--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Nov 25 13:44:00 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/346/PGRP-LB-PD/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2033.31         -2046.73
2      -2033.25         -2044.44
--------------------------------------
TOTAL    -2033.28         -2046.14
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.429569    0.003279    0.325417    0.541663    0.423086   1388.67   1395.10    1.000
r(A<->C){all}   0.171477    0.001170    0.109790    0.240236    0.168847    776.49   1050.29    1.000
r(A<->G){all}   0.207973    0.001728    0.128421    0.288264    0.206254    641.06    882.34    1.000
r(A<->T){all}   0.132867    0.001639    0.055534    0.208155    0.130260    594.80    629.49    1.000
r(C<->G){all}   0.094964    0.000504    0.053544    0.141198    0.093294    770.33    941.45    1.000
r(C<->T){all}   0.287521    0.002089    0.203535    0.381699    0.286065    927.65   1013.66    1.000
r(G<->T){all}   0.105198    0.000923    0.049269    0.163644    0.103085    944.19   1014.89    1.000
pi(A){all}      0.214895    0.000187    0.188397    0.241696    0.214912   1291.03   1329.28    1.000
pi(C){all}      0.333231    0.000244    0.302095    0.362482    0.333285   1132.69   1185.57    1.001
pi(G){all}      0.275918    0.000229    0.244622    0.303762    0.275400   1070.95   1136.05    1.000
pi(T){all}      0.175956    0.000160    0.152789    0.201718    0.175528   1248.39   1297.34    1.000
alpha{1,2}      0.126714    0.004481    0.000208    0.231717    0.128822   1043.93   1068.19    1.000
alpha{3}        1.886459    0.579474    0.681053    3.407272    1.748901   1128.70   1251.37    1.001
pinvar{all}     0.191412    0.012988    0.000006    0.390345    0.184523   1055.21   1135.54    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1876.238336
Model 2: PositiveSelection	-1875.321254
Model 0: one-ratio	-1896.251769
Model 3: discrete	-1875.288646
Model 7: beta	-1878.591073
Model 8: beta&w>1	-1875.297185


Model 0 vs 1	40.026866000000155

Model 2 vs 1	1.8341639999998733

Model 8 vs 7	6.587776000000304

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PD)

            Pr(w>1)     post mean +- SE for w

    13 G      0.997**       1.789
    14 P      0.992**       1.780
    17 L      0.716         1.318
    26 L      0.675         1.248
   214 I      0.904         1.633
   216 D      0.891         1.613
   220 V      0.965*        1.735
   222 T      0.997**       1.789
   235 A      0.847         1.538
   237 Q      0.767         1.404
   238 K      0.981*        1.763

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PD)

            Pr(w>1)     post mean +- SE for w

    13 G      0.889         2.075 +- 0.921
    14 P      0.903         2.119 +- 0.948
   214 I      0.737         1.815 +- 1.064
   216 D      0.542         1.414 +- 0.965
   220 V      0.746         1.822 +- 1.005
   222 T      0.904         2.119 +- 0.939
   235 A      0.647         1.635 +- 1.084
   237 Q      0.512         1.331 +- 1.005
   238 K      0.828         1.979 +- 0.981

>C1
MGDKVSGSVSTSGPTSLAILMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHINDTEGVSSTTAPVVPHVHPQAAAPQKPHQSPP
AAPKVooooo
>C2
MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLNASDGESSTAAPVVPHVHAQAAAPQTPHQSPP
AAPKVooooo
>C3
MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLNATEGVSSTAAPVVPHVHAQAAAPQTPHQSPP
AAPKVooooo
>C4
MGDKVSGSVSTSSLTSPAILMDSEHWEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKAATQTPLAQSP
PAAPKVoooo
>C5
MGDKVSGSVSTSGTTSPAILMNTEHLQQQQLATSWGYSQHMQQANLGTAR
LLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQ
DFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAHAPKYNDRSVGIVLI
GDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLLGHRQVRDTECPGGR
LFAEISSWPHFTHINDTEGVSSTKAPVEPHVHPQAATQQTPPKSPPAAPK
Vooooooooo
>C6
MGDKASGSVSIPSTKPPAILTDSEHFEQQQLATTCGYSQHMQHANLGDGA
ATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVCYTTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISGWPHFTHLNATEGSTPVPIEPHAHPQAASQTPPQSPPQSP
PHAPAAAPKV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=272 

C1              MGDKVSGSVSTSGPTSLAILMDSEQLEQQQLATSCGYSQHMQQANLGDGV
C2              MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
C3              MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
C4              MGDKVSGSVSTSSLTSPAILMDSEHWEQQQLATSCGYSQHMQQANLGDGV
C5              MGDKVSGSVSTSGTTSPAILMNTEHLQQQQLATSWGYSQHMQQANLG---
C6              MGDKASGSVSIPSTKPPAILTDSEHFEQQQLATTCGYSQHMQHANLGDGA
                ****.***** .. .. **  ::*: :******: *******:****   

C1              ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
C2              ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
C3              ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
C4              ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVCYSTPECMKSM
C5              -TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
C6              ATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVCYTTPDCMKSM
                 ******************:**:**************.***:**:*****

C1              RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
C2              RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
C3              RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
C4              RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAHAPKYNDKSVG
C5              RDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAHAPKYNDRSVG
C6              RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
                *****************************:******:*********:***

C1              IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
C2              IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
C3              IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
C4              IVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLLGHRQVRDTEC
C5              IVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLLGHRQVRDTEC
C6              IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
                ********************::**:*************************

C1              PGGRLFAEISSWPHFTHINDTEGV-SSTTAPVVPHVHPQAAAP---QKPH
C2              PGGRLFAEISSWPHFTHLNASDGE-SSTAAPVVPHVHAQAAAP---QTPH
C3              PGGRLFAEISSWPHFTHLNATEGV-SSTAAPVVPHVHAQAAAP---QTPH
C4              PGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKAATQ---TPLA
C5              PGGRLFAEISSWPHFTHINDTEGV-SSTKAPVEPHVHPQAATQ---QTPP
C6              PGGRLFAEISGWPHFTHLNATEGS---TPVPIEPHAHPQAASQTPPQSPP
                **********.******:. ::*    * .*: **.*.:**:        

C1              QSPP----AAPKVooooo----
C2              QSPP----AAPKVooooo----
C3              QSPP----AAPKVooooo----
C4              QSPP----AAPKVoooo-----
C5              KSPP----AAPKVooooooooo
C6              QSPPHAPAAAPKV---------
                :***    *****         




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  260 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  260 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9004]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [9004]--->[8586]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.344 Mb, Max= 30.691 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MGDKVSGSVSTSGPTSLAILMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHINDTEGV-SSTTAPVVPHVHPQAAAP---QKPH
QSPP----AAPKVooooo----
>C2
MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLNASDGE-SSTAAPVVPHVHAQAAAP---QTPH
QSPP----AAPKVooooo----
>C3
MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLNATEGV-SSTAAPVVPHVHAQAAAP---QTPH
QSPP----AAPKVooooo----
>C4
MGDKVSGSVSTSSLTSPAILMDSEHWEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKAATQ---TPLA
QSPP----AAPKVoooo-----
>C5
MGDKVSGSVSTSGTTSPAILMNTEHLQQQQLATSWGYSQHMQQANLG---
-TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAHAPKYNDRSVG
IVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHINDTEGV-SSTKAPVEPHVHPQAATQ---QTPP
KSPP----AAPKVooooooooo
>C6
MGDKASGSVSIPSTKPPAILTDSEHFEQQQLATTCGYSQHMQHANLGDGA
ATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVCYTTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISGWPHFTHLNATEGS---TPVPIEPHAHPQAASQTPPQSPP
QSPPHAPAAAPKV---------

FORMAT of file /tmp/tmp3016354545656366050aln Not Supported[FATAL:T-COFFEE]
>C1
MGDKVSGSVSTSGPTSLAILMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHINDTEGV-SSTTAPVVPHVHPQAAAP---QKPH
QSPP----AAPKVooooo----
>C2
MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLNASDGE-SSTAAPVVPHVHAQAAAP---QTPH
QSPP----AAPKVooooo----
>C3
MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLNATEGV-SSTAAPVVPHVHAQAAAP---QTPH
QSPP----AAPKVooooo----
>C4
MGDKVSGSVSTSSLTSPAILMDSEHWEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKAATQ---TPLA
QSPP----AAPKVoooo-----
>C5
MGDKVSGSVSTSGTTSPAILMNTEHLQQQQLATSWGYSQHMQQANLG---
-TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAHAPKYNDRSVG
IVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHINDTEGV-SSTKAPVEPHVHPQAATQ---QTPP
KSPP----AAPKVooooooooo
>C6
MGDKASGSVSIPSTKPPAILTDSEHFEQQQLATTCGYSQHMQHANLGDGA
ATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVCYTTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISGWPHFTHLNATEGS---TPVPIEPHAHPQAASQTPPQSPP
QSPPHAPAAAPKV---------
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:272 S:96 BS:272
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 94.62 C1	 C2	 94.62
TOP	    1    0	 94.62 C2	 C1	 94.62
BOT	    0    2	 96.15 C1	 C3	 96.15
TOP	    2    0	 96.15 C3	 C1	 96.15
BOT	    0    3	 91.12 C1	 C4	 91.12
TOP	    3    0	 91.12 C4	 C1	 91.12
BOT	    0    4	 93.36 C1	 C5	 93.36
TOP	    4    0	 93.36 C5	 C1	 93.36
BOT	    0    5	 88.54 C1	 C6	 88.54
TOP	    5    0	 88.54 C6	 C1	 88.54
BOT	    1    2	 98.46 C2	 C3	 98.46
TOP	    2    1	 98.46 C3	 C2	 98.46
BOT	    1    3	 91.12 C2	 C4	 91.12
TOP	    3    1	 91.12 C4	 C2	 91.12
BOT	    1    4	 90.23 C2	 C5	 90.23
TOP	    4    1	 90.23 C5	 C2	 90.23
BOT	    1    5	 87.75 C2	 C6	 87.75
TOP	    5    1	 87.75 C6	 C2	 87.75
BOT	    2    3	 91.89 C3	 C4	 91.89
TOP	    3    2	 91.89 C4	 C3	 91.89
BOT	    2    4	 91.80 C3	 C5	 91.80
TOP	    4    2	 91.80 C5	 C3	 91.80
BOT	    2    5	 88.93 C3	 C6	 88.93
TOP	    5    2	 88.93 C6	 C3	 88.93
BOT	    3    4	 89.80 C4	 C5	 89.80
TOP	    4    3	 89.80 C5	 C4	 89.80
BOT	    3    5	 86.96 C4	 C6	 86.96
TOP	    5    3	 86.96 C6	 C4	 86.96
BOT	    4    5	 87.95 C5	 C6	 87.95
TOP	    5    4	 87.95 C6	 C5	 87.95
AVG	 0	 C1	  *	 92.76
AVG	 1	 C2	  *	 92.44
AVG	 2	 C3	  *	 93.45
AVG	 3	 C4	  *	 90.18
AVG	 4	 C5	  *	 90.63
AVG	 5	 C6	  *	 88.03
TOT	 TOT	  *	 91.25
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGGCGACAAGGTGTCTGGATCCGTCTCCACTTCTGGCCCAACTTCCTT
C2              ATGGGCGACAAGGTGTCTGGATCCGTCTCCACTTCTAGCACAACTTCCTC
C3              ATGGGCGACAAGGTGTCTGGATCCGTCTCCACTTCTAGCACAACTTCCTC
C4              ATGGGCGACAAGGTGTCTGGATCCGTATCCACTTCTAGCTTAACTTCCCC
C5              ATGGGCGACAAGGTGTCTGGATCCGTATCCACTTCTGGCACAACTTCCCC
C6              ATGGGCGACAAAGCGTCTGGATCCGTCTCCATTCCCTCGACAAAACCCCC
                ***********.* ************.**** * *      **.: **  

C1              GGCAATCCTCATGGACTCGGAGCAATTGGAGCAGCAACAGCTGGCCACAA
C2              GGCAATCCCCATGGACTCGGAGCAATTGGAGCAGCAACAGCTGGCCACAA
C3              GGCAATCCCCATGGACTCGGAGCAATTGGAGCAGCAACAGCTGGCCACAA
C4              GGCAATCCTCATGGACTCGGAGCATTGGGAGCAGCAACAGCTGGCCACAA
C5              GGCAATTCTTATGAACACAGAGCATTTGCAGCAGCAACAGCTGGCCACAA
C6              AGCAATCCTCACGGACTCGGAGCATTTCGAGCAACAACAGCTGGCCACAA
                .***** *  * *.**:*.*****:*   ****.****************

C1              GTTGTGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGCGACGGTGTG
C2              GTTGTGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGCGACGGTGTG
C3              GTTGTGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGCGACGGTGTG
C4              GTTGTGGCTATAGTCAGCACATGCAGCAGGCAAATCTGGGCGATGGTGTG
C5              GTTGGGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGC---------
C6              CTTGTGGCTATAGCCAGCACATGCAGCATGCGAATTTGGGCGATGGAGCG
                 *** ******** ************** **.*** *****         

C1              GCCACCGCCCGCCTGCTGTCCCGATCCGACTGGGGTGCCCGGCTGCCCAA
C2              GCCACCGCCCGCCTGCTTTCCCGATCCGACTGGGGTGCCCGGCTGCCCAA
C3              GCCACCGCCCGCCTGCTTTCCCGATCCGACTGGGGTGCACGGCTGCCCAA
C4              GCCACCGCCCGACTGCTGTCCAGATCCGACTGGGGTGCCCGGCTGCCCAA
C5              ---ACCGCCCGGCTTCTGTCCCGATCCGACTGGGGTGCCCGCCTGCCCAA
C6              GCCACCGCTCGACTTCTGTCCCGCTCCGACTGGGGCGCCCGTCTGCCCAA
                   ***** ** ** ** ***.*.*********** **.** ********

C1              GTCCGTGGAGCACTTCCAGGGTCCCGCGCCCTACGTCATCATCCATCACT
C2              GTCTGTGGACCACTTCCAGGGACCCGCGCCCTACGTCATCATCCACCACT
C3              GTCCGTGGAGCACTTCCAGGGACCAGCGCCTTACGTCATCATCCACCACT
C4              GTCCGTGGACCACTTTCAGGGACCCGCGCCCTACGTCATCATCCACCACT
C5              GTCCGTGGAGCACTTTCAAGGACCCGCGCCCTACGTGATCATCCACCACT
C6              GTCCGTGGAGCACTTCGAGGGTCCCGCCCCCTACGTGATCATCCACCACT
                *** ***** *****  *.**:**.** ** ***** ******** ****

C1              CGTACATGCCGGCCGTGTGCTACTCCACTCCGGACTGCATGAAGAGCATG
C2              CGTACATGCCGGCCGTGTGCTACTCCACTCCGGAATGCATGAAGAGCATG
C3              CGTATATGCCGGCCGTGTGCTACTCAACTCCGGAATGCATGAAGAGCATG
C4              CGTACATGCCAGGCGTGTGCTACTCCACTCCGGAGTGCATGAAGAGCATG
C5              CGTACATGCCAGCCGTGTGCTACTCCACTCCGGACTGCATGAAGAGCATG
C6              CTTACATGCCGGCGGTGTGCTATACCACTCCCGACTGCATGAAGAGCATG
                * ** *****.*  ******** :*.***** ** ***************

C1              CGGGACATGCAGGACTTCCATCAGCTGGAGCGCGGATGGAACGATATTGG
C2              CGGGACATGCAGGACTTCCATCAGCTGGAGCGCGGATGGAACGATATTGG
C3              CGGGACATGCAGGACTTTCATCAGCTGGAGCGCGGATGGAACGATATTGG
C4              CGGGACATGCAGGACTTCCACCAGCTGGAGCGCGGATGGAACGATATCGG
C5              CGGGACATGCAGGACTTCCACCAGCTGGAGCGCGGTTGGAACGATATCGG
C6              CGCGACATGCAGGACTTCCACCAGCTGGAGCGCGGTTGGAACGACATCGG
                ** ************** ** **************:******** ** **

C1              TTATAGCTTTGGCATCGGCGGCGATGGCATGATTTACACCGGCAGGGGAT
C2              TTATAGCTTTGGCATCGGCGGCGATGGCATGATCTACACCGGCAGGGGAT
C3              TTATAGCTTTGGCATCGGCGGCGATGGCATGATCTACACCGGCAGGGGAT
C4              ATATAGCTTTGGCATCGGCGGCGATGGCATGATCTACACCGGCAGGGGAT
C5              ATATAGCTTTGGCATCGGCGGCGATGGCATGATCTACGCAGGCAGGGGAT
C6              CTATAGCTTCGGCATCGGCGGCGATGGCATGATCTACACCGGAAGGGGAT
                 ******** *********************** ***.*.**.*******

C1              TCAATGTCATCGGAGCTCATGCACCCAAGTACAATGACAAGAGCGTGGGC
C2              TCAATGTCATCGGAGCTCATGCACCCAAGTACAATGACAAGAGCGTGGGC
C3              TCAATGTCATCGGAGCTCATGCACCGAAGTACAATGACAAGAGCGTGGGC
C4              TCAATGTCGTCGGAGCTCATGCGCCGAAGTACAATGACAAGAGCGTGGGC
C5              TCAATGTCATCGGAGCTCATGCGCCGAAGTACAATGACAGGAGCGTGGGC
C6              TCAACGTTATCGGAGCTCATGCACCCAAGTACAATGACAAGAGCGTGGGC
                **** ** .*************.** *************.**********

C1              ATTGTGCTGATCGGAGATTGGAGAACCGAACTGCCGCCCAAGCAGATGCT
C2              ATCGTGCTGATCGGAGATTGGAGAACCGAACTGCCGCCCAAGCAGATGCT
C3              ATTGTGCTGATCGGAGATTGGAGAACCGAACTGCCGCCCAAGCAGATGCT
C4              ATCGTGCTGATCGGAGATTGGAGAACTGAACTGCCGCCCAAGCAGATGCT
C5              ATCGTGCTGATCGGAGATTGGAGAACTGAACTTCCGCCCAAGCAGATGCT
C6              ATCGTGCTGATCGGAGATTGGAGAACTGAACTGCCGCCCAAACAGATGCT
                ** *********************** ***** ********.********

