 | 1/14 38 h-m-p 0.0012 0.5903 0.2572 Y 1999.213640 0 0.0006 956 | 1/14 39 h-m-p 0.0042 2.1025 0.4479 Y 1999.213576 0 0.0020 986 | 1/14 40 h-m-p 0.0008 0.4132 1.5359 YC 1999.213420 1 0.0015 1017 | 1/14 41 h-m-p 0.0011 0.5343 3.7006 YC 1999.213259 1 0.0007 1035 | 1/14 42 h-m-p 0.0007 0.3461 5.3856 +YC 1999.212575 1 0.0019 1054 | 1/14 43 h-m-p 0.0005 0.2305 21.2639 ++YC 1999.205044 1 0.0054 1074 | 1/14 44 h-m-p 0.0011 0.0447 106.9754 YC 1999.200723 1 0.0006 1092 | 1/14 45 h-m-p 0.0247 0.3697 2.6951 --C 1999.200622 0 0.0006 1111 | 1/14 46 h-m-p 0.0032 1.6160 0.7783 +++CC 1999.189733 1 0.2346 1133 | 1/14 47 h-m-p 1.6000 8.0000 0.0279 -C 1999.189676 0 0.1298 1164 | 1/14 48 h-m-p 1.6000 8.0000 0.0020 YC 1999.189627 1 0.9171 1195 | 1/14 49 h-m-p 1.5589 8.0000 0.0012 Y 1999.189626 0 0.9860 1225 | 1/14 50 h-m-p 1.6000 8.0000 0.0000 Y 1999.189626 0 0.7302 1255 | 1/14 51 h-m-p 1.6000 8.0000 0.0000 C 1999.189626 0 0.4000 1285 Out.. lnL = -1999.189626 1286 lfun, 15432 eigenQcodon, 127314 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2008.523934 S = -1905.964463 -94.797311 Calculating f(w|X), posterior probabilities of site classes. did 10 / 159 patterns 1:52 did 20 / 159 patterns 1:52 did 30 / 159 patterns 1:52 did 40 / 159 patterns 1:53 did 50 / 159 patterns 1:53 did 60 / 159 patterns 1:53 did 70 / 159 patterns 1:53 did 80 / 159 patterns 1:53 did 90 / 159 patterns 1:54 did 100 / 159 patterns 1:54 did 110 / 159 patterns 1:54 did 120 / 159 patterns 1:54 did 130 / 159 patterns 1:54 did 140 / 159 patterns 1:54 did 150 / 159 patterns 1:55 did 159 / 159 patterns 1:55 Time used: 1:55 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=291 D_melanogaster_Reep1-PE MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC D_sechellia_Reep1-PE MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC D_simulans_Reep1-PE MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC D_yakuba_Reep1-PE MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC D_erecta_Reep1-PE MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC D_biarmipes_Reep1-PE MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC ************************************************** D_melanogaster_Reep1-PE IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE D_sechellia_Reep1-PE IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE D_simulans_Reep1-PE IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE D_yakuba_Reep1-PE IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE D_erecta_Reep1-PE IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE D_biarmipes_Reep1-PE IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE ************************************************** D_melanogaster_Reep1-PE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH D_sechellia_Reep1-PE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH D_simulans_Reep1-PE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH D_yakuba_Reep1-PE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH D_erecta_Reep1-PE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTTPSGD D_biarmipes_Reep1-PE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGQ *********************************************:***. D_melanogaster_Reep1-PE GRGLQNSHSADELYRGQDTMDSTENWLPRASSLSSIESYTETIYEPRTET D_sechellia_Reep1-PE GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTDT D_simulans_Reep1-PE GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTET D_yakuba_Reep1-PE GRGLQNSHSANELSRDQDMMDSTDNWLPRASSLSSIESYTETIYEPRAET D_erecta_Reep1-PE GRGLQNSHSANELSRGQDVMDSTDNWLPRASSLSSIESYAETIYEPRAET D_biarmipes_Reep1-PE GRGLQNSHSADELYRGQDTMDSTDNWLPRASSLSSIDSYTENIYEPRAET **********:** *.** ****:************:**:*.