C1              GGATGCGGCCAAGAACCTGATCGCCTTTGGCGTTTTCAAGGGCTACATTG
C2              GGATGCGGCCAAGAACCTGATCGCCTTCGGAGTTTTCAAGGGCTACATTG
C3              GGATGCGGCCAAGAACCTGATCGCCTTCGGCGTTTTCAAGGGCTACATTG
C4              GGATGCGGCCAGGAACCTGATCTCCTTCGGGGTGTTCAAGGGCTACATTG
C5              GGATGCGGCCAAGGACCTGATCGCCTTCGGGGTGTTCAAGGGCTACATTG
C6              GGACGCGGCCAAAAACCTGATCGCCTTCGGCGTGTTCAAGGGCTACATTG
                *** *******...******** **** ** ** ****************

C1              ACCCTGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
C2              ACCCCGCCTACAAACTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
C3              ACCCCGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
C4              ACCCCGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
C5              ACCCCGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
C6              ACCCCGCATACAAGCTGCTGGGCCACCGACAGGTTCGTGACACCGAGTGT
                **** **.*****.******************** ** ** *********

C1              CCTGGCGGCCGCCTGTTCGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
C2              CCTGGAGGCCGCCTCTTCGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
C3              CCTGGCGGCCGCCTCTTCGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
C4              CCTGGAGGCCGCCTGTTTGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
C5              CCTGGGGGCCGCCTGTTTGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
C6              CCCGGAGGCAGGCTGTTCGCGGAGATCTCCGGCTGGCCGCACTTTACCCA
                ** ** ***.* ** ** ** *********.*******************

C1              CATAAACGACACCGAAGGCGTC---AGCAGCACCACGGCGCCCGTCGTGC
C2              CCTAAACGCCAGCGACGGCGAG---AGCAGCACTGCGGCGCCCGTCGTGC
C3              CCTAAACGCCACCGAAGGCGTG---AGCAGCACTGCGGCGCCCGTCGTGC
C4              CCTAAGCGAAACCGAAGGCGTAGTTAGCAGCACTGCTGCGCCCGTCGAGC
C5              CATAAACGACACCGAAGGCGTT---AGCAGTACGAAGGCGCCGGTCGAGC
C6              CCTAAACGCCACCGAAGGCAGC---------ACCCCCGTCCCCATTGAAC
                *.***.**..* ***.***.           **  . *  ** .* *:.*

C1              CCCACGTCCATCCACAGGCGGCAGCACCA---------CAAAAGCCGCAC
C2              CCCATGTCCATGCACAGGCGGCAGCACCA---------CAAACGCCGCAC
C3              CCCATGTCCATGCACAGGCGGCAGCACCA---------CAAACGCCGCAC
C4              CCCACGTCCATCCAAAGGCGGCAACACAA---------ACGCCACTCGCC
C5              CCCACGTCCATCCACAGGCGGCAACACAA---------CAAACGCCGCCC
C6              CGCACGCACATCCCCAGGCGGCGTCCCAAACGCCACCCCAATCACCACCC
                * ** * .*** *..*******. *.*.*         ... ..*   .*

C1              CAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
C2              CAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
C3              CAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
C4              CAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
C5              AAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
C6              CAATCGCCACCCCATGCCCCGGCAGCTGCGCCCAAGGTC-----------
                .**** **.**.            ***************           

C1              ----------------
C2              ----------------
C3              ----------------
C4              ----------------
C5              ----------------
C6              ----------------
                                



>C1
ATGGGCGACAAGGTGTCTGGATCCGTCTCCACTTCTGGCCCAACTTCCTT
GGCAATCCTCATGGACTCGGAGCAATTGGAGCAGCAACAGCTGGCCACAA
GTTGTGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGCGACGGTGTG
GCCACCGCCCGCCTGCTGTCCCGATCCGACTGGGGTGCCCGGCTGCCCAA
GTCCGTGGAGCACTTCCAGGGTCCCGCGCCCTACGTCATCATCCATCACT
CGTACATGCCGGCCGTGTGCTACTCCACTCCGGACTGCATGAAGAGCATG
CGGGACATGCAGGACTTCCATCAGCTGGAGCGCGGATGGAACGATATTGG
TTATAGCTTTGGCATCGGCGGCGATGGCATGATTTACACCGGCAGGGGAT
TCAATGTCATCGGAGCTCATGCACCCAAGTACAATGACAAGAGCGTGGGC
ATTGTGCTGATCGGAGATTGGAGAACCGAACTGCCGCCCAAGCAGATGCT
GGATGCGGCCAAGAACCTGATCGCCTTTGGCGTTTTCAAGGGCTACATTG
ACCCTGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
CCTGGCGGCCGCCTGTTCGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
CATAAACGACACCGAAGGCGTC---AGCAGCACCACGGCGCCCGTCGTGC
CCCACGTCCATCCACAGGCGGCAGCACCA---------CAAAAGCCGCAC
CAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
----------------
>C2
ATGGGCGACAAGGTGTCTGGATCCGTCTCCACTTCTAGCACAACTTCCTC
GGCAATCCCCATGGACTCGGAGCAATTGGAGCAGCAACAGCTGGCCACAA
GTTGTGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGCGACGGTGTG
GCCACCGCCCGCCTGCTTTCCCGATCCGACTGGGGTGCCCGGCTGCCCAA
GTCTGTGGACCACTTCCAGGGACCCGCGCCCTACGTCATCATCCACCACT
CGTACATGCCGGCCGTGTGCTACTCCACTCCGGAATGCATGAAGAGCATG
CGGGACATGCAGGACTTCCATCAGCTGGAGCGCGGATGGAACGATATTGG
TTATAGCTTTGGCATCGGCGGCGATGGCATGATCTACACCGGCAGGGGAT
TCAATGTCATCGGAGCTCATGCACCCAAGTACAATGACAAGAGCGTGGGC
ATCGTGCTGATCGGAGATTGGAGAACCGAACTGCCGCCCAAGCAGATGCT
GGATGCGGCCAAGAACCTGATCGCCTTCGGAGTTTTCAAGGGCTACATTG
ACCCCGCCTACAAACTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
CCTGGAGGCCGCCTCTTCGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
CCTAAACGCCAGCGACGGCGAG---AGCAGCACTGCGGCGCCCGTCGTGC
CCCATGTCCATGCACAGGCGGCAGCACCA---------CAAACGCCGCAC
CAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
----------------
>C3
ATGGGCGACAAGGTGTCTGGATCCGTCTCCACTTCTAGCACAACTTCCTC
GGCAATCCCCATGGACTCGGAGCAATTGGAGCAGCAACAGCTGGCCACAA
GTTGTGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGCGACGGTGTG
GCCACCGCCCGCCTGCTTTCCCGATCCGACTGGGGTGCACGGCTGCCCAA
GTCCGTGGAGCACTTCCAGGGACCAGCGCCTTACGTCATCATCCACCACT
CGTATATGCCGGCCGTGTGCTACTCAACTCCGGAATGCATGAAGAGCATG
CGGGACATGCAGGACTTTCATCAGCTGGAGCGCGGATGGAACGATATTGG
TTATAGCTTTGGCATCGGCGGCGATGGCATGATCTACACCGGCAGGGGAT
TCAATGTCATCGGAGCTCATGCACCGAAGTACAATGACAAGAGCGTGGGC
ATTGTGCTGATCGGAGATTGGAGAACCGAACTGCCGCCCAAGCAGATGCT
GGATGCGGCCAAGAACCTGATCGCCTTCGGCGTTTTCAAGGGCTACATTG
ACCCCGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
CCTGGCGGCCGCCTCTTCGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
CCTAAACGCCACCGAAGGCGTG---AGCAGCACTGCGGCGCCCGTCGTGC
CCCATGTCCATGCACAGGCGGCAGCACCA---------CAAACGCCGCAC
CAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
----------------
>C4
ATGGGCGACAAGGTGTCTGGATCCGTATCCACTTCTAGCTTAACTTCCCC
GGCAATCCTCATGGACTCGGAGCATTGGGAGCAGCAACAGCTGGCCACAA
GTTGTGGCTATAGTCAGCACATGCAGCAGGCAAATCTGGGCGATGGTGTG
GCCACCGCCCGACTGCTGTCCAGATCCGACTGGGGTGCCCGGCTGCCCAA
GTCCGTGGACCACTTTCAGGGACCCGCGCCCTACGTCATCATCCACCACT
CGTACATGCCAGGCGTGTGCTACTCCACTCCGGAGTGCATGAAGAGCATG
CGGGACATGCAGGACTTCCACCAGCTGGAGCGCGGATGGAACGATATCGG
ATATAGCTTTGGCATCGGCGGCGATGGCATGATCTACACCGGCAGGGGAT
TCAATGTCGTCGGAGCTCATGCGCCGAAGTACAATGACAAGAGCGTGGGC
ATCGTGCTGATCGGAGATTGGAGAACTGAACTGCCGCCCAAGCAGATGCT
GGATGCGGCCAGGAACCTGATCTCCTTCGGGGTGTTCAAGGGCTACATTG
ACCCCGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
CCTGGAGGCCGCCTGTTTGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
CCTAAGCGAAACCGAAGGCGTAGTTAGCAGCACTGCTGCGCCCGTCGAGC
CCCACGTCCATCCAAAGGCGGCAACACAA---------ACGCCACTCGCC
CAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
----------------
>C5
ATGGGCGACAAGGTGTCTGGATCCGTATCCACTTCTGGCACAACTTCCCC
GGCAATTCTTATGAACACAGAGCATTTGCAGCAGCAACAGCTGGCCACAA
GTTGGGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGC---------
---ACCGCCCGGCTTCTGTCCCGATCCGACTGGGGTGCCCGCCTGCCCAA
GTCCGTGGAGCACTTTCAAGGACCCGCGCCCTACGTGATCATCCACCACT
CGTACATGCCAGCCGTGTGCTACTCCACTCCGGACTGCATGAAGAGCATG
CGGGACATGCAGGACTTCCACCAGCTGGAGCGCGGTTGGAACGATATCGG
ATATAGCTTTGGCATCGGCGGCGATGGCATGATCTACGCAGGCAGGGGAT
TCAATGTCATCGGAGCTCATGCGCCGAAGTACAATGACAGGAGCGTGGGC
ATCGTGCTGATCGGAGATTGGAGAACTGAACTTCCGCCCAAGCAGATGCT
GGATGCGGCCAAGGACCTGATCGCCTTCGGGGTGTTCAAGGGCTACATTG
ACCCCGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
CCTGGGGGCCGCCTGTTTGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
CATAAACGACACCGAAGGCGTT---AGCAGTACGAAGGCGCCGGTCGAGC
CCCACGTCCATCCACAGGCGGCAACACAA---------CAAACGCCGCCC
AAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
----------------
>C6
ATGGGCGACAAAGCGTCTGGATCCGTCTCCATTCCCTCGACAAAACCCCC
AGCAATCCTCACGGACTCGGAGCATTTCGAGCAACAACAGCTGGCCACAA
CTTGTGGCTATAGCCAGCACATGCAGCATGCGAATTTGGGCGATGGAGCG
GCCACCGCTCGACTTCTGTCCCGCTCCGACTGGGGCGCCCGTCTGCCCAA
GTCCGTGGAGCACTTCGAGGGTCCCGCCCCCTACGTGATCATCCACCACT
CTTACATGCCGGCGGTGTGCTATACCACTCCCGACTGCATGAAGAGCATG
CGCGACATGCAGGACTTCCACCAGCTGGAGCGCGGTTGGAACGACATCGG
CTATAGCTTCGGCATCGGCGGCGATGGCATGATCTACACCGGAAGGGGAT
TCAACGTTATCGGAGCTCATGCACCCAAGTACAATGACAAGAGCGTGGGC
ATCGTGCTGATCGGAGATTGGAGAACTGAACTGCCGCCCAAACAGATGCT
GGACGCGGCCAAAAACCTGATCGCCTTCGGCGTGTTCAAGGGCTACATTG
ACCCCGCATACAAGCTGCTGGGCCACCGACAGGTTCGTGACACCGAGTGT
CCCGGAGGCAGGCTGTTCGCGGAGATCTCCGGCTGGCCGCACTTTACCCA
CCTAAACGCCACCGAAGGCAGC---------ACCCCCGTCCCCATTGAAC
CGCACGCACATCCCCAGGCGGCGTCCCAAACGCCACCCCAATCACCACCC
CAATCGCCACCCCATGCCCCGGCAGCTGCGCCCAAGGTC-----------
----------------
>C1
MGDKVSGSVSTSGPTSLAILMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHINDTEGVoSSTTAPVVPHVHPQAAAPoooQKPH
QSPPooooAAPKV
>C2
MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLNASDGEoSSTAAPVVPHVHAQAAAPoooQTPH
QSPPooooAAPKV
>C3
MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLNATEGVoSSTAAPVVPHVHAQAAAPoooQTPH
QSPPooooAAPKV
>C4
MGDKVSGSVSTSSLTSPAILMDSEHWEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKAATQoooTPLA
QSPPooooAAPKV
>C5
MGDKVSGSVSTSGTTSPAILMNTEHLQQQQLATSWGYSQHMQQANLGooo
oTARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAHAPKYNDRSVG
IVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHINDTEGVoSSTKAPVEPHVHPQAATQoooQTPP
KSPPooooAAPKV
>C6
MGDKASGSVSIPSTKPPAILTDSEHFEQQQLATTCGYSQHMQHANLGDGA
ATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVCYTTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISGWPHFTHLNATEGSoooTPVPIEPHAHPQAASQTPPQSPP
QSPPHAPAAAPKV


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 816 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1480081029
      Setting output file names to "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1150854165
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 6872989632
      Seed = 5993488
      Swapseed = 1480081029
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 35 unique site patterns
      Division 2 has 33 unique site patterns
      Division 3 has 70 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2429.902395 -- -24.965149
         Chain 2 -- -2453.408033 -- -24.965149
         Chain 3 -- -2475.616655 -- -24.965149
         Chain 4 -- -2455.225181 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2455.225181 -- -24.965149
         Chain 2 -- -2436.902277 -- -24.965149
         Chain 3 -- -2437.768580 -- -24.965149
         Chain 4 -- -2427.949812 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2429.902] (-2453.408) (-2475.617) (-2455.225) * [-2455.225] (-2436.902) (-2437.769) (-2427.950) 
        500 -- (-2060.900) (-2057.917) [-2065.259] (-2072.599) * (-2057.383) [-2060.804] (-2067.249) (-2063.441) -- 0:33:19
       1000 -- (-2052.323) [-2056.038] (-2051.144) (-2051.183) * [-2048.921] (-2049.485) (-2050.793) (-2051.661) -- 0:16:39
       1500 -- [-2052.399] (-2047.263) (-2051.497) (-2040.363) * [-2042.134] (-2052.130) (-2047.747) (-2041.678) -- 0:11:05
       2000 -- (-2048.884) (-2041.765) (-2037.896) [-2034.619] * [-2036.635] (-2035.328) (-2040.827) (-2042.279) -- 0:08:19
       2500 -- (-2033.187) (-2040.145) (-2036.910) [-2040.348] * (-2039.600) (-2037.468) (-2034.570) [-2036.263] -- 0:06:39
       3000 -- (-2036.713) (-2038.782) [-2043.162] (-2034.622) * (-2040.530) (-2037.811) (-2034.855) [-2034.105] -- 0:05:32
       3500 -- (-2040.609) (-2037.552) (-2046.915) [-2035.360] * (-2039.357) [-2036.508] (-2040.146) (-2044.503) -- 0:04:44
       4000 -- (-2039.888) (-2033.112) (-2034.223) [-2033.738] * [-2035.152] (-2036.430) (-2033.588) (-2036.330) -- 0:08:18
       4500 -- (-2040.535) [-2037.910] (-2038.119) (-2038.361) * [-2034.931] (-2040.056) (-2036.506) (-2039.419) -- 0:07:22
       5000 -- (-2037.110) (-2038.663) (-2040.026) [-2040.511] * (-2033.503) (-2039.004) [-2039.453] (-2034.908) -- 0:06:38

      Average standard deviation of split frequencies: 0.062854

       5500 -- (-2035.200) (-2044.377) (-2044.867) [-2039.310] * [-2032.636] (-2032.435) (-2036.797) (-2038.583) -- 0:06:01
       6000 -- [-2035.454] (-2041.424) (-2035.893) (-2034.908) * [-2034.925] (-2036.107) (-2038.087) (-2045.716) -- 0:05:31
       6500 -- (-2042.174) (-2036.116) [-2036.193] (-2032.390) * (-2039.542) (-2033.822) [-2031.120] (-2044.362) -- 0:05:05
       7000 -- (-2038.315) (-2044.355) [-2036.496] (-2037.420) * [-2035.356] (-2042.841) (-2037.425) (-2035.289) -- 0:04:43
       7500 -- [-2033.976] (-2044.166) (-2033.781) (-2043.513) * [-2037.394] (-2046.129) (-2039.486) (-2030.279) -- 0:06:37
       8000 -- [-2036.139] (-2051.454) (-2038.960) (-2038.767) * (-2040.555) (-2040.497) (-2040.608) [-2032.515] -- 0:06:12
       8500 -- (-2039.326) (-2044.015) [-2031.145] (-2042.963) * (-2044.934) [-2044.739] (-2037.724) (-2031.391) -- 0:05:49
       9000 -- (-2035.328) [-2040.630] (-2032.591) (-2038.335) * [-2036.212] (-2041.904) (-2038.157) (-2033.355) -- 0:05:30
       9500 -- (-2045.015) (-2034.472) [-2033.216] (-2037.112) * (-2039.408) [-2045.985] (-2044.569) (-2037.607) -- 0:05:12
      10000 -- (-2041.184) (-2034.703) [-2041.086] (-2034.345) * (-2034.312) (-2040.535) (-2045.175) [-2034.165] -- 0:04:57

      Average standard deviation of split frequencies: 0.077340

      10500 -- (-2031.233) (-2036.030) [-2034.200] (-2040.536) * [-2034.323] (-2037.334) (-2042.427) (-2039.589) -- 0:04:42
      11000 -- (-2041.243) [-2032.742] (-2038.576) (-2038.418) * (-2035.307) [-2037.527] (-2038.689) (-2031.995) -- 0:05:59
      11500 -- (-2039.204) (-2032.516) [-2033.368] (-2036.595) * (-2040.294) [-2035.956] (-2042.529) (-2033.967) -- 0:05:43
      12000 -- (-2032.711) (-2036.119) (-2041.518) [-2036.581] * (-2037.118) (-2039.252) (-2041.082) [-2035.914] -- 0:05:29
      12500 -- [-2036.846] (-2041.419) (-2036.827) (-2041.516) * (-2036.609) [-2037.074] (-2040.678) (-2034.737) -- 0:05:16
      13000 -- [-2037.753] (-2037.389) (-2031.630) (-2039.229) * (-2036.525) (-2036.719) [-2040.192] (-2037.142) -- 0:05:03
      13500 -- (-2047.922) (-2037.823) (-2038.141) [-2039.301] * (-2041.729) (-2037.952) (-2041.502) [-2033.031] -- 0:04:52
      14000 -- [-2047.315] (-2035.046) (-2039.857) (-2034.294) * (-2037.617) [-2037.377] (-2038.997) (-2032.671) -- 0:04:41
      14500 -- (-2040.755) (-2035.277) (-2040.580) [-2044.027] * (-2036.631) (-2036.445) (-2033.622) [-2037.575] -- 0:05:39
      15000 -- (-2033.542) [-2036.168] (-2039.284) (-2038.769) * (-2045.344) [-2037.300] (-2039.059) (-2034.840) -- 0:05:28

      Average standard deviation of split frequencies: 0.044194

      15500 -- (-2039.719) (-2032.924) [-2043.248] (-2031.577) * [-2035.868] (-2040.612) (-2040.520) (-2038.569) -- 0:05:17
      16000 -- [-2035.927] (-2045.379) (-2040.855) (-2034.349) * (-2039.014) (-2040.028) (-2041.883) [-2038.343] -- 0:05:07
      16500 -- (-2046.671) (-2046.281) [-2038.973] (-2038.836) * [-2035.133] (-2035.109) (-2038.844) (-2038.758) -- 0:04:58
      17000 -- (-2037.409) (-2035.872) [-2042.206] (-2039.636) * (-2036.479) (-2033.584) (-2040.054) [-2033.465] -- 0:04:49
      17500 -- (-2034.898) (-2036.838) (-2040.543) [-2035.139] * [-2031.607] (-2040.148) (-2038.817) (-2043.223) -- 0:04:40
      18000 -- (-2036.084) (-2038.833) [-2044.382] (-2037.854) * (-2033.533) [-2032.875] (-2037.864) (-2045.928) -- 0:05:27
      18500 -- (-2041.640) (-2039.569) (-2038.801) [-2033.446] * (-2036.540) [-2037.379] (-2035.486) (-2039.705) -- 0:05:18
      19000 -- (-2036.632) (-2037.932) [-2032.828] (-2036.951) * [-2034.936] (-2041.594) (-2039.322) (-2041.332) -- 0:05:09
      19500 -- (-2043.283) (-2035.929) [-2040.794] (-2034.576) * (-2036.064) (-2038.040) (-2037.370) [-2036.045] -- 0:05:01
      20000 -- (-2042.365) [-2035.567] (-2043.808) (-2036.256) * (-2029.559) (-2039.392) [-2036.939] (-2038.028) -- 0:04:54

      Average standard deviation of split frequencies: 0.045620

      20500 -- (-2045.743) [-2038.614] (-2040.279) (-2040.518) * (-2034.540) (-2038.287) [-2036.579] (-2040.196) -- 0:04:46
      21000 -- (-2042.132) [-2030.812] (-2038.354) (-2038.665) * [-2038.553] (-2039.532) (-2039.197) (-2041.936) -- 0:04:39
      21500 -- (-2041.305) (-2036.274) [-2033.730] (-2033.998) * (-2034.630) [-2047.683] (-2039.568) (-2034.766) -- 0:04:33
      22000 -- (-2040.246) (-2030.289) [-2030.756] (-2032.719) * [-2032.988] (-2034.722) (-2038.379) (-2040.375) -- 0:05:11
      22500 -- (-2034.846) (-2043.478) [-2034.616] (-2034.825) * (-2037.781) (-2038.756) [-2038.301] (-2035.419) -- 0:05:04
      23000 -- (-2041.683) [-2035.032] (-2036.863) (-2038.059) * (-2035.449) (-2038.140) [-2035.986] (-2040.605) -- 0:04:57
      23500 -- (-2045.172) [-2036.315] (-2040.085) (-2036.732) * [-2039.787] (-2037.905) (-2044.002) (-2038.919) -- 0:04:50
      24000 -- [-2041.534] (-2039.705) (-2036.934) (-2038.648) * (-2040.272) [-2035.988] (-2035.473) (-2040.399) -- 0:04:44
      24500 -- (-2038.376) [-2037.270] (-2035.638) (-2038.561) * (-2038.839) (-2036.417) [-2031.682] (-2043.331) -- 0:04:38
      25000 -- [-2035.151] (-2040.194) (-2040.361) (-2043.704) * (-2040.943) (-2040.252) [-2037.269] (-2040.284) -- 0:04:33

      Average standard deviation of split frequencies: 0.045327

      25500 -- [-2034.768] (-2036.250) (-2036.434) (-2038.035) * (-2038.101) (-2039.753) [-2037.054] (-2038.287) -- 0:05:05
      26000 -- (-2039.939) (-2036.876) [-2032.794] (-2032.622) * (-2033.041) [-2041.057] (-2035.329) (-2044.885) -- 0:04:59
      26500 -- (-2034.360) (-2042.139) (-2036.800) [-2034.444] * (-2033.275) (-2035.032) [-2044.341] (-2057.903) -- 0:04:53
      27000 -- [-2034.984] (-2032.164) (-2034.890) (-2032.357) * (-2043.211) [-2034.429] (-2041.886) (-2038.504) -- 0:04:48
      27500 -- (-2034.533) [-2030.840] (-2040.882) (-2042.804) * (-2046.091) [-2034.534] (-2037.536) (-2037.450) -- 0:04:42
      28000 -- (-2036.292) (-2038.477) [-2031.865] (-2033.595) * (-2038.269) [-2035.763] (-2045.544) (-2040.093) -- 0:04:37
      28500 -- [-2035.475] (-2041.158) (-2032.200) (-2032.624) * [-2036.279] (-2043.191) (-2039.433) (-2045.547) -- 0:04:32
      29000 -- [-2034.561] (-2035.769) (-2035.966) (-2038.264) * (-2042.230) (-2038.834) [-2037.990] (-2039.564) -- 0:05:01
      29500 -- (-2030.225) [-2038.260] (-2039.251) (-2035.396) * (-2038.186) (-2044.732) (-2039.369) [-2035.383] -- 0:04:56
      30000 -- (-2037.639) [-2036.274] (-2042.420) (-2044.639) * [-2037.238] (-2040.058) (-2036.889) (-2042.658) -- 0:04:51

      Average standard deviation of split frequencies: 0.023058

      30500 -- (-2035.161) (-2040.766) (-2034.812) [-2037.113] * (-2035.569) (-2038.319) (-2041.925) [-2035.395] -- 0:04:46
      31000 -- (-2032.978) (-2034.721) (-2032.697) [-2036.167] * (-2036.419) (-2033.879) (-2038.068) [-2038.724] -- 0:04:41
      31500 -- (-2037.149) [-2033.922] (-2034.236) (-2048.556) * [-2036.726] (-2034.783) (-2040.794) (-2033.474) -- 0:04:36
      32000 -- (-2034.218) (-2037.815) [-2036.884] (-2035.494) * (-2043.286) [-2036.221] (-2035.223) (-2032.703) -- 0:04:32
      32500 -- (-2039.476) [-2037.235] (-2035.108) (-2041.058) * (-2039.421) [-2036.145] (-2038.371) (-2032.551) -- 0:04:57
      33000 -- (-2040.822) (-2036.025) (-2042.028) [-2035.539] * (-2041.771) (-2043.012) (-2038.712) [-2033.919] -- 0:04:53
      33500 -- (-2044.836) [-2032.627] (-2035.951) (-2042.414) * (-2036.887) (-2040.560) (-2037.503) [-2031.896] -- 0:04:48
      34000 -- [-2039.647] (-2039.905) (-2042.630) (-2037.426) * (-2041.540) [-2037.753] (-2040.553) (-2036.888) -- 0:04:44
      34500 -- [-2038.992] (-2033.200) (-2042.121) (-2036.478) * (-2034.845) [-2035.148] (-2041.894) (-2040.031) -- 0:04:39
      35000 -- (-2037.736) [-2035.206] (-2037.955) (-2043.055) * (-2032.045) (-2039.738) [-2032.422] (-2033.133) -- 0:04:35

      Average standard deviation of split frequencies: 0.013095

      35500 -- (-2044.400) (-2036.362) (-2041.672) [-2034.790] * [-2032.821] (-2034.486) (-2037.313) (-2042.928) -- 0:04:31
      36000 -- (-2034.441) (-2033.160) [-2036.176] (-2039.660) * [-2032.855] (-2040.499) (-2034.441) (-2035.224) -- 0:04:54
      36500 -- (-2036.695) (-2034.628) (-2044.805) [-2034.523] * (-2037.315) (-2044.489) [-2033.226] (-2036.411) -- 0:04:50
      37000 -- (-2040.274) (-2038.425) [-2036.827] (-2044.626) * (-2034.631) [-2037.925] (-2031.499) (-2045.435) -- 0:04:46
      37500 -- (-2052.263) (-2032.939) (-2038.450) [-2039.611] * (-2038.540) (-2036.226) (-2038.441) [-2036.819] -- 0:04:42
      38000 -- (-2048.453) (-2039.043) (-2050.838) [-2038.849] * (-2039.577) [-2034.186] (-2035.243) (-2041.204) -- 0:04:38
      38500 -- (-2041.612) (-2037.990) (-2042.959) [-2036.744] * (-2036.047) (-2038.610) (-2041.516) [-2040.444] -- 0:04:34
      39000 -- (-2040.423) (-2036.086) (-2041.999) [-2036.073] * [-2035.303] (-2034.506) (-2052.242) (-2038.466) -- 0:04:31
      39500 -- (-2038.723) [-2031.553] (-2039.331) (-2037.956) * [-2033.733] (-2033.484) (-2038.136) (-2045.437) -- 0:04:27
      40000 -- (-2039.097) (-2037.298) [-2041.959] (-2033.290) * (-2036.241) (-2037.071) [-2041.237] (-2040.187) -- 0:04:48

      Average standard deviation of split frequencies: 0.023184

      40500 -- (-2038.817) (-2037.194) [-2038.817] (-2041.246) * (-2031.692) [-2032.284] (-2036.973) (-2037.137) -- 0:04:44
      41000 -- (-2032.713) (-2038.755) [-2035.963] (-2038.027) * (-2039.103) (-2037.782) (-2035.280) [-2039.761] -- 0:04:40
      41500 -- [-2045.263] (-2039.488) (-2040.062) (-2035.946) * (-2041.789) [-2035.450] (-2035.444) (-2034.517) -- 0:04:37
      42000 -- (-2038.851) [-2033.926] (-2035.644) (-2038.722) * (-2038.437) (-2038.957) [-2037.239] (-2042.911) -- 0:04:33
      42500 -- (-2036.459) (-2043.887) (-2041.290) [-2037.121] * (-2036.414) (-2044.873) [-2037.359] (-2032.895) -- 0:04:30
      43000 -- (-2044.300) (-2035.446) (-2040.077) [-2038.347] * [-2038.333] (-2035.685) (-2048.074) (-2039.262) -- 0:04:27
      43500 -- (-2042.214) (-2038.414) [-2033.243] (-2041.671) * (-2035.528) [-2038.188] (-2036.355) (-2037.295) -- 0:04:45
      44000 -- (-2037.928) (-2037.581) (-2039.636) [-2042.432] * [-2033.947] (-2034.220) (-2033.188) (-2035.833) -- 0:04:42
      44500 -- (-2040.351) (-2040.897) (-2040.110) [-2038.569] * (-2041.453) (-2036.807) (-2039.825) [-2033.969] -- 0:04:39
      45000 -- (-2038.832) (-2040.100) (-2035.273) [-2034.829] * (-2038.809) (-2046.994) [-2038.335] (-2032.526) -- 0:04:35

      Average standard deviation of split frequencies: 0.007686

      45500 -- (-2041.172) [-2040.799] (-2041.599) (-2036.336) * (-2035.315) (-2034.203) [-2034.873] (-2033.309) -- 0:04:32
      46000 -- (-2040.016) [-2034.913] (-2047.249) (-2043.544) * (-2036.431) (-2035.470) (-2034.085) [-2042.958] -- 0:04:29
      46500 -- (-2040.337) [-2036.842] (-2045.469) (-2031.974) * [-2035.053] (-2041.403) (-2042.150) (-2037.886) -- 0:04:26
      47000 -- (-2040.559) [-2038.357] (-2037.199) (-2033.071) * [-2035.854] (-2045.368) (-2036.517) (-2047.034) -- 0:04:43
      47500 -- (-2039.602) (-2036.623) (-2038.767) [-2036.292] * (-2040.039) (-2043.546) (-2044.304) [-2040.022] -- 0:04:40
      48000 -- (-2036.215) (-2036.505) (-2037.294) [-2032.276] * (-2038.315) (-2045.002) (-2046.806) [-2038.511] -- 0:04:37
      48500 -- (-2042.599) [-2029.990] (-2037.360) (-2037.770) * [-2037.917] (-2034.251) (-2035.656) (-2033.715) -- 0:04:34
      49000 -- (-2040.289) (-2036.063) (-2035.474) [-2037.459] * (-2038.775) [-2041.707] (-2037.483) (-2033.577) -- 0:04:31
      49500 -- [-2034.049] (-2035.670) (-2035.727) (-2035.770) * (-2036.156) [-2047.762] (-2032.998) (-2034.857) -- 0:04:28
      50000 -- (-2042.470) [-2036.972] (-2039.433) (-2034.770) * (-2035.584) (-2049.307) (-2036.937) [-2042.103] -- 0:04:26

      Average standard deviation of split frequencies: 0.002326

      50500 -- (-2034.077) (-2037.667) (-2037.749) [-2034.720] * (-2036.979) [-2039.637] (-2031.662) (-2039.273) -- 0:04:42
      51000 -- (-2034.908) (-2041.514) [-2040.993] (-2038.953) * (-2032.744) (-2040.649) (-2033.665) [-2038.117] -- 0:04:39
      51500 -- (-2044.339) (-2039.419) (-2040.343) [-2033.998] * [-2036.122] (-2034.387) (-2034.205) (-2036.434) -- 0:04:36
      52000 -- (-2036.056) [-2041.698] (-2046.077) (-2034.577) * (-2048.356) (-2047.980) [-2033.220] (-2037.777) -- 0:04:33
      52500 -- (-2036.768) (-2031.709) (-2039.540) [-2037.369] * (-2043.942) (-2040.607) (-2041.892) [-2033.589] -- 0:04:30
      53000 -- (-2037.635) (-2032.990) (-2040.834) [-2033.836] * (-2037.781) (-2033.832) [-2034.311] (-2045.806) -- 0:04:28
      53500 -- [-2039.653] (-2033.150) (-2041.811) (-2035.860) * (-2040.244) (-2031.783) (-2034.710) [-2039.673] -- 0:04:25
      54000 -- (-2033.809) (-2031.770) (-2041.167) [-2032.917] * [-2037.187] (-2031.443) (-2034.039) (-2041.092) -- 0:04:22
      54500 -- (-2040.844) [-2039.148] (-2039.311) (-2036.166) * (-2040.881) (-2034.959) [-2035.414] (-2037.189) -- 0:04:37
      55000 -- [-2042.827] (-2035.748) (-2038.924) (-2039.051) * [-2036.072] (-2034.659) (-2037.261) (-2036.653) -- 0:04:34

      Average standard deviation of split frequencies: 0.008418

      55500 -- (-2038.453) (-2034.746) (-2030.428) [-2040.361] * (-2040.253) [-2030.024] (-2039.600) (-2032.831) -- 0:04:32
      56000 -- (-2038.157) (-2041.963) (-2037.322) [-2035.885] * [-2039.355] (-2044.695) (-2034.219) (-2035.802) -- 0:04:29
      56500 -- (-2037.842) (-2048.050) [-2037.720] (-2035.332) * (-2037.904) (-2047.615) [-2033.429] (-2033.096) -- 0:04:27
      57000 -- (-2035.925) (-2038.831) [-2035.151] (-2038.529) * (-2042.300) [-2041.394] (-2037.319) (-2035.578) -- 0:04:24
      57500 -- [-2033.246] (-2042.692) (-2038.310) (-2035.068) * (-2041.507) [-2033.021] (-2038.827) (-2036.782) -- 0:04:22
      58000 -- (-2036.374) (-2038.202) (-2033.736) [-2039.533] * (-2038.923) (-2032.317) (-2047.201) [-2031.265] -- 0:04:36
      58500 -- [-2039.956] (-2035.857) (-2035.949) (-2034.395) * (-2043.702) (-2037.119) (-2040.476) [-2036.069] -- 0:04:33
      59000 -- (-2036.825) [-2036.376] (-2040.772) (-2037.552) * (-2041.716) [-2029.491] (-2039.031) (-2038.878) -- 0:04:31
      59500 -- (-2037.325) (-2033.181) (-2037.736) [-2035.789] * (-2037.067) (-2038.881) (-2047.164) [-2037.216] -- 0:04:28
      60000 -- (-2036.363) (-2036.354) (-2043.004) [-2041.515] * (-2038.362) [-2035.389] (-2049.872) (-2039.413) -- 0:04:26

      Average standard deviation of split frequencies: 0.001943

      60500 -- [-2046.011] (-2047.184) (-2038.701) (-2037.418) * (-2039.033) [-2034.961] (-2048.558) (-2039.961) -- 0:04:23
      61000 -- (-2045.022) (-2039.915) (-2044.294) [-2043.560] * (-2041.374) (-2036.720) (-2037.403) [-2042.178] -- 0:04:21
      61500 -- (-2039.942) (-2038.057) (-2037.871) [-2034.754] * (-2042.772) (-2035.176) [-2045.165] (-2040.475) -- 0:04:34
      62000 -- (-2033.317) (-2036.330) (-2039.518) [-2032.363] * [-2036.927] (-2046.213) (-2033.786) (-2038.083) -- 0:04:32
      62500 -- [-2029.756] (-2037.145) (-2043.185) (-2042.590) * (-2033.568) (-2030.828) (-2042.183) [-2040.176] -- 0:04:30
      63000 -- [-2031.480] (-2033.320) (-2035.890) (-2036.418) * (-2037.464) (-2033.752) (-2037.790) [-2033.806] -- 0:04:27
      63500 -- (-2034.406) (-2039.139) (-2036.887) [-2041.122] * (-2039.137) (-2039.133) (-2034.493) [-2035.078] -- 0:04:25
      64000 -- [-2033.485] (-2036.077) (-2039.100) (-2038.095) * (-2033.969) (-2035.053) (-2035.741) [-2035.595] -- 0:04:23
      64500 -- (-2037.852) [-2045.866] (-2039.572) (-2041.566) * (-2043.820) (-2039.729) [-2040.999] (-2036.586) -- 0:04:21
      65000 -- (-2034.885) [-2036.852] (-2035.359) (-2035.169) * (-2037.687) (-2046.128) [-2039.128] (-2039.296) -- 0:04:33