*****::* D_melanogaster_Reep1-PE KRLVIREVSEEAEFDDDPLGDAGAARLRDMPVRKAQPRRAASTAKAAGKR D_sechellia_Reep1-PE RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKTQPRRAATTAKATDKR D_simulans_Reep1-PE RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKAQPRRAASTAKAAGKR D_yakuba_Reep1-PE RRLVIREVSEEVEHEDEPLGDAGAARLRDLPVRKAQPRRAAGTARAAGKR D_erecta_Reep1-PE RRLIIREVREEVEQEDEPLGDAGAARLRDLPARKAQPRRAAGTARAAGKR D_biarmipes_Reep1-PE RRLVIREVSEEVEQEDEPTGDAGAARLRDLPVRKAQPRRAAGTARTGGKR :**:**** **.* :*:* *******:**:*.**:****** **:: .** D_melanogaster_Reep1-PE GQKHNDIEGARSSSSSSNVIRSRRKLREPTPDVDVENY--- D_sechellia_Reep1-PE GQKQNDMKGAKSSSNTINVIRSRRKLREPTPDVDVETY--- D_simulans_Reep1-PE GQKQNDVEGAKSSSSTINVIRSRRKLREPTPDVDVETY--- D_yakuba_Reep1-PE GQKNNDMEAAGSSSSS--VIRSRRKLRDPTPDVDVENYoo- D_erecta_Reep1-PE GQKNNDMEAAGSSSN---VIRSRRKLRDPTPDVDVENYooo D_biarmipes_Reep1-PE GQKNNDTEAAAGSSTN--VIRSRRKLRDPTPDVDVENYoo- ***:** :.* .**. *********:********.*
>D_melanogaster_Reep1-PE ATGATCAGCAGCCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTACCCGGCATATGCCTCATACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACCTGC ATAGAAACATTCACGGACATATTTATCTCCTGGCTACCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTCTGGCTCCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTGTATCGCAAATTCGTGCATCCTATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAATCAGGCCAAAGAGCGCGGCTATTCGGC GGTCCTGCAGCTGGGCTCCAAGGGAGTAAACTATGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTACGCGCTGACTACGGCGCCATCTGGCCAT GGACGCGGCCTGCAAAACTCCCATTCGGCCGATGAGCTGTACAGGGGCCA GGATACGATGGACAGCACGGAAAACTGGCTGCCGCGAGCCAGTTCCTTGA GCAGCATCGAGAGCTACACAGAGACGATCTACGAGCCGAGGACCGAGACC AAGCGACTGGTTATTCGAGAGGTTAGCGAGGAGGCGGAGTTCGATGATGA TCCCCTGGGCGATGCCGGAGCAGCCCGTCTCCGGGACATGCCCGTCCGGA AGGCACAACCACGTCGGGCTGCTAGCACTGCCAAGGCTGCAGGCAAACGC GGCCAGAAACACAACGATATTGAGGGCGCCAGGAGCTCCAGCAGCTCCAG CAATGTGATCCGCTCCCGCCGCAAGCTGCGCGAACCCACGCCCGATGTGG ATGTGGAAAACTAC--------- >D_sechellia_Reep1-PE ATGATCAGCAGCCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTACCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACATGC ATAGAAACATTCACGGACATATTCATCTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTCTGGCTTCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTGTATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAATCAGGCCAAAGAGCGGGGCTATTCGGC GGTGCTGCAGCTGGGCTCCAAGGGAGTAAACTATGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTACGCGCTGACCACGGCACCATCTGGCCAT GGACGCGGCCTGCAGAACTCCCATTCGGCCGATGAGCTGTTCCGGGGCCA GGACACAATGGACAGCACGGACAATTGGCTGCCGCGGGCCAGTTCCTTGA GCAGCATCGAGAGCTACACGGAGACGATCTACGAGCCGAGGACCGACACC AGGCGACTGATTATTCGAGAGGTTAGCGAGGAAGCGGAGCTCGATGATGA GCCCCTGGGCGATGCCGGAGCAGCCCGTATCCGGGACTTGCCCGTCCGGA AGACACAACCACGTCGTGCTGCTACCACTGCCAAGGCTACAGACAAACGC GGCCAGAAACAGAACGATATGAAGGGAGCCAAGAGCTCCAGCAACACCAT CAATGTGATCCGCTCCCGCCGCAAGCTGCGCGAACCCACGCCCGATGTGG ATGTGGAAACCTAC--------- >D_simulans_Reep1-PE ATGATCAGCAGCCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTACCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACATGC ATAGAAACATTCACGGACATATTCATCTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTCTGGCTCCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTATATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAATCAGGCCAAAGAGCGGGGCTATTCGGC GGTGCTGCAGCTGGGCTCCAAGGGAGTAAACTATGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTACGCGCTGACCACGGCACCATCTGGCCAT GGACGCGGCCTGCAGAACTCCCATTCGGCCGATGAGCTGTTCCGGGGCCA GGACACAATGGACAGCACGGACAATTGGCTGCCGCGGGCCAGTTCCTTGA GCAGCATCGAGAGCTACACGGAGACGATCTACGAGCCGAGGACCGAGACC AGGCGACTGATTATTCGAGAGGTTAGCGAGGAGGCGGAGCTCGATGATGA GCCCCTGGGCGATGCCGGGGCAGCCCGTATCCGGGACTTGCCCGTCCGGA AGGCACAACCACGTCGTGCTGCCAGCACTGCCAAGGCTGCAGGCAAACGC GGCCAGAAACAGAACGATGTGGAGGGAGCCAAGAGCTCCAGCAGCACCAT CAATGTGATCCGCTCCCGCCGCAAGCTGCGCGAACCCACGCCCGATGTGG