      Average standard deviation of split frequencies: 0.007142

      65500 -- (-2032.967) (-2037.108) [-2038.397] (-2039.507) * (-2041.289) [-2043.430] (-2042.216) (-2033.303) -- 0:04:31
      66000 -- [-2035.938] (-2040.102) (-2044.455) (-2038.134) * [-2032.586] (-2042.780) (-2048.004) (-2036.892) -- 0:04:28
      66500 -- [-2035.693] (-2035.448) (-2034.594) (-2043.692) * (-2034.166) (-2037.501) (-2040.751) [-2038.391] -- 0:04:26
      67000 -- (-2043.030) (-2038.214) [-2037.477] (-2037.481) * (-2035.726) (-2039.546) (-2038.958) [-2037.540] -- 0:04:24
      67500 -- (-2039.394) (-2037.206) [-2032.100] (-2036.951) * (-2032.005) [-2034.261] (-2036.551) (-2033.626) -- 0:04:22
      68000 -- (-2036.145) (-2042.121) [-2034.732] (-2040.460) * (-2041.453) (-2036.982) [-2038.884] (-2038.818) -- 0:04:20
      68500 -- (-2035.646) (-2042.875) (-2041.032) [-2044.750] * [-2032.636] (-2036.832) (-2042.340) (-2036.402) -- 0:04:18
      69000 -- [-2033.522] (-2034.541) (-2032.063) (-2036.843) * [-2031.618] (-2035.061) (-2045.826) (-2033.100) -- 0:04:29
      69500 -- (-2030.930) [-2034.126] (-2036.737) (-2036.131) * (-2041.709) (-2030.936) (-2037.162) [-2033.548] -- 0:04:27
      70000 -- (-2037.439) (-2036.796) (-2042.137) [-2033.871] * (-2034.142) (-2041.375) [-2036.683] (-2036.827) -- 0:04:25

      Average standard deviation of split frequencies: 0.005003

      70500 -- [-2040.444] (-2037.749) (-2042.957) (-2034.265) * (-2038.027) (-2041.096) [-2036.146] (-2040.764) -- 0:04:23
      71000 -- (-2043.791) [-2041.063] (-2037.349) (-2039.499) * (-2034.488) (-2043.047) [-2034.004] (-2040.537) -- 0:04:21
      71500 -- (-2038.129) (-2049.287) [-2033.613] (-2035.352) * (-2035.728) (-2037.723) [-2037.489] (-2046.672) -- 0:04:19
      72000 -- (-2034.791) [-2043.020] (-2030.885) (-2043.660) * (-2036.001) (-2041.474) [-2034.205] (-2040.349) -- 0:04:17
      72500 -- (-2043.918) [-2040.393] (-2039.317) (-2033.422) * (-2041.925) (-2039.551) [-2033.068] (-2037.895) -- 0:04:28
      73000 -- (-2041.109) (-2040.244) (-2038.195) [-2032.551] * (-2048.625) (-2034.828) (-2032.877) [-2039.031] -- 0:04:26
      73500 -- (-2038.702) [-2037.096] (-2036.060) (-2040.655) * (-2040.752) (-2038.515) (-2036.094) [-2037.392] -- 0:04:24
      74000 -- (-2048.637) [-2035.076] (-2036.719) (-2034.692) * (-2043.655) (-2047.018) (-2041.465) [-2033.202] -- 0:04:22
      74500 -- (-2037.939) (-2032.307) [-2039.057] (-2032.688) * (-2034.310) (-2045.625) (-2034.151) [-2038.230] -- 0:04:20
      75000 -- (-2038.836) (-2039.535) [-2036.609] (-2038.481) * (-2037.697) (-2034.733) (-2035.525) [-2030.725] -- 0:04:19

      Average standard deviation of split frequencies: 0.003101

      75500 -- (-2035.178) [-2034.607] (-2041.123) (-2041.790) * (-2037.255) [-2032.516] (-2037.950) (-2034.498) -- 0:04:17
      76000 -- [-2035.195] (-2037.527) (-2041.439) (-2039.993) * (-2037.851) [-2038.005] (-2041.356) (-2033.071) -- 0:04:27
      76500 -- [-2034.580] (-2034.394) (-2039.591) (-2038.726) * (-2037.602) [-2033.684] (-2041.779) (-2033.696) -- 0:04:25
      77000 -- (-2040.056) [-2034.527] (-2051.028) (-2039.008) * [-2037.800] (-2034.422) (-2038.004) (-2044.950) -- 0:04:23
      77500 -- [-2040.266] (-2037.390) (-2047.241) (-2042.537) * (-2045.115) [-2034.493] (-2040.193) (-2040.475) -- 0:04:21
      78000 -- (-2036.205) [-2040.329] (-2041.870) (-2041.875) * (-2039.167) (-2043.864) (-2038.854) [-2038.772] -- 0:04:20
      78500 -- [-2033.479] (-2046.320) (-2041.977) (-2034.265) * (-2035.260) (-2038.851) (-2043.910) [-2036.885] -- 0:04:18
      79000 -- (-2031.954) [-2042.104] (-2047.292) (-2036.059) * (-2034.155) (-2039.191) (-2037.015) [-2039.995] -- 0:04:16
      79500 -- (-2034.994) (-2043.025) [-2041.323] (-2037.744) * (-2036.361) [-2034.373] (-2036.817) (-2038.795) -- 0:04:26
      80000 -- (-2044.397) (-2043.500) (-2039.707) [-2038.373] * [-2034.764] (-2040.987) (-2039.304) (-2033.782) -- 0:04:24

      Average standard deviation of split frequencies: 0.007305

      80500 -- (-2038.719) (-2040.827) (-2037.615) [-2035.960] * [-2040.846] (-2040.416) (-2050.074) (-2033.518) -- 0:04:22
      81000 -- (-2037.314) (-2042.275) (-2037.017) [-2039.231] * [-2033.727] (-2046.410) (-2042.376) (-2037.933) -- 0:04:20
      81500 -- [-2041.724] (-2039.846) (-2036.533) (-2032.712) * (-2039.522) (-2040.156) [-2039.590] (-2043.570) -- 0:04:19
      82000 -- (-2041.153) (-2033.152) [-2038.690] (-2036.024) * [-2040.469] (-2040.397) (-2041.537) (-2042.953) -- 0:04:17
      82500 -- (-2038.563) (-2039.042) (-2040.207) [-2034.099] * (-2038.340) (-2044.451) [-2041.416] (-2052.092) -- 0:04:15
      83000 -- (-2032.280) [-2035.471] (-2048.890) (-2042.153) * (-2040.025) (-2043.102) (-2037.664) [-2040.229] -- 0:04:14
      83500 -- (-2038.947) (-2036.156) [-2038.782] (-2034.382) * (-2043.068) (-2043.517) (-2050.397) [-2042.997] -- 0:04:23
      84000 -- (-2043.295) [-2033.926] (-2038.362) (-2035.345) * (-2041.315) [-2044.370] (-2047.067) (-2039.126) -- 0:04:21
      84500 -- (-2036.543) (-2047.395) (-2034.777) [-2034.858] * (-2033.665) [-2046.143] (-2039.297) (-2039.227) -- 0:04:20
      85000 -- (-2045.358) (-2039.044) (-2035.509) [-2037.202] * (-2040.135) [-2039.092] (-2039.329) (-2039.398) -- 0:04:18

      Average standard deviation of split frequencies: 0.001370

      85500 -- [-2033.857] (-2035.793) (-2045.783) (-2044.934) * (-2037.554) (-2048.785) (-2037.968) [-2039.194] -- 0:04:16
      86000 -- (-2036.863) (-2037.053) (-2037.043) [-2039.875] * [-2039.303] (-2034.151) (-2034.076) (-2034.133) -- 0:04:15
      86500 -- (-2037.160) (-2033.511) [-2035.321] (-2036.223) * (-2031.045) (-2037.373) (-2036.271) [-2036.039] -- 0:04:13
      87000 -- (-2035.703) (-2035.651) (-2036.455) [-2032.375] * (-2037.359) (-2040.135) [-2036.131] (-2034.469) -- 0:04:22
      87500 -- (-2037.743) (-2038.076) [-2035.828] (-2031.330) * [-2034.557] (-2036.368) (-2039.159) (-2036.762) -- 0:04:20
      88000 -- (-2039.657) (-2036.015) (-2038.462) [-2031.153] * (-2034.983) (-2039.304) (-2034.268) [-2031.669] -- 0:04:19
      88500 -- (-2032.259) (-2039.775) [-2036.575] (-2032.398) * (-2036.888) [-2035.034] (-2037.350) (-2039.186) -- 0:04:17
      89000 -- [-2033.524] (-2040.128) (-2041.569) (-2037.428) * (-2038.100) [-2036.471] (-2037.159) (-2035.055) -- 0:04:15
      89500 -- [-2035.639] (-2036.987) (-2041.237) (-2038.919) * [-2040.492] (-2038.088) (-2037.384) (-2038.413) -- 0:04:14
      90000 -- (-2043.106) [-2038.407] (-2038.873) (-2036.664) * (-2041.871) (-2043.957) (-2041.405) [-2037.729] -- 0:04:12

      Average standard deviation of split frequencies: 0.001300

      90500 -- (-2049.802) (-2038.194) (-2040.080) [-2037.075] * (-2038.372) [-2036.173] (-2036.503) (-2035.026) -- 0:04:21
      91000 -- (-2042.991) [-2035.099] (-2035.176) (-2042.718) * (-2047.893) (-2036.993) (-2036.435) [-2035.637] -- 0:04:19
      91500 -- (-2038.844) (-2036.701) [-2034.990] (-2042.733) * [-2042.990] (-2035.548) (-2037.477) (-2042.819) -- 0:04:18
      92000 -- (-2042.255) (-2037.498) (-2040.325) [-2033.114] * (-2038.681) [-2035.355] (-2031.318) (-2034.551) -- 0:04:16
      92500 -- (-2036.750) [-2040.379] (-2039.221) (-2040.485) * (-2034.032) (-2035.932) [-2032.792] (-2042.190) -- 0:04:15
      93000 -- (-2042.409) (-2034.456) [-2033.242] (-2038.976) * (-2040.969) (-2038.741) (-2036.445) [-2038.457] -- 0:04:13
      93500 -- (-2039.955) [-2036.298] (-2038.396) (-2037.880) * [-2031.901] (-2038.326) (-2035.083) (-2042.733) -- 0:04:12
      94000 -- (-2040.610) (-2036.820) [-2037.426] (-2035.684) * (-2041.470) [-2040.243] (-2039.367) (-2041.492) -- 0:04:20
      94500 -- (-2039.397) (-2041.993) (-2037.540) [-2037.416] * (-2042.837) (-2046.435) (-2036.249) [-2035.040] -- 0:04:18
      95000 -- [-2039.598] (-2042.290) (-2040.084) (-2045.458) * (-2042.919) (-2036.857) (-2038.526) [-2036.947] -- 0:04:17

      Average standard deviation of split frequencies: 0.001228

      95500 -- [-2034.002] (-2033.324) (-2037.393) (-2041.394) * [-2041.771] (-2040.050) (-2042.853) (-2038.733) -- 0:04:15
      96000 -- (-2036.439) [-2034.944] (-2043.451) (-2040.089) * [-2034.716] (-2035.198) (-2037.264) (-2041.098) -- 0:04:14
      96500 -- [-2042.231] (-2034.953) (-2039.552) (-2036.194) * (-2035.357) (-2035.524) (-2035.446) [-2036.870] -- 0:04:12
      97000 -- (-2036.931) (-2034.455) (-2044.768) [-2037.836] * (-2037.216) (-2042.277) [-2031.766] (-2042.501) -- 0:04:11
      97500 -- [-2037.132] (-2042.821) (-2043.264) (-2037.483) * (-2037.031) [-2037.972] (-2039.936) (-2043.133) -- 0:04:19
      98000 -- (-2040.013) [-2040.171] (-2036.262) (-2035.701) * (-2031.854) (-2041.851) [-2036.263] (-2045.866) -- 0:04:17
      98500 -- (-2042.788) [-2035.392] (-2049.657) (-2037.100) * (-2033.969) (-2039.917) (-2037.780) [-2045.952] -- 0:04:16
      99000 -- (-2039.020) [-2033.100] (-2041.162) (-2039.613) * (-2035.452) (-2034.109) (-2037.747) [-2043.981] -- 0:04:14
      99500 -- (-2037.262) [-2037.873] (-2032.855) (-2036.117) * (-2036.102) [-2034.520] (-2044.573) (-2035.200) -- 0:04:13
      100000 -- [-2040.366] (-2039.625) (-2035.969) (-2037.143) * [-2029.946] (-2037.360) (-2035.657) (-2043.969) -- 0:04:11

      Average standard deviation of split frequencies: 0.001171

      100500 -- (-2039.390) (-2034.950) (-2035.175) [-2040.409] * (-2032.208) [-2031.333] (-2033.537) (-2038.469) -- 0:04:10
      101000 -- (-2033.109) [-2036.076] (-2038.579) (-2037.342) * [-2035.031] (-2032.081) (-2032.233) (-2037.018) -- 0:04:09
      101500 -- (-2047.626) [-2036.123] (-2039.237) (-2033.652) * (-2033.425) [-2035.960] (-2038.638) (-2040.778) -- 0:04:16
      102000 -- (-2038.832) (-2044.044) (-2038.765) [-2039.228] * (-2041.889) (-2039.129) (-2037.101) [-2035.167] -- 0:04:15
      102500 -- (-2039.939) (-2047.503) (-2041.827) [-2032.505] * (-2040.953) [-2037.404] (-2037.011) (-2037.062) -- 0:04:13
      103000 -- (-2039.931) (-2046.035) (-2046.835) [-2034.800] * [-2032.304] (-2036.750) (-2033.095) (-2045.664) -- 0:04:12
      103500 -- (-2045.085) [-2042.583] (-2037.514) (-2039.501) * (-2039.483) (-2037.116) [-2033.381] (-2043.087) -- 0:04:11
      104000 -- (-2049.133) (-2056.548) [-2038.698] (-2041.830) * (-2044.918) [-2037.636] (-2035.590) (-2040.405) -- 0:04:09
      104500 -- (-2036.374) (-2045.263) [-2034.129] (-2035.165) * [-2037.178] (-2036.332) (-2042.115) (-2037.830) -- 0:04:08
      105000 -- (-2036.162) (-2043.141) (-2049.782) [-2034.357] * (-2037.517) (-2039.110) (-2032.392) [-2035.401] -- 0:04:15

      Average standard deviation of split frequencies: 0.005559

      105500 -- (-2039.463) (-2044.815) (-2036.478) [-2037.166] * (-2043.472) (-2043.726) [-2032.884] (-2041.310) -- 0:04:14
      106000 -- (-2038.396) (-2047.586) (-2037.911) [-2034.060] * [-2037.886] (-2038.062) (-2034.334) (-2034.689) -- 0:04:13
      106500 -- (-2036.676) (-2038.510) (-2036.711) [-2038.444] * [-2039.057] (-2035.287) (-2036.624) (-2039.893) -- 0:04:11
      107000 -- [-2038.246] (-2037.858) (-2035.012) (-2040.432) * [-2034.810] (-2038.377) (-2039.460) (-2040.440) -- 0:04:10
      107500 -- (-2034.860) [-2038.069] (-2039.529) (-2038.775) * [-2040.491] (-2038.809) (-2035.094) (-2040.681) -- 0:04:09
      108000 -- (-2037.569) (-2034.137) [-2043.795] (-2037.141) * (-2043.211) (-2034.923) [-2035.690] (-2043.179) -- 0:04:07
      108500 -- (-2032.489) (-2037.771) (-2032.680) [-2033.782] * (-2032.442) [-2036.827] (-2035.202) (-2051.912) -- 0:04:14
      109000 -- [-2039.227] (-2037.917) (-2036.187) (-2035.157) * (-2040.541) (-2038.359) (-2038.872) [-2041.107] -- 0:04:13
      109500 -- (-2044.650) [-2035.967] (-2035.243) (-2036.323) * [-2034.137] (-2045.448) (-2040.664) (-2040.080) -- 0:04:12
      110000 -- (-2045.135) [-2041.775] (-2033.808) (-2038.704) * (-2033.919) (-2039.390) (-2039.780) [-2038.531] -- 0:04:10

      Average standard deviation of split frequencies: 0.004260

      110500 -- (-2036.696) (-2041.780) (-2032.406) [-2032.704] * [-2034.258] (-2045.296) (-2038.476) (-2036.426) -- 0:04:09
      111000 -- (-2038.173) (-2042.611) (-2035.720) [-2035.853] * (-2040.643) (-2048.565) (-2041.105) [-2035.976] -- 0:04:08
      111500 -- [-2035.768] (-2048.656) (-2041.187) (-2036.428) * (-2040.080) (-2039.026) [-2031.421] (-2041.949) -- 0:04:07
      112000 -- (-2039.453) (-2051.118) (-2046.327) [-2035.126] * (-2037.908) (-2034.909) [-2034.756] (-2034.884) -- 0:04:13
      112500 -- (-2043.641) (-2042.634) [-2040.618] (-2035.077) * (-2042.937) (-2037.491) (-2032.398) [-2037.578] -- 0:04:12
      113000 -- (-2035.843) (-2042.845) (-2045.000) [-2033.899] * (-2039.949) (-2033.663) [-2030.784] (-2038.938) -- 0:04:11
      113500 -- (-2057.128) [-2033.875] (-2036.930) (-2040.276) * (-2038.358) (-2036.461) [-2031.249] (-2035.608) -- 0:04:09
      114000 -- (-2036.845) (-2038.910) (-2042.179) [-2032.537] * [-2035.584] (-2036.364) (-2038.121) (-2036.264) -- 0:04:08
      114500 -- (-2035.987) (-2034.104) (-2038.576) [-2036.254] * (-2031.599) (-2044.414) (-2036.311) [-2034.841] -- 0:04:07
      115000 -- [-2033.607] (-2032.290) (-2034.867) (-2038.653) * (-2035.005) [-2038.372] (-2036.960) (-2039.431) -- 0:04:06

      Average standard deviation of split frequencies: 0.002032

      115500 -- (-2041.013) (-2038.464) (-2042.545) [-2036.814] * [-2032.114] (-2038.114) (-2035.846) (-2034.810) -- 0:04:05
      116000 -- (-2036.094) (-2037.011) (-2046.825) [-2036.606] * (-2037.643) (-2034.445) (-2036.313) [-2035.128] -- 0:04:11
      116500 -- (-2036.900) [-2036.906] (-2039.188) (-2041.534) * (-2034.947) (-2035.543) (-2034.852) [-2037.636] -- 0:04:10
      117000 -- [-2038.045] (-2034.663) (-2035.686) (-2031.065) * (-2034.769) (-2037.099) (-2043.628) [-2033.958] -- 0:04:09
      117500 -- (-2040.349) (-2044.820) [-2034.425] (-2034.298) * [-2030.861] (-2035.105) (-2032.769) (-2039.177) -- 0:04:07
      118000 -- (-2038.994) (-2052.186) (-2046.713) [-2033.635] * (-2036.500) [-2042.735] (-2032.065) (-2033.991) -- 0:04:06
      118500 -- [-2038.827] (-2045.986) (-2041.435) (-2031.900) * [-2029.743] (-2036.769) (-2035.531) (-2038.154) -- 0:04:05
      119000 -- (-2035.299) (-2040.719) [-2040.989] (-2035.202) * (-2034.993) (-2047.572) [-2031.036] (-2039.657) -- 0:04:04
      119500 -- (-2036.098) (-2040.643) (-2035.408) [-2039.148] * (-2036.715) (-2042.073) [-2031.725] (-2034.403) -- 0:04:10
      120000 -- (-2033.716) (-2041.503) [-2038.624] (-2037.384) * (-2036.744) (-2035.962) (-2032.523) [-2036.142] -- 0:04:09

      Average standard deviation of split frequencies: 0.004883

      120500 -- [-2038.986] (-2036.832) (-2037.382) (-2034.821) * (-2032.777) (-2043.334) [-2038.031] (-2039.822) -- 0:04:08
      121000 -- (-2036.223) (-2039.603) [-2036.108] (-2038.839) * [-2032.861] (-2040.093) (-2041.122) (-2035.681) -- 0:04:06
      121500 -- (-2035.158) (-2035.111) (-2035.696) [-2033.881] * (-2031.031) [-2038.236] (-2041.965) (-2046.921) -- 0:04:05
      122000 -- (-2034.386) (-2036.914) (-2042.534) [-2035.455] * (-2036.444) [-2035.059] (-2035.024) (-2037.354) -- 0:04:04
      122500 -- (-2036.662) [-2037.036] (-2037.752) (-2042.946) * [-2036.527] (-2039.831) (-2039.573) (-2044.214) -- 0:04:03
      123000 -- (-2037.248) (-2041.441) [-2036.740] (-2041.143) * (-2036.880) [-2038.087] (-2037.440) (-2037.187) -- 0:04:09
      123500 -- (-2036.994) (-2038.627) [-2041.439] (-2043.442) * (-2034.334) (-2041.300) (-2034.729) [-2035.754] -- 0:04:08
      124000 -- (-2045.463) (-2041.065) [-2038.145] (-2036.218) * (-2032.518) [-2036.930] (-2037.245) (-2034.545) -- 0:04:07
      124500 -- [-2034.785] (-2034.800) (-2037.812) (-2043.407) * [-2036.746] (-2041.489) (-2036.940) (-2037.730) -- 0:04:06
      125000 -- [-2034.972] (-2036.444) (-2039.009) (-2047.563) * (-2036.249) (-2042.278) [-2040.348] (-2036.315) -- 0:04:04

      Average standard deviation of split frequencies: 0.002806

      125500 -- [-2040.832] (-2035.423) (-2045.172) (-2033.230) * (-2037.696) [-2036.286] (-2034.976) (-2035.369) -- 0:04:03
      126000 -- [-2033.543] (-2033.223) (-2041.905) (-2035.897) * [-2034.467] (-2037.899) (-2031.870) (-2040.155) -- 0:04:02
      126500 -- [-2035.682] (-2045.539) (-2046.678) (-2038.568) * (-2040.200) [-2033.723] (-2041.023) (-2041.999) -- 0:04:01
      127000 -- (-2034.189) [-2035.054] (-2045.856) (-2035.436) * (-2037.056) (-2038.538) (-2035.136) [-2039.409] -- 0:04:07
      127500 -- (-2041.254) [-2038.505] (-2047.554) (-2037.785) * [-2035.741] (-2041.417) (-2044.995) (-2049.543) -- 0:04:06
      128000 -- (-2040.251) (-2040.549) (-2040.952) [-2035.348] * (-2045.398) [-2035.963] (-2036.239) (-2045.284) -- 0:04:05
      128500 -- (-2035.355) [-2047.777] (-2037.370) (-2034.809) * (-2042.944) [-2037.262] (-2034.481) (-2036.214) -- 0:04:04
      129000 -- [-2033.838] (-2044.038) (-2038.827) (-2039.546) * (-2043.988) (-2034.829) [-2040.037] (-2036.223) -- 0:04:03
      129500 -- (-2039.051) [-2035.952] (-2038.517) (-2041.127) * (-2038.215) (-2037.759) [-2033.804] (-2033.881) -- 0:04:01
      130000 -- (-2040.517) (-2033.531) (-2035.864) [-2037.603] * [-2042.960] (-2037.636) (-2038.339) (-2037.297) -- 0:04:00

      Average standard deviation of split frequencies: 0.007215

      130500 -- (-2040.321) [-2032.812] (-2041.401) (-2034.084) * (-2039.510) (-2041.324) [-2039.290] (-2039.500) -- 0:04:06
      131000 -- [-2043.126] (-2036.585) (-2043.023) (-2033.824) * (-2038.224) (-2043.459) (-2029.693) [-2036.206] -- 0:04:05
      131500 -- (-2036.873) (-2039.438) (-2044.066) [-2037.219] * (-2038.834) (-2036.023) [-2031.477] (-2045.625) -- 0:04:04
      132000 -- (-2032.488) (-2038.694) (-2041.407) [-2031.779] * (-2032.815) (-2035.457) [-2037.799] (-2035.182) -- 0:04:03
      132500 -- (-2036.674) (-2034.125) [-2044.650] (-2034.322) * (-2036.111) [-2044.106] (-2037.566) (-2039.759) -- 0:04:02
      133000 -- [-2036.770] (-2038.142) (-2040.476) (-2038.431) * [-2032.247] (-2040.526) (-2037.895) (-2038.844) -- 0:04:01
      133500 -- (-2043.857) [-2034.637] (-2046.059) (-2043.852) * [-2038.257] (-2044.672) (-2035.031) (-2034.293) -- 0:04:00
      134000 -- (-2036.864) [-2036.668] (-2039.920) (-2035.559) * (-2037.431) [-2041.687] (-2036.242) (-2044.630) -- 0:04:05
      134500 -- (-2037.564) (-2041.261) (-2035.635) [-2037.398] * [-2038.250] (-2036.729) (-2034.735) (-2033.140) -- 0:04:04
      135000 -- (-2035.916) [-2036.647] (-2037.118) (-2036.549) * (-2037.768) (-2037.540) [-2033.479] (-2039.234) -- 0:04:03

      Average standard deviation of split frequencies: 0.004333

      135500 -- (-2043.366) (-2040.616) [-2036.925] (-2038.150) * (-2035.118) [-2039.885] (-2036.231) (-2036.335) -- 0:04:02
      136000 -- (-2045.303) (-2043.099) (-2044.546) [-2036.063] * (-2043.344) (-2035.481) [-2040.491] (-2037.365) -- 0:04:01
      136500 -- (-2049.890) [-2038.938] (-2039.039) (-2046.151) * (-2035.057) (-2042.486) (-2041.357) [-2036.045] -- 0:04:00
      137000 -- (-2041.704) (-2038.044) (-2037.487) [-2036.245] * (-2032.138) (-2044.453) (-2043.712) [-2035.774] -- 0:03:59
      137500 -- (-2040.695) (-2034.388) (-2038.500) [-2038.466] * [-2036.183] (-2044.236) (-2033.236) (-2031.514) -- 0:04:04
      138000 -- (-2045.658) (-2033.845) [-2042.432] (-2041.340) * (-2035.470) (-2045.412) [-2036.305] (-2033.221) -- 0:04:03
      138500 -- (-2049.374) [-2039.607] (-2039.715) (-2037.867) * (-2036.591) (-2042.816) [-2036.959] (-2037.693) -- 0:04:02
      139000 -- (-2046.712) [-2032.726] (-2036.832) (-2044.068) * (-2037.825) [-2032.950] (-2037.012) (-2038.137) -- 0:04:01
      139500 -- (-2036.638) (-2034.509) [-2035.459] (-2037.499) * (-2051.108) (-2041.614) (-2032.165) [-2037.975] -- 0:04:00
      140000 -- (-2035.341) (-2031.469) [-2041.410] (-2039.976) * (-2041.903) [-2037.085] (-2032.822) (-2037.688) -- 0:03:59

      Average standard deviation of split frequencies: 0.003351

      140500 -- (-2048.708) (-2032.798) [-2038.840] (-2039.337) * (-2045.910) (-2041.350) (-2039.344) [-2039.692] -- 0:03:58
      141000 -- (-2039.344) [-2032.322] (-2041.220) (-2044.468) * (-2044.800) (-2033.891) (-2046.119) [-2036.976] -- 0:04:03
      141500 -- (-2038.849) [-2034.004] (-2041.382) (-2041.618) * (-2045.002) [-2033.535] (-2036.277) (-2041.063) -- 0:04:02
      142000 -- (-2043.291) [-2038.235] (-2035.474) (-2044.292) * (-2039.279) (-2035.430) [-2034.707] (-2037.806) -- 0:04:01
      142500 -- (-2051.058) (-2036.509) [-2035.222] (-2035.327) * (-2037.672) (-2038.510) (-2034.049) [-2033.794] -- 0:04:00
      143000 -- (-2046.043) (-2036.917) (-2039.013) [-2036.252] * (-2034.949) (-2037.819) [-2034.435] (-2037.664) -- 0:03:59
      143500 -- (-2050.378) (-2043.475) (-2035.208) [-2034.395] * (-2035.972) (-2035.986) (-2037.703) [-2033.099] -- 0:03:58
      144000 -- (-2035.607) (-2043.231) (-2040.918) [-2036.392] * (-2034.721) [-2033.066] (-2041.201) (-2037.895) -- 0:03:57
      144500 -- (-2036.827) [-2038.184] (-2042.604) (-2036.341) * (-2032.684) (-2034.955) [-2037.031] (-2036.798) -- 0:03:56
      145000 -- (-2040.076) (-2038.747) (-2040.427) [-2036.217] * [-2034.517] (-2038.800) (-2038.987) (-2037.696) -- 0:04:01

      Average standard deviation of split frequencies: 0.002422

      145500 -- (-2040.581) (-2036.820) (-2038.001) [-2036.462] * (-2034.795) (-2040.754) (-2040.035) [-2033.376] -- 0:04:00
      146000 -- (-2033.452) (-2048.111) (-2042.764) [-2038.482] * [-2038.062] (-2034.930) (-2040.304) (-2040.040) -- 0:03:59
      146500 -- (-2033.307) (-2042.964) [-2038.552] (-2042.784) * [-2040.338] (-2033.292) (-2043.640) (-2038.797) -- 0:03:58
      147000 -- (-2040.745) (-2039.829) [-2043.989] (-2038.543) * (-2039.727) (-2043.772) (-2044.204) [-2037.712] -- 0:03:57
      147500 -- (-2033.072) (-2038.228) (-2040.708) [-2037.351] * (-2033.046) (-2034.876) (-2043.202) [-2031.062] -- 0:03:56
      148000 -- [-2038.042] (-2036.361) (-2044.488) (-2045.756) * (-2034.433) [-2041.888] (-2035.379) (-2037.022) -- 0:03:56
      148500 -- (-2037.496) [-2039.299] (-2037.950) (-2041.117) * (-2042.778) (-2040.587) (-2042.791) [-2046.765] -- 0:04:00
      149000 -- (-2036.102) (-2035.604) (-2039.856) [-2037.487] * (-2042.236) (-2042.075) (-2038.655) [-2039.184] -- 0:03:59
      149500 -- (-2041.318) (-2034.619) (-2039.528) [-2035.968] * (-2041.810) (-2038.447) [-2034.434] (-2035.105) -- 0:03:58
      150000 -- (-2043.638) (-2034.026) [-2039.335] (-2040.726) * (-2036.894) [-2036.224] (-2034.379) (-2036.278) -- 0:03:57

      Average standard deviation of split frequencies: 0.002347

      150500 -- (-2042.227) (-2033.322) (-2039.158) [-2036.325] * (-2041.034) (-2031.859) (-2039.411) [-2033.353] -- 0:03:57
      151000 -- (-2040.684) (-2033.120) (-2031.790) [-2033.599] * (-2040.077) (-2033.305) (-2042.082) [-2036.775] -- 0:03:56
      151500 -- (-2039.494) [-2043.740] (-2031.929) (-2037.755) * (-2033.144) (-2037.413) (-2042.809) [-2036.250] -- 0:03:55
      152000 -- (-2040.663) (-2036.274) (-2045.014) [-2038.876] * [-2032.924] (-2038.634) (-2034.979) (-2043.559) -- 0:03:59
      152500 -- (-2036.387) [-2037.797] (-2044.053) (-2033.428) * (-2038.124) (-2037.960) (-2037.981) [-2042.418] -- 0:03:58
      153000 -- (-2034.197) (-2048.044) (-2035.914) [-2036.828] * (-2050.041) [-2036.675] (-2036.943) (-2046.157) -- 0:03:58
      153500 -- (-2034.087) (-2039.068) [-2035.167] (-2037.136) * [-2037.644] (-2042.920) (-2040.420) (-2041.649) -- 0:03:57
      154000 -- (-2035.988) (-2037.248) [-2035.836] (-2040.908) * (-2037.318) [-2037.898] (-2038.552) (-2039.775) -- 0:03:56
      154500 -- (-2039.929) (-2043.187) [-2036.059] (-2040.573) * (-2035.961) (-2050.196) (-2045.513) [-2037.141] -- 0:03:55
      155000 -- (-2039.568) [-2031.999] (-2034.475) (-2041.003) * (-2040.929) (-2040.630) [-2040.139] (-2042.095) -- 0:03:54

      Average standard deviation of split frequencies: 0.003777

      155500 -- [-2034.133] (-2041.166) (-2035.638) (-2047.378) * (-2054.447) (-2042.453) (-2046.186) [-2042.212] -- 0:03:58
      156000 -- (-2037.012) (-2035.907) (-2036.954) [-2033.933] * (-2038.962) [-2043.831] (-2047.653) (-2037.050) -- 0:03:58
      156500 -- (-2037.111) (-2035.861) [-2038.884] (-2041.206) * (-2035.809) (-2047.274) (-2033.558) [-2031.524] -- 0:03:57
      157000 -- (-2038.893) (-2036.390) [-2034.402] (-2040.474) * (-2036.730) (-2037.764) (-2039.001) [-2037.106] -- 0:03:56
      157500 -- (-2038.075) (-2041.483) (-2036.679) [-2038.069] * (-2033.294) (-2040.594) [-2045.875] (-2037.502) -- 0:03:55
      158000 -- [-2029.727] (-2036.832) (-2036.820) (-2041.605) * (-2038.742) (-2037.169) [-2037.699] (-2036.589) -- 0:03:54
      158500 -- (-2034.134) (-2037.281) [-2033.340] (-2040.348) * (-2036.536) (-2035.187) [-2035.105] (-2041.968) -- 0:03:53
      159000 -- [-2032.859] (-2044.547) (-2035.649) (-2038.303) * (-2038.549) (-2036.746) (-2037.799) [-2036.761] -- 0:03:58
      159500 -- (-2041.943) [-2036.932] (-2046.027) (-2042.845) * (-2040.718) (-2034.972) [-2037.375] (-2033.726) -- 0:03:57
      160000 -- (-2044.156) [-2037.381] (-2033.552) (-2035.874) * (-2045.016) [-2032.496] (-2038.280) (-2038.901) -- 0:03:56

      Average standard deviation of split frequencies: 0.005135

      160500 -- (-2034.563) [-2035.893] (-2047.036) (-2033.595) * (-2033.548) (-2034.793) [-2037.317] (-2038.955) -- 0:03:55
      161000 -- (-2030.491) (-2044.564) (-2041.919) [-2039.889] * (-2037.084) (-2036.443) [-2037.435] (-2043.102) -- 0:03:54
      161500 -- [-2034.477] (-2041.007) (-2038.151) (-2035.635) * (-2034.156) (-2038.121) [-2037.466] (-2040.242) -- 0:03:53
      162000 -- (-2037.370) (-2038.415) (-2046.903) [-2037.647] * [-2044.678] (-2042.197) (-2038.902) (-2041.440) -- 0:03:52
      162500 -- [-2040.448] (-2052.336) (-2036.431) (-2039.285) * (-2040.639) [-2040.917] (-2041.614) (-2040.426) -- 0:03:57
      163000 -- (-2040.312) [-2039.342] (-2040.112) (-2035.299) * [-2032.824] (-2044.054) (-2037.808) (-2030.080) -- 0:03:56
      163500 -- (-2038.434) [-2038.266] (-2038.359) (-2037.927) * [-2033.021] (-2040.325) (-2037.494) (-2036.353) -- 0:03:55
      164000 -- [-2038.699] (-2038.546) (-2041.230) (-2041.122) * (-2037.811) [-2038.676] (-2037.309) (-2041.480) -- 0:03:54
      164500 -- (-2041.798) (-2049.047) [-2039.642] (-2035.049) * (-2036.952) (-2039.323) (-2044.778) [-2036.771] -- 0:03:53
      165000 -- (-2041.229) (-2043.598) (-2038.084) [-2035.894] * (-2031.713) (-2036.706) [-2033.776] (-2040.625) -- 0:03:52