ATGTGGAAACCTAC--------- >D_yakuba_Reep1-PE ATGATCAGCAGTCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTATCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACCTGC ATAGAAACATTCACGGACATATTCATTTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTTTGGCTCCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTGTATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAACCAGGCCAAAGAGCGGGGCTATTCGGC GGTCCTGCAGCTGGGCTCCAAGGGAGTAAACTACGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTATGCGCTGACCACGGCGCCATCTGGCCAT GGACGCGGCCTGCAGAACTCCCATTCCGCGAATGAGCTGTCCCGGGACCA GGACATGATGGACAGCACGGACAACTGGCTGCCGAGGGCCAGTTCCCTGA GCAGCATCGAGAGCTACACGGAGACGATCTACGAGCCGAGAGCCGAGACC AGGCGACTGGTTATTCGGGAGGTCAGCGAGGAGGTGGAGCACGAAGATGA GCCCCTGGGCGATGCCGGAGCAGCACGTCTCCGAGACTTGCCTGTCCGGA AGGCTCAGCCACGTCGTGCCGCAGGTACCGCCAGAGCTGCGGGCAAACGT GGCCAGAAAAACAACGATATGGAGGCCGCCGGAAGCTCTAGCTCCAGT-- ----GTGATCCGCTCCCGGCGCAAGCTGCGCGATCCCACACCCGATGTGG ATGTGGAAAACTAC--------- >D_erecta_Reep1-PE ATGATCAGCAGTCTGTTTTCGCGGCTTATAATATTGTTCTGCGGCACCCT GTACCCGGCCTATGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTTAAATGGATGATGTACTGGATTGTCTTTGCATTTTTTACCTGC ATAGAAACATTCACGGATATATTCATCTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTGTTCTGGCTCCTCTCGCCGGCCACAAAGGGCA GTTCGACTTTGTATCGCAAATTCGTGCATCCGATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTAAATCAGGCCAAAGAGCGGGGCTATTCGGC GGTCCTGCAGCTGGGTTCGAAGGGAGTAAACTATGCCACCAATGTCCTCA TGCAGACGGCCATCAAGACCTATGCGCTGACCACAACGCCATCTGGCGAT GGACGCGGCCTGCAAAACTCCCATTCGGCCAATGAGCTGTCCCGGGGTCA GGACGTGATGGACAGCACGGACAACTGGCTGCCGAGGGCCAGTTCCCTGA GCAGCATCGAGAGCTACGCGGAGACGATCTATGAGCCGAGGGCCGAGACC AGGCGACTGATTATTCGAGAGGTTAGAGAGGAGGTGGAGCAGGAAGATGA GCCCCTGGGCGATGCCGGAGCAGCACGTCTACGAGACTTGCCTGCTCGGA AGGCTCAACCACGTCGTGCTGCAGGCACCGCCAGAGCTGCAGGCAAGCGC GGCCAGAAAAACAACGATATGGAGGCCGCCGGCAGCTCCAGCAAT----- ----GTGATCCGCTCCCGGCGCAAGTTGCGCGATCCCACGCCCGATGTGG ATGTGGAAAACTAC--------- >D_biarmipes_Reep1-PE ATGATCAGCAGCCTGTTCTCGCGGCTTATCATATTGTTCTGCGGCACCCT GTACCCGGCCTACGCCTCCTACAAGGCCGTCAGGACCAAGGATGTCAAGG AATATGTAAAATGGATGATGTACTGGATTGTCTTTGCATTTTTCACCTGC ATCGAAACATTCACGGACATCTTCATCTCCTGGCTGCCGTTCTACTACGA GGTGAAGGTGGCCCTGGTCTTCTGGCTCCTCTCGCCGGCCACTAAGGGCA GTTCGACGCTGTATCGCAAGTTCGTGCACCCCATGTTGACGCGCCACGAA CAGGAGATCGACGAGTACGTGAACCAGGCCAAGGAGCGGGGCTATTCGGC GGTCCTGCAGCTGGGCTCCAAGGGAGTCAACTATGCCACCAATGTGCTCA TGCAGACGGCCATCAAGACCTATGCGCTGACCACGGCTCCATCGGGCCAG GGACGTGGCCTGCAGAACTCCCATTCGGCGGACGAGCTGTACCGGGGCCA GGACACGATGGACAGCACGGACAACTGGCTGCCGCGGGCCAGTTCCCTGA GCAGCATCGACAGCTATACGGAGAACATCTACGAGCCGAGGGCCGAGACC AGGCGCCTGGTCATCCGTGAGGTGTCCGAGGAGGTTGAGCAGGAAGATGA GCCCACGGGTGATGCCGGAGCAGCCAGGCTGCGGGACCTGCCGGTCCGGA AGGCGCAGCCACGTCGCGCCGCAGGCACCGCCAGAACTGGAGGCAAACGT GGCCAGAAAAACAACGATACAGAAGCCGCCGCCGGCAGCTCCACCAAT-- ----GTGATCCGGTCGCGCCGCAAGCTGCGCGATCCCACGCCCGATGTGG ACGTGGAGAACTAC---------
>D_melanogaster_Reep1-PE MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELYRGQDTMDSTENWLPRASSLSSIESYTETIYEPRTET KRLVIREVSEEAEFDDDPLGDAGAARLRDMPVRKAQPRRAASTAKAAGKR GQKHNDIEGARSSSSSSNVIRSRRKLREPTPDVDVENY >D_sechellia_Reep1-PE MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTDT RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKTQPRRAATTAKATDKR GQKQNDMKGAKSSSNTINVIRSRRKLREPTPDVDVETY >D_simulans_Reep1-PE MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSADELFRGQDTMDSTDNWLPRASSLSSIESYTETIYEPRTET RRLIIREVSEEAELDDEPLGDAGAARIRDLPVRKAQPRRAASTAKAAGKR GQKQNDVEGAKSSSSTINVIRSRRKLREPTPDVDVETY >D_yakuba_Reep1-PE MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGH GRGLQNSHSANELSRDQDMMDSTDNWLPRASSLSSIESYTETIYEPRAET RRLVIREVSEEVEHEDEPLGDAGAARLRDLPVRKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSSS--VIRSRRKLRDPTPDVDVENY >D_erecta_Reep1-PE MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTTPSGD GRGLQNSHSANELSRGQDVMDSTDNWLPRASSLSSIESYAETIYEPRAET RRLIIREVREEVEQEDEPLGDAGAARLRDLPARKAQPRRAAGTARAAGKR GQKNNDMEAAGSSSN---VIRSRRKLRDPTPDVDVENY >D_biarmipes_Reep1-PE MISSLFSRLIILFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTC IETFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHE QEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKTYALTTAPSGQ GRGLQNSHSADELYRGQDTMDSTDNWLPRASSLSSIDSYTENIYEPRAET RRLVIREVSEEVEQEDEPTGDAGAARLRDLPVRKAQPRRAAGTARTGGKR GQKNNDTEAAAGSSTN--VIRSRRKLRDPTPDVDVENY
#NEXUS [ID: 3433527865] begin taxa; dimensions ntax=6; taxlabels D_melanogaster_Reep1-PE D_sechellia_Reep1-PE D_simulans_Reep1-PE D_yakuba_Reep1-PE D_erecta_Reep1-PE D_biarmipes_Reep1-PE ; end; begin trees; translate 1 D_melanogaster_Reep1-PE, 2 D_sechellia_Reep1-PE, 3 D_simulans_Reep1-PE, 4 D_yakuba_Reep1-PE, 5 D_erecta_Reep1-PE, 6 D_biarmipes_Reep1-PE ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.0383062,((4:0.03144102,5:0.03904521)0.508:0.01233381,6:0.1492907)1.000:0.04485973,(2:0.01410712,3:0.006870316)1.000:0.01913593); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.0383062,((4:0.03144102,5:0.03904521):0.01233381,6:0.1492907):0.04485973,(2:0.01410712,3:0.006870316):0.01913593); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2153.04 -2164.37 2 -2153.40 -2164.03 -------------------------------------- TOTAL -2153.20 -2164.21 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/367/Reep1-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.363418 0.001861 0.283375 0.450777 0.360409 1285.16 1393.08 1.000 r(A<->C){all} 0.115627 0.000766 0.065770 0.173174 0.113733 807.76 833.12 1.000 r(A<->G){all} 0.251008 0.001740 0.171186 0.332182 0.247931 733.45 822.18 1.000 r(A<->T){all} 0.127527 0.001423 0.053400 0.197582 0.125618 829.78 831.18 1.002 r(C<->G){all} 0.081823 0.000416 0.041279 0.119534 0.080294 1059.46 1150.73 1.000 r(C<->T){all} 0.351152 0.002242 0.264134 0.451767 0.348859 826.57 888.74 1.001 r(G<->T){all} 0.072863 0.000596 0.025833 0.119734 0.071162 918.13 924.29 1.000 pi(A){all} 0.231014 0.000178 0.204743 0.256543 0.230715 1060.68 1123.89 1.000 pi(C){all} 0.290926 0.000216 0.261929 0.318381 0.290978 1213.42 1267.66 1.000 pi(G){all} 0.294921 0.000208 0.266537 0.322883 0.294676 1319.56 1340.53 1.000 pi(T){all} 0.183139 0.000152 0.159347 0.207566 0.182859 1155.97 1328.49 1.000 alpha{1,2} 0.070619 0.002386 0.000126 0.159606 0.063830 1188.12 1249.26 1.000 alpha{3} 2.109833 0.636378 0.798454 3.665272 1.974045 1382.83 1441.92 1.001 pinvar{all} 0.197111 0.009192 0.000239 0.359693 0.194418 1004.28 1042.20 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/367/Reep1-PE/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 285 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 4 3 3 4 4 2 | Ser TCT 1 1 1 2 1 0 | Tyr TAT 5 5 5 6 7 6 | Cys TGT 0 0 0 0 0 0 TTC 7 8 8 6 6 8 | TCC 6 7 7 9 7 7 | TAC 11 10 10 9 8 10 | TGC 2 2 2 2 2 2 Leu TTA 0 0 1 0 0 0 | TCA 1 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 4 5 4 4 5 2 | TCG 5 5 5 4 6 7 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 1 2 1 1 1 1 | Pro CCT 1 0 0 1 1 0 | His CAT 3 3 3 3 2 1 | Arg CGT 2 3 3 4 3 4 CTC 4 3 4 4 3 3 | CCC 4 4 4 3 3 4 | CAC 2 1 1 2 1 2 | CGC 9 8 8 6 7 7 CTA 1 0 0 0 1 0 | CCA 2 2 2 2 2 2 | Gln CAA 2 1 1 0 2 0 | CGA 3 2 2 2 3 0 CTG 12 13 13 14 13 16 | CCG 5 6 6 6 6 6 | CAG 6 8 8 8 7 10 | CGG 4 6 6 6 5 7 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 3 3 3 3 3 1 | Thr ACT 3 2 2 1 1 2 | Asn AAT 2 3 3 2 4 1 | Ser AGT 2 2 2 3 3 2 ATC 7 8 8 6 7 11 | ACC 7 9 8 8 8 9 | AAC 5 4 3 7 6 8 | AGC 11 9 11 8 7 7 ATA 4 4 4 4 4 1 | ACA 3 6 4 3 3 2 | Lys AAA 5 5 5 5 4 3 | Arg AGA 0 0 0 2 2 1 Met ATG 7 7 6 8 7 6 | ACG 8 8 8 7 7 10 | AAG 11 12 11 9 10 11 | AGG 4 3 3 3 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 3 2 2 2 2 1 | Ala GCT 3 3 2 2 4 1 | Asp GAT 10 8 8 7 9 6 | Gly GGT 0 0 0 1 2 1 GTC 6 5 5 7 5 8 | GCC 13 14 15 15 15 17 | GAC 4 8 6 7 5 9 | GGC 11 9 10 9 10 11 GTA 1 1 1 1 2 1 | GCA 5 3 5 4 5 3 | Glu GAA 6 6 5 5 5 5 | GGA 3 4 3 4 3 4 GTG 8 9 10 9 9 9 | GCG 4 3 3 5 3 4 | GAG 14 12 15 15 15 14 | GGG 0 0 1 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: D_melanogaster_Reep1-PE position 1: T:0.17895 C:0.21404 A:0.28772 G:0.31930 position 2: T:0.25263 C:0.24912 A:0.30175 G:0.19649 position 3: T:0.15088 C:0.38246 A:0.12632 G:0.34035 Average T:0.19415 C:0.28187 A:0.23860 G:0.28538 #2: D_sechellia_Reep1-PE position 1: T:0.17895 C:0.21754 A:0.29825 G:0.30526 position 2: T:0.25614 C:0.25614 A:0.30175 G:0.18596 position 3: T:0.14035 C:0.38246 A:0.11930 G:0.35789 Average T:0.19181 C:0.28538 A:0.23977 G:0.28304 #3: D_simulans_Reep1-PE position 1: T:0.17895 C:0.21754 A:0.28421 G:0.31930 position 2: T:0.25614 C:0.25263 A:0.29474 G:0.19649 position 3: T:0.13333 C:0.38596 A:0.11579 G:0.36491 Average T:0.18947 C:0.28538 A:0.23158 G:0.29357 #4: D_yakuba_Reep1-PE position 1: T:0.17895 C:0.21754 A:0.27719 G:0.32632 position 2: T:0.25614 C:0.25263 A:0.29825 G:0.19298 position 3: T:0.14737 C:0.37895 A:0.11228 G:0.36140 Average T:0.19415 C:0.28304 A:0.22924 G:0.29357 #5: D_erecta_Reep1-PE position 1: T:0.17895 C:0.21053 A:0.28070 G:0.32982 position 2: T:0.25263 C:0.25263 A:0.29825 G:0.19649 position 3: T:0.16491 C:0.35088 A:0.12632 G:0.35789 Average T:0.19883 C:0.27135 A:0.23509 G:0.29474 #6: D_biarmipes_Reep1-PE position 1: T:0.17193 C:0.22105 A:0.27719 G:0.32982 position 2: T:0.24561 C:0.25965 A:0.30175 G:0.19298 position 3: T:0.10175 C:0.43158 A:0.07719 G:0.38947 Average T:0.17310 C:0.30409 A:0.21871 G:0.30409 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 20 | Ser S TCT 6 | Tyr Y TAT 34 | Cys C TGT 0 TTC 43 | TCC 43 | TAC 58 | TGC 12 Leu L TTA 1 | TCA 1 | *** * TAA 0 | *** * TGA 0 TTG 24 | TCG 32 | TAG 0 | Trp W TGG 30 ------------------------------------------------------------------------------ Leu L CTT 7 | Pro P CCT 3 | His H CAT 15 | Arg R CGT 19 CTC 21 | CCC 22 | CAC 9 | CGC 45 CTA 2 | CCA 12 | Gln Q CAA 6 | CGA 12 CTG 81 | CCG 35 | CAG 47 | CGG 34 ------------------------------------------------------------------------------ Ile I ATT 16 | Thr T ACT 11 | Asn N AAT 15 | Ser S AGT 14 ATC 47 | ACC 49 | AAC 33 | AGC 53 ATA 21 | ACA 21 | Lys K AAA 27 | Arg R AGA 5 Met M ATG 41 | ACG 48 | AAG 64 | AGG 21 ------------------------------------------------------------------------------ Val V GTT 12 | Ala A GCT 15 | Asp D GAT 48 | Gly G GGT 4 GTC 36 | GCC 89 | GAC 39 | GGC 60 GTA 7 | GCA 25 | Glu E GAA 32 | GGA 21 GTG 54 | GCG 22 | GAG 85 | GGG 1 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.17778 C:0.21637 A:0.28421 G:0.32164 position 2: T:0.25322 C:0.25380 A:0.29942 G:0.19357 position 3: T:0.13977 C:0.38538 A:0.11287 G:0.36199 Average T:0.19025 C:0.28519 A:0.23216 G:0.29240 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_Reep1-PE D_sechellia_Reep1-PE 0.2738 (0.0299 0.1092) D_simulans_Reep1-PE 0.1667 (0.0195 0.1173) 0.5097 (0.0125 0.0245) D_yakuba_Reep1-PE 0.1430 (0.0347 0.2431) 0.2117 (0.0437 0.2066) 0.1730 (0.0356 0.2059) D_erecta_Reep1-PE 0.2123 (0.0445 0.2098) 0.2572 (0.0484 0.1883) 0.2232 (0.0419 0.1877) 0.1003 (0.0172 0.1716) D_biarmipes_Reep1-PE 0.1471 (0.0551 0.3748) 0.1969 (0.0672 0.3415) 0.1701 (0.0583 0.3428) 0.1159 (0.0382 0.3294) 0.1182 (0.0456 0.3857) Model 0: one-ratio TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 166 lnL(ntime: 9 np: 11): -2025.125189 +0.000000 7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3 