      Average standard deviation of split frequencies: 0.004970

      165500 -- (-2035.924) (-2037.925) [-2040.193] (-2038.103) * (-2038.142) (-2042.307) [-2031.475] (-2039.589) -- 0:03:51
      166000 -- (-2037.158) (-2040.258) [-2037.086] (-2045.424) * (-2038.518) (-2047.293) (-2037.764) [-2030.629] -- 0:03:56
      166500 -- (-2035.719) (-2035.754) [-2035.180] (-2043.225) * [-2032.198] (-2044.733) (-2041.696) (-2038.072) -- 0:03:55
      167000 -- (-2037.690) [-2031.315] (-2036.523) (-2037.235) * (-2036.358) [-2038.957] (-2036.712) (-2046.159) -- 0:03:54
      167500 -- (-2040.546) (-2034.583) [-2038.331] (-2038.044) * [-2037.274] (-2035.462) (-2040.024) (-2038.534) -- 0:03:53
      168000 -- (-2036.730) (-2042.119) [-2035.809] (-2035.134) * [-2042.351] (-2040.694) (-2036.125) (-2036.083) -- 0:03:52
      168500 -- [-2033.898] (-2048.104) (-2036.859) (-2036.112) * (-2040.958) (-2037.826) [-2033.331] (-2034.945) -- 0:03:51
      169000 -- [-2035.610] (-2040.452) (-2042.944) (-2032.662) * (-2035.333) (-2038.059) [-2039.582] (-2037.259) -- 0:03:51
      169500 -- (-2039.534) (-2040.378) [-2037.037] (-2037.703) * (-2040.698) (-2034.783) (-2043.737) [-2038.244] -- 0:03:50
      170000 -- (-2035.220) (-2031.682) (-2042.297) [-2035.203] * (-2037.700) [-2033.567] (-2032.407) (-2034.814) -- 0:03:54

      Average standard deviation of split frequencies: 0.004834

      170500 -- (-2033.665) (-2040.580) (-2034.512) [-2034.101] * (-2034.599) (-2040.081) (-2033.740) [-2031.887] -- 0:03:53
      171000 -- (-2033.250) (-2037.128) [-2038.705] (-2037.304) * (-2037.194) [-2037.155] (-2031.180) (-2048.549) -- 0:03:52
      171500 -- (-2032.965) (-2034.942) [-2032.532] (-2038.777) * (-2039.797) (-2034.783) [-2040.345] (-2040.701) -- 0:03:51
      172000 -- (-2035.302) [-2035.447] (-2036.487) (-2045.004) * (-2038.941) [-2032.246] (-2038.148) (-2034.891) -- 0:03:51
      172500 -- [-2033.759] (-2036.601) (-2044.703) (-2037.311) * (-2038.249) (-2040.327) [-2040.122] (-2035.338) -- 0:03:50
      173000 -- [-2035.951] (-2035.665) (-2045.998) (-2035.043) * (-2035.466) (-2039.343) [-2041.694] (-2036.860) -- 0:03:49
      173500 -- (-2038.967) [-2036.796] (-2039.339) (-2041.643) * (-2039.381) [-2031.414] (-2044.578) (-2036.232) -- 0:03:53
      174000 -- (-2033.589) (-2038.843) (-2034.098) [-2040.675] * (-2043.073) (-2038.420) [-2042.972] (-2036.884) -- 0:03:52
      174500 -- (-2033.864) [-2033.318] (-2044.147) (-2041.587) * (-2034.978) [-2036.918] (-2035.167) (-2044.146) -- 0:03:51
      175000 -- [-2031.656] (-2037.754) (-2043.503) (-2041.128) * [-2045.496] (-2039.824) (-2036.955) (-2035.916) -- 0:03:50

      Average standard deviation of split frequencies: 0.004687

      175500 -- [-2040.487] (-2039.297) (-2040.541) (-2041.012) * (-2038.072) (-2044.740) (-2035.503) [-2041.873] -- 0:03:50
      176000 -- (-2038.611) [-2038.033] (-2039.140) (-2045.288) * (-2048.280) [-2037.522] (-2034.790) (-2036.795) -- 0:03:49
      176500 -- (-2037.999) (-2037.107) [-2037.560] (-2034.302) * (-2036.554) (-2039.348) (-2039.418) [-2032.830] -- 0:03:48
      177000 -- (-2040.738) [-2041.884] (-2035.274) (-2037.416) * (-2037.301) [-2033.125] (-2034.032) (-2038.773) -- 0:03:52
      177500 -- (-2035.419) [-2037.153] (-2044.297) (-2046.763) * [-2032.426] (-2038.877) (-2039.872) (-2037.087) -- 0:03:51
      178000 -- (-2039.454) [-2031.071] (-2039.282) (-2042.468) * (-2033.212) (-2033.729) (-2032.702) [-2035.351] -- 0:03:50
      178500 -- [-2036.000] (-2036.817) (-2042.434) (-2040.641) * (-2039.764) (-2037.049) (-2037.404) [-2035.460] -- 0:03:50
      179000 -- [-2035.816] (-2036.909) (-2032.389) (-2038.543) * (-2042.873) (-2037.366) [-2039.628] (-2033.160) -- 0:03:49
      179500 -- (-2033.200) (-2034.778) [-2032.479] (-2037.546) * (-2040.607) [-2037.071] (-2038.881) (-2033.675) -- 0:03:48
      180000 -- (-2031.392) (-2034.647) (-2051.483) [-2034.820] * (-2040.576) (-2039.444) [-2039.651] (-2033.724) -- 0:03:47

      Average standard deviation of split frequencies: 0.003914

      180500 -- [-2039.916] (-2035.790) (-2045.295) (-2038.249) * [-2035.965] (-2045.715) (-2042.885) (-2038.949) -- 0:03:51
      181000 -- (-2038.509) (-2038.311) (-2039.296) [-2033.230] * (-2042.592) [-2042.630] (-2031.595) (-2036.612) -- 0:03:50
      181500 -- (-2036.587) [-2033.228] (-2046.937) (-2033.977) * (-2043.717) (-2045.420) (-2038.673) [-2032.671] -- 0:03:49
      182000 -- (-2038.576) (-2036.779) [-2044.017] (-2032.052) * (-2036.056) (-2043.793) (-2041.165) [-2037.517] -- 0:03:49
      182500 -- (-2037.173) (-2039.354) (-2039.729) [-2034.683] * (-2037.700) (-2041.838) [-2034.042] (-2036.351) -- 0:03:48
      183000 -- (-2041.821) (-2033.691) (-2034.973) [-2033.986] * (-2034.277) (-2042.744) [-2033.773] (-2042.688) -- 0:03:47
      183500 -- (-2036.334) (-2039.342) [-2039.173] (-2033.075) * (-2037.111) [-2045.795] (-2033.465) (-2047.252) -- 0:03:46
      184000 -- [-2037.754] (-2038.141) (-2031.849) (-2035.834) * (-2042.308) [-2040.366] (-2032.309) (-2047.834) -- 0:03:46
      184500 -- (-2040.463) (-2040.968) [-2034.124] (-2031.402) * (-2041.642) [-2036.603] (-2038.407) (-2035.964) -- 0:03:49
      185000 -- (-2036.851) (-2041.041) (-2034.764) [-2037.183] * (-2035.989) (-2039.808) [-2035.213] (-2035.362) -- 0:03:49

      Average standard deviation of split frequencies: 0.005069

      185500 -- (-2035.603) (-2047.820) [-2036.059] (-2040.815) * [-2033.368] (-2040.969) (-2038.993) (-2034.777) -- 0:03:48
      186000 -- (-2040.379) (-2041.925) [-2040.877] (-2039.663) * (-2032.151) (-2037.020) (-2045.332) [-2036.365] -- 0:03:47
      186500 -- (-2039.729) (-2037.377) (-2035.950) [-2036.575] * (-2042.145) (-2037.455) [-2038.903] (-2048.351) -- 0:03:46
      187000 -- (-2035.658) (-2037.718) (-2034.917) [-2033.572] * [-2042.244] (-2040.050) (-2037.253) (-2033.538) -- 0:03:46
      187500 -- (-2043.463) (-2036.881) [-2039.321] (-2034.106) * (-2039.677) (-2041.746) [-2034.991] (-2033.613) -- 0:03:45
      188000 -- (-2038.294) (-2040.643) [-2037.106] (-2042.164) * (-2035.963) [-2036.751] (-2035.016) (-2042.144) -- 0:03:48
      188500 -- (-2039.127) [-2033.921] (-2037.557) (-2037.982) * (-2039.053) (-2037.056) (-2036.103) [-2032.705] -- 0:03:48
      189000 -- (-2042.788) [-2033.486] (-2040.292) (-2033.252) * [-2033.350] (-2045.205) (-2047.094) (-2033.362) -- 0:03:47
      189500 -- (-2031.078) [-2034.441] (-2042.503) (-2033.593) * (-2041.396) [-2034.850] (-2032.472) (-2039.220) -- 0:03:46
      190000 -- (-2039.459) (-2044.362) (-2042.753) [-2034.538] * (-2033.521) (-2036.362) (-2037.764) [-2034.237] -- 0:03:45

      Average standard deviation of split frequencies: 0.005563

      190500 -- (-2036.085) [-2032.957] (-2040.454) (-2037.422) * (-2035.816) (-2034.825) (-2034.693) [-2049.106] -- 0:03:45
      191000 -- [-2036.805] (-2036.378) (-2036.209) (-2041.629) * [-2036.460] (-2033.717) (-2039.516) (-2044.438) -- 0:03:44
      191500 -- (-2033.201) [-2035.140] (-2035.590) (-2039.678) * (-2033.841) (-2037.450) (-2037.554) [-2035.501] -- 0:03:47
      192000 -- (-2036.504) (-2041.415) (-2036.007) [-2032.907] * [-2034.950] (-2038.659) (-2048.200) (-2040.058) -- 0:03:47
      192500 -- [-2036.237] (-2036.788) (-2038.383) (-2033.562) * (-2037.636) (-2035.143) [-2039.266] (-2037.684) -- 0:03:46
      193000 -- [-2036.322] (-2032.991) (-2043.989) (-2036.511) * (-2039.501) (-2035.596) (-2037.110) [-2033.026] -- 0:03:45
      193500 -- (-2034.083) (-2035.868) [-2038.774] (-2039.067) * (-2034.561) [-2035.837] (-2037.120) (-2038.440) -- 0:03:45
      194000 -- (-2030.100) (-2040.831) [-2037.438] (-2036.482) * (-2040.253) [-2035.499] (-2038.436) (-2044.903) -- 0:03:44
      194500 -- [-2031.180] (-2037.818) (-2036.441) (-2038.723) * (-2045.824) (-2035.675) [-2042.252] (-2046.617) -- 0:03:43
      195000 -- [-2034.121] (-2039.232) (-2040.621) (-2039.399) * (-2035.270) [-2040.077] (-2038.419) (-2051.229) -- 0:03:42

      Average standard deviation of split frequencies: 0.006614

      195500 -- (-2039.080) [-2043.094] (-2033.908) (-2037.605) * [-2047.697] (-2039.951) (-2037.796) (-2043.744) -- 0:03:46
      196000 -- (-2035.690) [-2036.706] (-2040.476) (-2036.913) * (-2038.452) [-2038.275] (-2040.878) (-2036.478) -- 0:03:45
      196500 -- (-2039.797) [-2036.323] (-2036.555) (-2052.120) * [-2034.432] (-2042.447) (-2037.178) (-2037.945) -- 0:03:44
      197000 -- (-2035.907) (-2031.585) [-2039.015] (-2039.243) * [-2037.027] (-2042.997) (-2041.321) (-2040.774) -- 0:03:44
      197500 -- (-2040.862) (-2042.724) (-2044.795) [-2034.035] * (-2034.444) (-2039.353) (-2037.996) [-2041.925] -- 0:03:43
      198000 -- (-2037.868) (-2037.990) (-2037.122) [-2034.914] * [-2034.278] (-2035.102) (-2038.180) (-2050.339) -- 0:03:42
      198500 -- (-2035.138) (-2040.271) [-2033.604] (-2032.252) * (-2044.743) (-2035.336) [-2034.789] (-2045.082) -- 0:03:42
      199000 -- (-2042.666) (-2037.840) [-2031.748] (-2046.460) * [-2036.798] (-2038.807) (-2037.379) (-2042.054) -- 0:03:45
      199500 -- (-2048.177) (-2041.335) (-2032.695) [-2034.294] * (-2035.751) (-2045.989) [-2035.086] (-2039.210) -- 0:03:44
      200000 -- (-2043.495) [-2035.502] (-2042.432) (-2035.398) * (-2046.724) (-2047.549) (-2032.373) [-2035.719] -- 0:03:43

      Average standard deviation of split frequencies: 0.008222

      200500 -- (-2042.814) (-2046.519) (-2031.064) [-2037.994] * (-2036.488) (-2037.686) (-2043.480) [-2041.905] -- 0:03:43
      201000 -- [-2036.765] (-2043.497) (-2032.723) (-2033.964) * (-2034.276) (-2036.926) (-2047.531) [-2037.719] -- 0:03:42
      201500 -- [-2033.464] (-2039.738) (-2034.981) (-2043.262) * (-2034.933) [-2046.627] (-2032.537) (-2037.555) -- 0:03:41
      202000 -- [-2035.904] (-2044.140) (-2034.159) (-2040.585) * (-2043.179) [-2040.312] (-2037.404) (-2040.121) -- 0:03:41
      202500 -- (-2039.811) (-2037.930) (-2036.041) [-2036.923] * (-2042.921) [-2039.797] (-2046.911) (-2044.713) -- 0:03:44
      203000 -- (-2036.896) [-2040.308] (-2037.814) (-2037.231) * (-2039.614) (-2034.491) [-2038.373] (-2035.149) -- 0:03:43
      203500 -- (-2041.910) [-2032.568] (-2044.583) (-2038.567) * (-2036.340) (-2033.881) (-2041.018) [-2039.669] -- 0:03:43
      204000 -- (-2040.339) [-2036.568] (-2054.696) (-2037.137) * [-2035.343] (-2039.584) (-2035.234) (-2037.943) -- 0:03:42
      204500 -- [-2037.589] (-2043.758) (-2045.646) (-2043.508) * (-2043.896) (-2036.718) [-2038.396] (-2034.592) -- 0:03:41
      205000 -- (-2031.817) (-2033.970) (-2036.895) [-2039.299] * [-2035.428] (-2039.363) (-2041.079) (-2033.793) -- 0:03:41

      Average standard deviation of split frequencies: 0.005721

      205500 -- (-2034.924) [-2037.009] (-2032.035) (-2040.734) * (-2040.100) (-2042.268) (-2038.093) [-2032.450] -- 0:03:40
      206000 -- (-2035.730) [-2034.430] (-2031.992) (-2036.620) * (-2038.938) (-2038.286) [-2039.452] (-2037.465) -- 0:03:43
      206500 -- [-2035.237] (-2038.965) (-2039.073) (-2039.537) * [-2036.509] (-2041.543) (-2040.349) (-2038.229) -- 0:03:42
      207000 -- (-2036.668) [-2031.151] (-2039.004) (-2031.568) * (-2037.688) (-2043.005) [-2039.184] (-2037.188) -- 0:03:42
      207500 -- (-2035.855) (-2040.720) (-2034.504) [-2036.213] * (-2035.139) (-2037.726) (-2039.022) [-2034.681] -- 0:03:41
      208000 -- (-2036.246) (-2033.416) (-2034.653) [-2037.013] * (-2037.521) (-2037.412) (-2036.881) [-2040.771] -- 0:03:40
      208500 -- (-2037.570) (-2042.009) [-2031.469] (-2039.947) * (-2045.066) (-2035.922) (-2037.879) [-2038.570] -- 0:03:40
      209000 -- (-2036.937) (-2043.266) [-2037.791] (-2034.719) * (-2032.635) (-2032.380) (-2038.061) [-2036.450] -- 0:03:39
      209500 -- (-2032.748) [-2040.048] (-2043.106) (-2039.128) * (-2035.676) (-2042.545) (-2040.695) [-2040.745] -- 0:03:42
      210000 -- [-2041.498] (-2034.832) (-2035.400) (-2035.643) * (-2031.680) (-2037.813) [-2032.581] (-2035.253) -- 0:03:41

      Average standard deviation of split frequencies: 0.005594

      210500 -- (-2041.206) (-2037.428) [-2040.509] (-2035.510) * [-2040.257] (-2033.958) (-2032.953) (-2036.344) -- 0:03:41
      211000 -- [-2033.302] (-2036.606) (-2038.801) (-2039.942) * (-2040.116) [-2030.127] (-2044.970) (-2035.775) -- 0:03:40
      211500 -- (-2036.005) (-2038.780) [-2035.047] (-2040.584) * (-2035.624) [-2035.999] (-2046.927) (-2042.362) -- 0:03:39
      212000 -- (-2037.583) [-2040.229] (-2034.685) (-2038.013) * (-2039.361) [-2034.189] (-2041.557) (-2035.306) -- 0:03:39
      212500 -- (-2037.407) [-2032.155] (-2034.625) (-2034.078) * (-2037.346) [-2035.175] (-2041.764) (-2035.878) -- 0:03:38
      213000 -- [-2038.064] (-2033.549) (-2034.143) (-2033.005) * (-2040.087) (-2036.810) [-2035.249] (-2043.779) -- 0:03:37
      213500 -- (-2037.333) (-2036.963) [-2036.227] (-2031.334) * (-2034.017) [-2034.472] (-2040.348) (-2034.255) -- 0:03:41
      214000 -- (-2041.961) (-2036.111) [-2040.223] (-2043.748) * (-2036.314) (-2042.270) (-2036.675) [-2035.134] -- 0:03:40
      214500 -- (-2041.729) [-2036.345] (-2040.279) (-2047.338) * (-2038.375) (-2034.352) (-2035.345) [-2038.708] -- 0:03:39
      215000 -- (-2038.184) [-2034.054] (-2050.916) (-2037.225) * (-2036.061) [-2033.179] (-2043.764) (-2035.690) -- 0:03:39

      Average standard deviation of split frequencies: 0.007638

      215500 -- (-2044.056) (-2038.061) [-2038.283] (-2035.265) * (-2035.048) (-2035.026) (-2034.996) [-2040.027] -- 0:03:38
      216000 -- (-2046.215) [-2043.075] (-2035.903) (-2036.757) * (-2032.711) (-2034.830) (-2039.600) [-2040.779] -- 0:03:37
      216500 -- (-2042.426) [-2036.242] (-2042.263) (-2037.100) * (-2038.577) (-2055.008) (-2037.843) [-2038.025] -- 0:03:37
      217000 -- (-2046.680) (-2036.331) (-2043.170) [-2038.179] * [-2030.915] (-2056.654) (-2041.094) (-2034.176) -- 0:03:40
      217500 -- (-2039.507) (-2039.213) (-2035.936) [-2035.010] * [-2035.215] (-2060.491) (-2040.396) (-2039.400) -- 0:03:39
      218000 -- (-2038.334) (-2044.063) (-2036.430) [-2033.507] * (-2040.865) (-2038.527) [-2037.548] (-2039.117) -- 0:03:38
      218500 -- [-2040.273] (-2040.994) (-2036.085) (-2035.414) * (-2037.524) (-2047.534) [-2035.392] (-2036.354) -- 0:03:38
      219000 -- (-2033.550) (-2032.573) [-2038.450] (-2045.926) * (-2037.198) (-2038.013) (-2038.929) [-2033.589] -- 0:03:37
      219500 -- [-2035.291] (-2032.026) (-2041.563) (-2039.498) * (-2034.069) (-2035.653) (-2035.207) [-2037.049] -- 0:03:36
      220000 -- [-2042.239] (-2035.250) (-2049.945) (-2045.263) * (-2034.784) (-2034.726) (-2043.630) [-2040.493] -- 0:03:36

      Average standard deviation of split frequencies: 0.005341

      220500 -- (-2040.569) (-2036.225) [-2042.961] (-2043.599) * (-2039.459) (-2040.776) (-2033.341) [-2041.813] -- 0:03:39
      221000 -- [-2036.984] (-2036.685) (-2041.761) (-2039.695) * (-2036.903) (-2033.503) (-2036.885) [-2041.841] -- 0:03:38
      221500 -- [-2031.689] (-2038.697) (-2043.128) (-2042.755) * (-2039.357) (-2038.776) (-2038.925) [-2036.177] -- 0:03:37
      222000 -- [-2034.564] (-2040.071) (-2043.784) (-2048.319) * (-2035.556) [-2036.214] (-2035.051) (-2034.427) -- 0:03:37
      222500 -- [-2036.660] (-2033.571) (-2033.575) (-2040.663) * (-2038.952) (-2040.234) (-2036.913) [-2041.930] -- 0:03:36
      223000 -- (-2035.098) (-2037.959) (-2037.876) [-2033.883] * [-2032.737] (-2037.095) (-2038.308) (-2038.809) -- 0:03:36
      223500 -- [-2032.767] (-2040.863) (-2034.992) (-2035.985) * (-2047.194) (-2035.225) (-2040.762) [-2038.519] -- 0:03:35
      224000 -- (-2035.060) [-2037.600] (-2034.443) (-2031.318) * (-2038.824) (-2035.559) (-2045.970) [-2039.463] -- 0:03:38
      224500 -- (-2035.798) [-2036.906] (-2036.512) (-2033.399) * (-2038.301) [-2033.139] (-2040.814) (-2037.868) -- 0:03:37
      225000 -- [-2035.736] (-2032.755) (-2036.711) (-2038.347) * [-2038.556] (-2039.844) (-2041.093) (-2048.040) -- 0:03:36

      Average standard deviation of split frequencies: 0.006779

      225500 -- (-2033.679) (-2038.763) [-2038.424] (-2040.107) * (-2043.669) (-2033.752) (-2035.846) [-2030.200] -- 0:03:36
      226000 -- (-2042.840) [-2033.605] (-2035.701) (-2039.744) * (-2031.027) [-2040.695] (-2037.486) (-2036.360) -- 0:03:35
      226500 -- (-2035.054) (-2032.285) [-2036.037] (-2048.460) * (-2037.533) [-2037.733] (-2044.353) (-2035.005) -- 0:03:35
      227000 -- (-2038.144) (-2034.557) [-2032.021] (-2039.302) * (-2040.880) (-2036.105) [-2032.337] (-2047.321) -- 0:03:34
      227500 -- (-2036.309) (-2033.714) [-2034.259] (-2039.440) * (-2042.656) (-2034.983) [-2032.033] (-2037.846) -- 0:03:33
      228000 -- [-2034.461] (-2039.047) (-2039.198) (-2036.313) * (-2036.161) (-2038.881) [-2032.017] (-2038.601) -- 0:03:36
      228500 -- (-2042.350) (-2039.899) [-2043.207] (-2043.384) * (-2037.142) (-2039.173) [-2034.228] (-2040.070) -- 0:03:36
      229000 -- (-2035.175) (-2038.067) [-2041.747] (-2037.093) * [-2039.163] (-2038.761) (-2033.905) (-2041.559) -- 0:03:35
      229500 -- (-2037.143) (-2037.329) [-2032.794] (-2041.234) * (-2034.770) [-2039.204] (-2039.457) (-2047.370) -- 0:03:34
      230000 -- (-2033.864) [-2047.305] (-2040.376) (-2042.333) * (-2039.351) [-2036.631] (-2036.251) (-2044.895) -- 0:03:34

      Average standard deviation of split frequencies: 0.005620

      230500 -- (-2043.776) [-2040.643] (-2041.804) (-2038.777) * (-2035.696) [-2042.828] (-2037.098) (-2045.408) -- 0:03:33
      231000 -- (-2048.215) (-2035.184) (-2035.410) [-2032.275] * [-2037.075] (-2035.700) (-2041.477) (-2044.839) -- 0:03:33
      231500 -- (-2051.699) (-2039.739) (-2037.405) [-2031.189] * (-2038.617) [-2035.554] (-2037.644) (-2038.082) -- 0:03:35
      232000 -- (-2042.619) [-2045.544] (-2035.199) (-2036.379) * (-2035.670) (-2044.948) (-2033.992) [-2037.888] -- 0:03:35
      232500 -- (-2041.338) (-2035.913) [-2037.961] (-2033.222) * (-2034.606) [-2038.423] (-2035.316) (-2042.363) -- 0:03:34
      233000 -- (-2043.907) [-2034.540] (-2043.796) (-2041.262) * [-2036.186] (-2035.059) (-2032.099) (-2042.023) -- 0:03:33
      233500 -- (-2053.461) (-2037.864) (-2050.249) [-2037.594] * (-2035.576) (-2045.515) [-2038.061] (-2045.402) -- 0:03:33
      234000 -- (-2045.918) (-2043.765) (-2041.445) [-2042.130] * (-2044.353) (-2044.132) [-2036.103] (-2041.610) -- 0:03:32
      234500 -- (-2038.195) [-2044.044] (-2037.246) (-2044.974) * (-2044.552) (-2039.597) (-2040.129) [-2031.225] -- 0:03:32
      235000 -- [-2042.297] (-2035.216) (-2039.803) (-2038.682) * (-2037.239) (-2037.138) [-2039.375] (-2037.671) -- 0:03:34

      Average standard deviation of split frequencies: 0.005493

      235500 -- (-2040.578) [-2040.933] (-2048.084) (-2038.747) * (-2035.410) (-2035.886) (-2041.280) [-2032.515] -- 0:03:34
      236000 -- (-2037.556) [-2034.264] (-2044.467) (-2039.845) * [-2039.979] (-2036.620) (-2038.572) (-2031.116) -- 0:03:33
      236500 -- [-2035.719] (-2038.326) (-2035.776) (-2038.974) * [-2032.245] (-2044.439) (-2036.526) (-2033.376) -- 0:03:33
      237000 -- (-2045.036) (-2034.940) [-2034.684] (-2036.714) * [-2035.174] (-2046.792) (-2038.848) (-2038.080) -- 0:03:32
      237500 -- (-2039.310) (-2033.648) [-2033.785] (-2037.059) * (-2039.105) (-2030.460) [-2038.518] (-2044.493) -- 0:03:31
      238000 -- (-2038.974) [-2034.518] (-2033.636) (-2038.083) * [-2035.110] (-2034.121) (-2042.344) (-2042.256) -- 0:03:31
      238500 -- (-2047.039) [-2035.487] (-2037.078) (-2038.532) * (-2045.604) [-2033.830] (-2039.084) (-2045.399) -- 0:03:33
      239000 -- (-2045.641) [-2033.626] (-2039.242) (-2042.685) * [-2034.290] (-2047.091) (-2041.785) (-2037.464) -- 0:03:33
      239500 -- (-2038.691) (-2034.493) [-2033.828] (-2041.564) * (-2035.013) [-2039.915] (-2037.216) (-2040.414) -- 0:03:32
      240000 -- [-2033.001] (-2039.583) (-2033.623) (-2034.266) * [-2037.327] (-2049.279) (-2036.693) (-2044.425) -- 0:03:32

      Average standard deviation of split frequencies: 0.005876

      240500 -- (-2033.404) (-2035.736) (-2039.264) [-2036.908] * [-2040.301] (-2037.365) (-2037.678) (-2039.264) -- 0:03:31
      241000 -- (-2035.539) [-2036.086] (-2044.426) (-2033.037) * [-2035.656] (-2040.329) (-2044.286) (-2034.688) -- 0:03:31
      241500 -- (-2038.227) (-2036.502) (-2041.105) [-2040.123] * [-2037.016] (-2040.503) (-2036.390) (-2039.668) -- 0:03:30
      242000 -- (-2044.369) (-2038.414) (-2043.626) [-2037.797] * [-2032.725] (-2031.927) (-2036.468) (-2042.073) -- 0:03:29
      242500 -- (-2044.076) (-2041.170) (-2037.504) [-2034.186] * [-2038.534] (-2034.629) (-2038.162) (-2039.356) -- 0:03:32
      243000 -- [-2035.348] (-2038.637) (-2047.646) (-2042.476) * (-2032.887) (-2036.761) (-2037.865) [-2038.228] -- 0:03:31
      243500 -- (-2033.407) (-2035.344) [-2038.802] (-2034.927) * (-2043.143) [-2035.557] (-2035.644) (-2032.112) -- 0:03:31
      244000 -- (-2039.706) (-2042.722) (-2035.642) [-2040.947] * (-2036.838) [-2033.090] (-2035.679) (-2032.825) -- 0:03:30
      244500 -- [-2033.865] (-2037.363) (-2031.812) (-2041.113) * (-2037.734) (-2041.531) [-2039.732] (-2040.666) -- 0:03:30
      245000 -- (-2036.812) (-2040.210) [-2033.790] (-2035.876) * [-2037.123] (-2040.490) (-2040.713) (-2035.588) -- 0:03:29

      Average standard deviation of split frequencies: 0.004791

      245500 -- [-2037.455] (-2035.981) (-2039.218) (-2042.887) * (-2040.838) [-2038.017] (-2035.243) (-2035.380) -- 0:03:28
      246000 -- [-2039.399] (-2036.108) (-2038.069) (-2033.745) * (-2041.174) (-2034.250) [-2037.162] (-2034.567) -- 0:03:31
      246500 -- (-2034.269) (-2034.548) (-2044.952) [-2040.142] * (-2037.864) (-2039.680) (-2033.245) [-2037.018] -- 0:03:30
      247000 -- (-2036.427) (-2036.952) [-2034.779] (-2039.706) * (-2038.210) (-2034.637) (-2035.681) [-2038.570] -- 0:03:30
      247500 -- (-2039.460) [-2038.927] (-2045.578) (-2032.812) * (-2040.272) [-2038.681] (-2037.700) (-2033.596) -- 0:03:29
      248000 -- [-2035.292] (-2037.464) (-2036.082) (-2037.577) * (-2039.437) (-2040.530) [-2034.007] (-2032.071) -- 0:03:29
      248500 -- [-2037.117] (-2039.761) (-2046.126) (-2045.804) * (-2032.650) (-2032.974) [-2040.977] (-2040.796) -- 0:03:28
      249000 -- [-2036.767] (-2038.864) (-2052.364) (-2040.724) * [-2032.541] (-2041.256) (-2040.686) (-2035.681) -- 0:03:28
      249500 -- (-2042.173) (-2041.984) (-2041.194) [-2042.306] * (-2040.200) (-2037.632) (-2036.137) [-2040.782] -- 0:03:30
      250000 -- (-2041.475) (-2041.639) [-2032.583] (-2034.328) * (-2044.977) [-2040.027] (-2042.737) (-2045.026) -- 0:03:29

      Average standard deviation of split frequencies: 0.004702

      250500 -- (-2035.775) (-2046.308) (-2040.188) [-2041.578] * (-2038.488) (-2039.171) [-2037.776] (-2040.847) -- 0:03:29
      251000 -- (-2041.342) (-2043.282) (-2040.125) [-2035.545] * [-2032.785] (-2038.919) (-2034.402) (-2035.089) -- 0:03:28
      251500 -- (-2045.036) (-2042.383) [-2037.144] (-2034.079) * [-2037.247] (-2034.729) (-2036.612) (-2033.490) -- 0:03:28
      252000 -- (-2045.380) (-2036.412) (-2037.362) [-2037.400] * [-2030.753] (-2037.655) (-2033.219) (-2036.226) -- 0:03:27
      252500 -- (-2038.647) (-2038.362) (-2042.791) [-2037.027] * (-2036.412) [-2038.397] (-2040.294) (-2041.383) -- 0:03:27
      253000 -- (-2037.869) (-2035.659) (-2040.143) [-2034.928] * (-2033.329) [-2036.740] (-2048.175) (-2037.035) -- 0:03:29
      253500 -- [-2034.643] (-2042.893) (-2041.315) (-2033.502) * [-2032.335] (-2032.623) (-2040.620) (-2034.714) -- 0:03:29
      254000 -- (-2037.304) (-2040.771) [-2039.759] (-2039.087) * [-2039.159] (-2034.650) (-2043.941) (-2037.467) -- 0:03:28
      254500 -- (-2035.660) [-2038.128] (-2043.522) (-2035.069) * (-2036.557) [-2033.788] (-2037.547) (-2037.132) -- 0:03:27
      255000 -- (-2036.587) (-2045.151) (-2046.183) [-2042.529] * [-2036.114] (-2034.111) (-2038.281) (-2042.039) -- 0:03:27

      Average standard deviation of split frequencies: 0.005064

      255500 -- [-2038.966] (-2038.029) (-2042.724) (-2040.567) * [-2034.132] (-2038.433) (-2039.714) (-2040.541) -- 0:03:26
      256000 -- (-2036.066) (-2037.967) [-2034.597] (-2041.986) * (-2039.018) [-2032.697] (-2035.075) (-2045.672) -- 0:03:26
      256500 -- (-2041.222) (-2041.586) (-2042.644) [-2037.460] * (-2046.727) (-2038.129) [-2034.757] (-2040.070) -- 0:03:25
      257000 -- [-2031.407] (-2041.737) (-2040.843) (-2039.547) * (-2039.866) [-2039.568] (-2032.124) (-2036.653) -- 0:03:28
      257500 -- (-2040.509) (-2040.239) (-2039.479) [-2034.213] * (-2041.234) (-2037.481) (-2031.604) [-2038.564] -- 0:03:27
      258000 -- (-2044.751) (-2042.950) (-2032.528) [-2042.588] * (-2037.811) (-2038.628) [-2035.021] (-2036.072) -- 0:03:27
      258500 -- (-2037.221) (-2041.970) (-2036.593) [-2035.330] * (-2040.413) [-2034.097] (-2037.343) (-2054.200) -- 0:03:26
      259000 -- (-2036.311) [-2042.288] (-2033.756) (-2036.797) * (-2037.464) (-2032.951) [-2033.518] (-2038.380) -- 0:03:25
      259500 -- (-2033.840) (-2050.207) [-2039.412] (-2043.843) * (-2037.496) (-2041.686) [-2037.232] (-2038.906) -- 0:03:25
      260000 -- (-2039.438) (-2039.259) (-2035.987) [-2035.855] * [-2035.012] (-2036.636) (-2042.542) (-2042.709) -- 0:03:24

      Average standard deviation of split frequencies: 0.004973

      260500 -- (-2037.654) [-2047.873] (-2042.682) (-2034.900) * [-2032.185] (-2037.412) (-2042.183) (-2036.196) -- 0:03:27
      261000 -- (-2036.975) (-2035.776) [-2034.078] (-2042.208) * (-2037.437) (-2041.525) [-2036.880] (-2040.024) -- 0:03:26
      261500 -- (-2038.033) [-2036.273] (-2035.992) (-2038.372) * [-2035.904] (-2038.810) (-2038.275) (-2039.311) -- 0:03:26
      262000 -- (-2035.898) (-2044.649) (-2042.816) [-2033.146] * (-2035.738) (-2038.524) (-2037.001) [-2038.957] -- 0:03:25
      262500 -- [-2035.890] (-2033.984) (-2042.411) (-2038.490) * (-2038.663) (-2034.963) [-2037.087] (-2043.604) -- 0:03:25
      263000 -- [-2038.048] (-2037.535) (-2042.339) (-2043.867) * (-2039.124) [-2037.211] (-2040.997) (-2040.523) -- 0:03:24
      263500 -- [-2040.109] (-2034.985) (-2042.050) (-2039.011) * (-2035.126) [-2033.867] (-2043.398) (-2040.311) -- 0:03:24
      264000 -- (-2042.659) [-2037.169] (-2035.579) (-2042.996) * (-2037.887) [-2035.070] (-2038.631) (-2048.871) -- 0:03:26
      264500 -- (-2036.226) [-2038.376] (-2035.660) (-2046.837) * (-2039.466) [-2036.462] (-2040.430) (-2053.793) -- 0:03:25
      265000 -- [-2035.676] (-2036.417) (-2042.880) (-2041.338) * (-2034.588) (-2040.281) (-2037.421) [-2035.692] -- 0:03:25

      Average standard deviation of split frequencies: 0.004874

      265500 -- (-2038.556) (-2032.959) (-2039.399) [-2036.138] * [-2035.044] (-2050.040) (-2034.806) (-2036.332) -- 0:03:24
      266000 -- (-2039.447) [-2034.580] (-2035.381) (-2033.438) * [-2033.310] (-2034.536) (-2037.024) (-2036.401) -- 0:03:24
      266500 -- [-2037.087] (-2032.501) (-2032.978) (-2045.561) * [-2034.647] (-2044.774) (-2043.058) (-2035.356) -- 0:03:23
      267000 -- (-2039.454) [-2035.988] (-2035.871) (-2036.316) * (-2039.558) (-2038.892) (-2045.043) [-2035.479] -- 0:03:23
      267500 -- (-2037.661) (-2042.538) [-2039.591] (-2038.587) * [-2032.159] (-2038.580) (-2037.665) (-2043.559) -- 0:03:25
      268000 -- (-2039.782) (-2045.925) (-2041.753) [-2034.489] * (-2035.448) (-2043.576) (-2037.982) [-2036.571] -- 0:03:24
      268500 -- [-2045.728] (-2039.240) (-2033.870) (-2033.779) * (-2042.946) (-2041.032) [-2035.665] (-2034.757) -- 0:03:24
      269000 -- (-2033.940) (-2041.026) (-2039.365) [-2031.845] * (-2037.530) (-2043.302) (-2031.788) [-2039.608] -- 0:03:23
      269500 -- [-2040.743] (-2042.422) (-2038.142) (-2037.703) * (-2039.496) (-2037.218) (-2038.551) [-2033.233] -- 0:03:23
      270000 -- (-2031.895) (-2036.203) [-2034.896] (-2035.445) * [-2036.733] (-2042.781) (-2043.917) (-2034.693) -- 0:03:22