0.071588 0.080629 0.030088 0.071587 0.087917 0.262314 0.044364 0.032733 0.013784 2.119432 0.122742 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.69500 (1: 0.071588, ((4: 0.071587, 5: 0.087917): 0.030088, 6: 0.262314): 0.080629, (2: 0.032733, 3: 0.013784): 0.044364); (D_melanogaster_Reep1-PE: 0.071588, ((D_yakuba_Reep1-PE: 0.071587, D_erecta_Reep1-PE: 0.087917): 0.030088, D_biarmipes_Reep1-PE: 0.262314): 0.080629, (D_sechellia_Reep1-PE: 0.032733, D_simulans_Reep1-PE: 0.013784): 0.044364); Detailed output identifying parameters kappa (ts/tv) = 2.11943 omega (dN/dS) = 0.12274 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.072 680.0 175.0 0.1227 0.0097 0.0789 6.6 13.8 7..8 0.081 680.0 175.0 0.1227 0.0109 0.0889 7.4 15.6 8..9 0.030 680.0 175.0 0.1227 0.0041 0.0332 2.8 5.8 9..4 0.072 680.0 175.0 0.1227 0.0097 0.0789 6.6 13.8 9..5 0.088 680.0 175.0 0.1227 0.0119 0.0969 8.1 17.0 8..6 0.262 680.0 175.0 0.1227 0.0355 0.2892 24.1 50.6 7..10 0.044 680.0 175.0 0.1227 0.0060 0.0489 4.1 8.6 10..2 0.033 680.0 175.0 0.1227 0.0044 0.0361 3.0 6.3 10..3 0.014 680.0 175.0 0.1227 0.0019 0.0152 1.3 2.7 tree length for dN: 0.0941 tree length for dS: 0.7663 Time used: 0:03 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 166 lnL(ntime: 9 np: 12): -1999.536754 +0.000000 7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3 0.077235 0.084763 0.026924 0.075423 0.088831 0.293246 0.042415 0.033268 0.014044 2.221908 0.892125 0.034205 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.73615 (1: 0.077235, ((4: 0.075423, 5: 0.088831): 0.026924, 6: 0.293246): 0.084763, (2: 0.033268, 3: 0.014044): 0.042415); (D_melanogaster_Reep1-PE: 0.077235, ((D_yakuba_Reep1-PE: 0.075423, D_erecta_Reep1-PE: 0.088831): 0.026924, D_biarmipes_Reep1-PE: 0.293246): 0.084763, (D_sechellia_Reep1-PE: 0.033268, D_simulans_Reep1-PE: 0.014044): 0.042415); Detailed output identifying parameters kappa (ts/tv) = 2.22191 dN/dS (w) for site classes (K=2) p: 0.89212 0.10788 w: 0.03420 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.077 679.1 175.9 0.1384 0.0113 0.0816 7.7 14.3 7..8 0.085 679.1 175.9 0.1384 0.0124 0.0895 8.4 15.7 8..9 0.027 679.1 175.9 0.1384 0.0039 0.0284 2.7 5.0 9..4 0.075 679.1 175.9 0.1384 0.0110 0.0797 7.5 14.0 9..5 0.089 679.1 175.9 0.1384 0.0130 0.0938 8.8 16.5 8..6 0.293 679.1 175.9 0.1384 0.0429 0.3097 29.1 54.5 7..10 0.042 679.1 175.9 0.1384 0.0062 0.0448 4.2 7.9 10..2 0.033 679.1 175.9 0.1384 0.0049 0.0351 3.3 6.2 10..3 0.014 679.1 175.9 0.1384 0.0021 0.0148 1.4 2.6 Time used: 0:07 Model 2: PositiveSelection (3 categories) TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 166 lnL(ntime: 9 np: 14): -1999.175410 +0.000000 7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3 0.078357 0.085005 0.027175 0.076647 0.088854 0.298990 0.042015 0.033431 0.014056 2.271134 0.914411 0.000000 0.042328 1.330025 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.74453 (1: 0.078357, ((4: 0.076647, 5: 0.088854): 0.027175, 6: 0.298990): 0.085005, (2: 0.033431, 3: 0.014056): 0.042015); (D_melanogaster_Reep1-PE: 0.078357, ((D_yakuba_Reep1-PE: 0.076647, D_erecta_Reep1-PE: 0.088854): 0.027175, D_biarmipes_Reep1-PE: 0.298990): 0.085005, (D_sechellia_Reep1-PE: 0.033431, D_simulans_Reep1-PE: 0.014056): 0.042015); Detailed output identifying parameters kappa (ts/tv) = 2.27113 dN/dS (w) for site classes (K=3) p: 0.91441 0.00000 0.08559 w: 0.04233 1.00000 1.33003 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.078 678.7 176.3 0.1525 0.0122 0.0798 8.3 14.1 7..8 0.085 678.7 176.3 0.1525 0.0132 0.0866 9.0 15.3 8..9 0.027 678.7 176.3 0.1525 0.0042 0.0277 2.9 4.9 9..4 0.077 678.7 176.3 0.1525 0.0119 0.0781 8.1 13.8 9..5 0.089 678.7 176.3 0.1525 0.0138 0.0905 9.4 16.0 8..6 0.299 678.7 176.3 0.1525 0.0465 0.3046 31.5 53.7 7..10 0.042 678.7 176.3 0.1525 0.0065 0.0428 4.4 7.5 10..2 0.033 678.7 176.3 0.1525 0.0052 0.0341 3.5 6.0 10..3 0.014 678.7 176.3 0.1525 0.0022 0.0143 1.5 2.5 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reep1-PE) Pr(w>1) post mean +- SE for w 150 H 0.957* 1.275 164 Y 0.977* 1.300 169 T 0.949 1.264 204 V 0.972* 1.294 209 S 0.997** 1.326 214 F 1.000** 1.330 219 L 0.943 1.257 242 S 0.890 1.189 246 A 0.511 0.701 247 A 0.976* 1.299 254 H 0.867 1.158 257 I 0.997** 1.326 261 R 0.999** 1.329 263 S 0.943 1.256 264 S 0.908 1.212 265 S 1.000** 1.330 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reep1-PE) Pr(w>1) post mean +- SE for w 150 H 0.514 1.383 +- 0.703 164 Y 0.551 1.448 +- 0.673 204 V 0.590 1.504 +- 0.726 209 S 0.586 1.510 +- 0.626 214 F 0.708 1.663 +- 0.679 247 A 0.621 1.550 +- 0.734 257 I 0.596 1.529 +- 0.644 261 R 0.719 1.686 +- 0.703 265 S 0.773 1.741 +- 0.704 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.650 0.301 0.040 0.006 0.001 0.000 0.000 0.000 0.000 0.000 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.022 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.126 0.851 sum of density on p0-p1 = 1.000000 Time used: 0:27 Model 3: discrete (3 categories) TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 166 lnL(ntime: 9 np: 15): -1999.175410 +0.000000 7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3 0.078357 0.085005 0.027175 0.076647 0.088854 0.298990 0.042015 0.033431 0.014056 2.271134 0.478006 0.436405 0.042328 0.042328 1.330025 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.74453 (1: 0.078357, ((4: 0.076647, 5: 0.088854): 0.027175, 6: 0.298990): 0.085005, (2: 0.033431, 3: 0.014056): 0.042015); (D_melanogaster_Reep1-PE: 0.078357, ((D_yakuba_Reep1-PE: 0.076647, D_erecta_Reep1-PE: 0.088854): 0.027175, D_biarmipes_Reep1-PE: 0.298990): 0.085005, (D_sechellia_Reep1-PE: 0.033431, D_simulans_Reep1-PE: 0.014056): 0.042015); Detailed output identifying parameters kappa (ts/tv) = 2.27113 dN/dS (w) for site classes (K=3) p: 0.47801 0.43641 0.08559 w: 0.04233 0.04233 1.33003 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.078 678.7 176.3 0.1525 0.0122 0.0798 8.3 14.1 7..8 0.085 678.7 176.3 0.1525 0.0132 0.0866 9.0 15.3 8..9 0.027 678.7 176.3 0.1525 0.0042 0.0277 2.9 4.9 9..4 0.077 678.7 176.3 0.1525 0.0119 0.0781 8.1 13.8 9..5 0.089 678.7 176.3 0.1525 0.0138 0.0905 9.4 16.0 8..6 0.299 678.7 176.3 0.1525 0.0465 0.3046 31.5 53.7 7..10 0.042 678.7 176.3 0.1525 0.0065 0.0428 4.4 7.5 10..2 0.033 678.7 176.3 0.1525 0.0052 0.0341 3.5 6.0 10..3 0.014 678.7 176.3 0.1525 0.0022 0.0143 1.5 2.5 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reep1-PE) Pr(w>1) post mean +- SE for w 150 H 0.957* 1.275 164 Y 0.977* 1.300 169 T 0.949 1.264 204 V 0.972* 1.294 209 S 0.997** 1.326 214 F 1.000** 1.330 219 L 0.943 1.257 242 S 0.890 1.189 246 A 0.511 0.701 247 A 0.976* 1.299 254 H 0.867 1.158 257 I 0.997** 1.326 261 R 0.999** 1.329 263 S 0.943 1.256 264 S 0.908 1.212 265 S 1.000** 1.330 Time used: 0:37 Model 7: beta (10 categories) TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 166 lnL(ntime: 9 np: 12): -2000.602722 +0.000000 7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3 0.076233 0.083833 0.027328 0.074519 0.088699 0.288751 0.042802 0.033054 0.014041 2.204145 0.069821 0.438216 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.72926 (1: 0.076233, ((4: 0.074519, 5: 0.088699): 0.027328, 6: 0.288751): 0.083833, (2: 0.033054, 3: 0.014041): 0.042802); (D_melanogaster_Reep1-PE: 0.076233, ((D_yakuba_Reep1-PE: 0.074519, D_erecta_Reep1-PE: 0.088699): 0.027328, D_biarmipes_Reep1-PE: 0.288751): 0.083833, (D_sechellia_Reep1-PE: 0.033054, D_simulans_Reep1-PE: 0.014041): 0.042802); Detailed output identifying parameters kappa (ts/tv) = 2.20414 Parameters in M7 (beta): p = 0.06982 q = 0.43822 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00005 0.00093 0.01015 0.07604 0.37635 0.91372 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.076 679.3 175.7 0.1377 0.0111 0.0807 7.5 14.2 7..8 0.084 679.3 175.7 0.1377 0.0122 0.0887 8.3 15.6 8..9 0.027 679.3 175.7 0.1377 0.0040 0.0289 2.7 5.1 9..4 0.075 679.3 175.7 0.1377 0.0109 0.0789 7.4 13.9 9..5 0.089 679.3 175.7 0.1377 0.0129 0.0939 8.8 16.5 8..6 0.289 679.3 175.7 0.1377 0.0421 0.3056 28.6 53.7 7..10 0.043 679.3 175.7 0.1377 0.0062 0.0453 4.2 8.0 10..2 0.033 679.3 175.7 0.1377 0.0048 0.0350 3.3 6.1 10..3 0.014 679.3 175.7 0.1377 0.0020 0.0149 1.4 2.6 Time used: 1:02 Model 8: beta&w>1 (11 categories) TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 166 lnL(ntime: 9 np: 14): -1999.189626 +0.000000 7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3 0.078341 0.084965 0.027214 0.076643 0.088853 0.298919 0.042027 0.033425 0.014054 2.270875 0.915542 4.506285 99.000000 1.338281 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.74444 (1: 0.078341, ((4: 0.076643, 5: 0.088853): 0.027214, 6: 0.298919): 0.084965, (2: 0.033425, 3: 0.014054): 0.042027); (D_melanogaster_Reep1-PE: 0.078341, ((D_yakuba_Reep1-PE: 0.076643, D_erecta_Reep1-PE: 0.088853): 0.027214, D_biarmipes_Reep1-PE: 0.298919): 0.084965, (D_sechellia_Reep1-PE: 0.033425, D_simulans_Reep1-PE: 0.014054): 0.042027); Detailed output identifying parameters kappa (ts/tv) = 2.27088 Parameters in M8 (beta&w>1): p0 = 0.91554 p = 4.50629 q = 99.00000 (p1 = 0.08446) w = 1.33828 dN/dS (w) for site classes (K=11) p: 0.09155 0.09155 0.09155 0.09155 0.09155 0.09155 0.09155 0.09155 0.09155 0.09155 0.08446 w: 0.01640 0.02367 0.02890 0.03361 0.03824 0.04310 0.04852 0.05503 0.06390 0.08063 1.33828 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.078 678.7 176.3 0.1526 0.0122 0.0798 8.3 14.1 7..8 0.085 678.7 176.3 0.1526 0.0132 0.0865 9.0 15.3 8..9 0.027 678.7 176.3 0.1526 0.0042 0.0277 2.9 4.9 9..4 0.077 678.7 176.3 0.1526 0.0119 0.0781 8.1 13.8 9..5 0.089 678.7 176.3 0.1526 0.0138 0.0905 9.4 16.0 8..6 0.299 678.7 176.3 0.1526 0.0465 0.3045 31.5 53.7 7..10 0.042 678.7 176.3 0.1526 0.0065 0.0428 4.4 7.5 10..2 0.033 678.7 176.3 0.1526 0.0052 0.0340 3.5 6.0 10..3 0.014 678.7 176.3 0.1526 0.0022 0.0143 1.5 2.5 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reep1-PE) Pr(w>1) post mean +- SE for w 150 H 0.948 1.271 164 Y 0.971* 1.301 169 T 0.938 1.259 204 V 0.966* 1.294 209 S 0.995** 1.332 214 F 0.999** 1.338 219 L 0.931 1.250 242 S 0.870 1.172 246 A 0.504 0.700 247 A 0.971* 1.301 254 H 0.843 1.137 257 I 0.995** 1.332 261 R 0.998** 1.336 263 S 0.931 1.250 264 S 0.890 1.198 265 S 1.000** 1.338 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Reep1-PE) Pr(w>1) post mean +- SE for w 150 H 0.601 1.282 +- 0.799 164 Y 0.672 1.395 +- 0.769 169 T 0.541 1.185 +- 0.792 204 V 0.697 1.439 +- 0.788 209 S 0.753 1.522 +- 0.709 214 F 0.885 1.711 +- 0.637 219 L 0.527 1.158 +- 0.789 247 A 0.732 1.495 +- 0.777 257 I 0.758 1.533 +- 0.714 261 R 0.872 1.697 +- 0.660 263 S 0.521 1.146 +- 0.784 265 S 0.927 1.765 +- 0.606 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.002 0.016 0.058 0.123 0.198 0.270 0.333 ws: 0.692 0.282 0.024 0.002 0.000 0.000 0.000 0.000 0.000 0.000 Time used: 1:55
Model 1: NearlyNeutral -1999.536754 Model 2: PositiveSelection -1999.17541 Model 0: one-ratio -2025.125189 Model 3: discrete -1999.17541 Model 7: beta -2000.602722 Model 8: beta&w>1 -1999.189626 Model 0 vs 1 51.176870000000235 Model 2 vs 1 0.7226879999998346 Model 8 vs 7 2.826191999999992