      Average standard deviation of split frequencies: 0.004354

      270500 -- (-2034.026) (-2037.622) [-2035.770] (-2052.201) * (-2037.549) (-2037.954) (-2037.347) [-2033.286] -- 0:03:22
      271000 -- (-2041.513) (-2041.566) [-2041.783] (-2043.086) * [-2037.425] (-2034.448) (-2034.444) (-2036.575) -- 0:03:24
      271500 -- (-2040.971) (-2038.016) (-2041.581) [-2036.557] * (-2035.683) [-2041.874] (-2034.194) (-2036.332) -- 0:03:23
      272000 -- (-2036.567) [-2037.984] (-2041.871) (-2036.595) * (-2040.189) [-2032.126] (-2042.601) (-2039.064) -- 0:03:23
      272500 -- (-2034.799) [-2030.786] (-2040.486) (-2037.689) * (-2041.381) (-2035.984) [-2034.474] (-2042.378) -- 0:03:22
      273000 -- [-2038.568] (-2033.083) (-2037.803) (-2036.721) * (-2035.447) (-2047.813) (-2039.545) [-2038.720] -- 0:03:22
      273500 -- (-2035.940) (-2034.377) (-2034.106) [-2031.996] * (-2046.935) (-2035.894) [-2033.125] (-2037.926) -- 0:03:21
      274000 -- (-2040.316) (-2041.349) [-2038.961] (-2038.729) * [-2044.577] (-2043.911) (-2044.009) (-2037.615) -- 0:03:21
      274500 -- (-2041.947) [-2039.626] (-2036.478) (-2045.084) * (-2043.574) (-2037.436) (-2040.095) [-2033.522] -- 0:03:20
      275000 -- [-2040.113] (-2039.540) (-2042.365) (-2045.869) * (-2044.657) [-2033.057] (-2045.214) (-2040.573) -- 0:03:22

      Average standard deviation of split frequencies: 0.004270

      275500 -- (-2049.693) (-2037.142) (-2036.487) [-2039.612] * [-2036.903] (-2036.341) (-2043.886) (-2037.610) -- 0:03:22
      276000 -- (-2043.674) [-2031.648] (-2037.452) (-2038.487) * [-2034.069] (-2040.036) (-2040.363) (-2041.709) -- 0:03:21
      276500 -- (-2040.401) (-2033.264) [-2033.022] (-2040.235) * (-2037.833) (-2041.118) [-2037.251] (-2037.831) -- 0:03:21
      277000 -- (-2036.135) (-2040.555) [-2031.843] (-2033.531) * (-2036.010) [-2037.987] (-2040.554) (-2038.532) -- 0:03:20
      277500 -- (-2038.046) (-2040.449) (-2036.629) [-2033.232] * (-2038.171) [-2035.594] (-2033.803) (-2033.826) -- 0:03:20
      278000 -- (-2035.251) (-2037.783) (-2037.828) [-2040.002] * [-2044.661] (-2034.511) (-2037.808) (-2044.114) -- 0:03:19
      278500 -- (-2038.705) (-2045.062) (-2045.273) [-2037.532] * (-2041.581) (-2035.377) [-2034.619] (-2041.179) -- 0:03:22
      279000 -- (-2033.953) (-2035.630) (-2045.613) [-2038.093] * (-2036.587) [-2035.020] (-2037.436) (-2034.826) -- 0:03:21
      279500 -- (-2035.317) [-2035.104] (-2037.410) (-2035.219) * (-2039.424) (-2038.240) [-2037.604] (-2042.189) -- 0:03:21
      280000 -- (-2038.257) [-2042.849] (-2041.080) (-2036.961) * (-2036.813) (-2034.831) [-2040.866] (-2041.526) -- 0:03:20

      Average standard deviation of split frequencies: 0.003779

      280500 -- (-2038.061) [-2031.144] (-2036.375) (-2033.015) * (-2041.701) [-2035.513] (-2031.515) (-2045.611) -- 0:03:20
      281000 -- [-2032.189] (-2035.247) (-2038.170) (-2038.939) * (-2037.621) (-2035.642) (-2041.429) [-2034.866] -- 0:03:19
      281500 -- (-2037.034) [-2036.747] (-2039.033) (-2035.757) * [-2037.117] (-2040.304) (-2039.288) (-2033.734) -- 0:03:19
      282000 -- (-2033.217) [-2035.644] (-2039.317) (-2036.251) * (-2041.837) (-2034.267) [-2033.721] (-2035.835) -- 0:03:21
      282500 -- (-2038.528) (-2042.266) (-2032.531) [-2034.898] * (-2038.958) (-2036.963) (-2040.115) [-2039.587] -- 0:03:20
      283000 -- (-2037.400) (-2034.680) (-2042.588) [-2039.610] * [-2038.008] (-2035.152) (-2037.125) (-2032.162) -- 0:03:20
      283500 -- (-2039.118) (-2035.060) [-2041.032] (-2045.242) * (-2036.309) [-2036.296] (-2036.470) (-2033.133) -- 0:03:19
      284000 -- (-2037.246) (-2040.668) [-2034.195] (-2043.803) * (-2031.401) [-2036.149] (-2032.375) (-2036.543) -- 0:03:19
      284500 -- (-2033.469) (-2036.520) [-2035.479] (-2040.565) * [-2035.608] (-2041.147) (-2035.516) (-2036.965) -- 0:03:18
      285000 -- (-2037.325) [-2031.103] (-2038.415) (-2039.770) * (-2037.446) (-2043.701) [-2035.727] (-2035.966) -- 0:03:18

      Average standard deviation of split frequencies: 0.003709

      285500 -- (-2041.571) (-2038.939) [-2034.021] (-2045.093) * (-2033.012) (-2043.201) (-2034.847) [-2036.583] -- 0:03:20
      286000 -- [-2044.127] (-2035.005) (-2031.594) (-2038.145) * (-2037.168) (-2042.369) [-2038.843] (-2041.046) -- 0:03:19
      286500 -- (-2043.474) (-2035.972) [-2032.178] (-2034.126) * [-2036.595] (-2038.791) (-2038.222) (-2038.931) -- 0:03:19
      287000 -- (-2038.933) (-2036.256) (-2042.159) [-2034.441] * (-2047.390) (-2039.126) [-2034.673] (-2045.136) -- 0:03:18
      287500 -- (-2047.570) [-2032.179] (-2037.125) (-2039.314) * [-2033.040] (-2037.852) (-2037.319) (-2043.661) -- 0:03:18
      288000 -- (-2038.679) (-2034.175) [-2038.590] (-2034.219) * (-2034.582) (-2042.601) (-2037.167) [-2038.008] -- 0:03:17
      288500 -- (-2036.448) (-2045.103) [-2037.774] (-2042.050) * (-2033.904) (-2050.797) (-2036.310) [-2045.791] -- 0:03:17
      289000 -- (-2046.909) (-2041.820) [-2053.180] (-2039.557) * (-2038.299) [-2045.202] (-2036.086) (-2043.259) -- 0:03:16
      289500 -- (-2036.427) [-2030.531] (-2039.785) (-2034.819) * (-2037.449) (-2036.405) [-2035.108] (-2047.952) -- 0:03:18
      290000 -- [-2040.416] (-2035.385) (-2039.726) (-2032.733) * (-2038.205) (-2036.379) [-2035.518] (-2042.875) -- 0:03:18

      Average standard deviation of split frequencies: 0.003244

      290500 -- (-2037.526) (-2038.963) [-2034.807] (-2038.277) * [-2039.414] (-2034.794) (-2037.890) (-2038.749) -- 0:03:17
      291000 -- (-2043.552) (-2040.997) [-2037.154] (-2039.518) * [-2032.030] (-2034.541) (-2045.203) (-2040.205) -- 0:03:17
      291500 -- (-2041.276) [-2034.543] (-2044.014) (-2038.421) * (-2044.823) [-2035.980] (-2033.925) (-2037.645) -- 0:03:16
      292000 -- (-2039.592) [-2032.543] (-2040.366) (-2030.812) * [-2035.660] (-2039.372) (-2038.014) (-2043.909) -- 0:03:16
      292500 -- (-2040.491) (-2045.996) (-2036.043) [-2035.052] * (-2036.939) (-2041.542) (-2035.345) [-2037.503] -- 0:03:15
      293000 -- [-2037.839] (-2035.558) (-2043.229) (-2035.985) * [-2036.021] (-2045.278) (-2037.227) (-2035.311) -- 0:03:17
      293500 -- (-2043.881) [-2034.778] (-2035.800) (-2034.632) * (-2039.036) (-2043.744) (-2036.233) [-2033.912] -- 0:03:17
      294000 -- (-2041.848) (-2038.175) (-2038.138) [-2036.296] * (-2049.251) (-2045.470) [-2036.819] (-2029.988) -- 0:03:16
      294500 -- (-2048.575) (-2038.498) (-2037.941) [-2033.389] * (-2044.664) (-2038.876) [-2035.321] (-2038.753) -- 0:03:16
      295000 -- (-2043.718) (-2041.394) (-2035.135) [-2029.712] * (-2036.448) (-2034.634) (-2040.738) [-2034.863] -- 0:03:15

      Average standard deviation of split frequencies: 0.003185

      295500 -- (-2042.057) (-2040.399) [-2039.648] (-2035.338) * (-2039.679) [-2035.348] (-2038.939) (-2031.242) -- 0:03:15
      296000 -- [-2039.840] (-2038.108) (-2042.171) (-2050.490) * (-2035.898) (-2033.023) (-2031.461) [-2038.578] -- 0:03:15
      296500 -- (-2046.339) (-2041.288) (-2034.400) [-2037.359] * (-2037.295) [-2034.607] (-2042.199) (-2031.999) -- 0:03:16
      297000 -- (-2032.755) [-2036.696] (-2039.887) (-2042.741) * (-2037.658) (-2032.321) [-2039.954] (-2040.158) -- 0:03:16
      297500 -- (-2047.879) (-2034.984) [-2034.906] (-2040.130) * (-2040.872) [-2031.608] (-2045.153) (-2040.019) -- 0:03:15
      298000 -- (-2038.703) (-2038.098) [-2032.820] (-2037.217) * (-2040.864) [-2037.848] (-2041.312) (-2033.445) -- 0:03:15
      298500 -- [-2030.499] (-2039.616) (-2033.288) (-2038.521) * (-2055.573) (-2040.496) (-2033.436) [-2032.096] -- 0:03:15
      299000 -- (-2033.109) (-2038.806) [-2038.125] (-2039.956) * (-2043.006) (-2037.585) [-2032.658] (-2037.793) -- 0:03:14
      299500 -- [-2033.830] (-2038.908) (-2042.214) (-2037.246) * (-2056.045) (-2037.000) (-2044.837) [-2031.780] -- 0:03:14
      300000 -- (-2037.278) (-2039.352) (-2040.556) [-2036.818] * (-2044.577) [-2042.346] (-2038.054) (-2043.472) -- 0:03:15

      Average standard deviation of split frequencies: 0.003920

      300500 -- [-2034.514] (-2037.402) (-2036.134) (-2033.529) * (-2042.158) (-2040.494) (-2036.258) [-2030.480] -- 0:03:15
      301000 -- (-2047.304) (-2034.866) [-2046.983] (-2039.319) * (-2039.728) (-2041.518) (-2034.376) [-2040.009] -- 0:03:15
      301500 -- (-2030.259) [-2037.836] (-2042.868) (-2035.140) * (-2040.085) (-2035.480) (-2034.684) [-2037.661] -- 0:03:14
      302000 -- [-2035.542] (-2037.350) (-2045.406) (-2036.787) * (-2033.189) (-2043.098) (-2039.760) [-2040.833] -- 0:03:14
      302500 -- (-2042.476) (-2037.588) [-2039.676] (-2038.051) * (-2037.457) (-2042.100) [-2035.254] (-2036.553) -- 0:03:13
      303000 -- (-2043.273) [-2037.804] (-2035.848) (-2038.427) * [-2046.763] (-2043.292) (-2031.901) (-2034.390) -- 0:03:13
      303500 -- [-2037.893] (-2037.059) (-2035.485) (-2039.967) * [-2035.020] (-2037.867) (-2035.184) (-2043.740) -- 0:03:15
      304000 -- (-2041.318) [-2042.930] (-2039.115) (-2043.153) * [-2034.584] (-2034.018) (-2038.498) (-2036.531) -- 0:03:14
      304500 -- [-2036.505] (-2037.920) (-2041.161) (-2043.234) * (-2037.123) [-2039.818] (-2034.786) (-2036.033) -- 0:03:14
      305000 -- (-2031.075) (-2038.409) [-2035.968] (-2041.165) * (-2048.791) (-2033.575) [-2031.070] (-2039.843) -- 0:03:13

      Average standard deviation of split frequencies: 0.003851

      305500 -- (-2037.285) (-2045.441) [-2034.769] (-2039.103) * (-2038.212) (-2034.823) (-2035.234) [-2034.470] -- 0:03:13
      306000 -- (-2038.675) (-2042.210) [-2043.835] (-2039.763) * (-2038.057) (-2034.148) [-2037.775] (-2040.334) -- 0:03:12
      306500 -- (-2033.692) (-2038.184) (-2033.012) [-2033.909] * (-2040.504) (-2037.637) (-2035.009) [-2037.554] -- 0:03:12
      307000 -- [-2030.937] (-2038.741) (-2036.805) (-2040.302) * (-2044.272) [-2038.342] (-2037.317) (-2037.052) -- 0:03:11
      307500 -- (-2036.142) (-2038.365) (-2038.885) [-2038.048] * (-2038.278) [-2033.406] (-2043.339) (-2037.435) -- 0:03:13
      308000 -- [-2035.152] (-2044.016) (-2036.815) (-2041.756) * (-2035.699) (-2042.508) (-2041.396) [-2035.210] -- 0:03:13
      308500 -- [-2040.036] (-2044.567) (-2044.741) (-2036.160) * (-2035.483) [-2034.047] (-2039.826) (-2034.013) -- 0:03:12
      309000 -- (-2043.783) [-2039.708] (-2035.216) (-2041.122) * (-2044.186) (-2035.509) (-2040.089) [-2035.352] -- 0:03:12
      309500 -- [-2044.507] (-2042.129) (-2034.144) (-2042.267) * (-2033.654) (-2049.694) [-2034.946] (-2032.772) -- 0:03:11
      310000 -- (-2036.533) (-2036.721) [-2037.017] (-2037.749) * (-2034.047) (-2041.978) [-2035.820] (-2037.871) -- 0:03:11

      Average standard deviation of split frequencies: 0.003414

      310500 -- (-2036.753) (-2051.938) (-2047.664) [-2039.422] * [-2037.595] (-2041.646) (-2038.239) (-2039.021) -- 0:03:10
      311000 -- [-2038.246] (-2042.351) (-2039.457) (-2037.849) * (-2036.838) (-2045.935) [-2038.829] (-2038.607) -- 0:03:12
      311500 -- (-2036.839) (-2043.826) (-2038.658) [-2035.494] * (-2035.524) (-2042.972) [-2034.660] (-2045.935) -- 0:03:12
      312000 -- [-2037.016] (-2040.597) (-2044.347) (-2045.505) * (-2040.870) [-2036.620] (-2034.175) (-2041.081) -- 0:03:11
      312500 -- (-2041.138) (-2043.327) [-2038.345] (-2043.686) * [-2039.996] (-2051.988) (-2042.963) (-2042.536) -- 0:03:11
      313000 -- (-2037.060) (-2033.936) [-2037.716] (-2035.295) * [-2041.643] (-2042.260) (-2043.062) (-2039.423) -- 0:03:10
      313500 -- (-2056.346) (-2037.036) (-2038.708) [-2037.802] * [-2037.446] (-2041.276) (-2040.583) (-2039.539) -- 0:03:10
      314000 -- (-2039.818) (-2045.198) [-2032.496] (-2037.851) * [-2032.244] (-2043.527) (-2046.171) (-2042.712) -- 0:03:10
      314500 -- (-2034.168) (-2046.553) (-2036.736) [-2043.634] * (-2037.230) [-2039.024] (-2030.934) (-2036.793) -- 0:03:11
      315000 -- [-2035.380] (-2038.102) (-2041.324) (-2046.236) * [-2036.946] (-2036.787) (-2033.089) (-2041.825) -- 0:03:11

      Average standard deviation of split frequencies: 0.004102

      315500 -- [-2036.068] (-2040.636) (-2040.563) (-2039.955) * [-2036.912] (-2033.831) (-2037.939) (-2041.197) -- 0:03:10
      316000 -- [-2034.168] (-2044.629) (-2038.326) (-2039.750) * [-2039.633] (-2034.472) (-2036.941) (-2048.763) -- 0:03:10
      316500 -- (-2040.712) (-2036.444) (-2039.806) [-2035.554] * [-2040.267] (-2041.321) (-2043.447) (-2039.392) -- 0:03:10
      317000 -- (-2031.754) [-2035.818] (-2040.422) (-2036.692) * (-2040.381) [-2038.346] (-2034.220) (-2038.843) -- 0:03:09
      317500 -- [-2033.833] (-2032.035) (-2039.304) (-2040.908) * (-2035.975) (-2042.737) [-2033.744] (-2036.201) -- 0:03:09
      318000 -- [-2040.218] (-2042.469) (-2034.497) (-2033.599) * (-2039.991) [-2040.887] (-2039.129) (-2034.776) -- 0:03:10
      318500 -- (-2038.148) (-2039.602) [-2035.551] (-2037.996) * (-2034.382) (-2039.078) (-2040.939) [-2037.914] -- 0:03:10
      319000 -- (-2037.466) (-2041.540) [-2034.772] (-2044.277) * [-2042.239] (-2042.013) (-2043.135) (-2035.248) -- 0:03:09
      319500 -- (-2038.450) (-2040.566) [-2033.309] (-2040.657) * (-2038.556) (-2038.351) (-2040.988) [-2036.398] -- 0:03:09
      320000 -- (-2035.121) (-2040.583) [-2033.145] (-2039.191) * (-2036.065) (-2041.210) (-2042.220) [-2035.565] -- 0:03:09

      Average standard deviation of split frequencies: 0.002940

      320500 -- (-2039.457) [-2036.114] (-2036.396) (-2037.806) * (-2032.511) [-2033.256] (-2036.355) (-2033.658) -- 0:03:08
      321000 -- (-2035.219) [-2037.902] (-2032.255) (-2044.560) * [-2032.053] (-2033.004) (-2037.255) (-2036.381) -- 0:03:08
      321500 -- [-2030.593] (-2036.085) (-2048.520) (-2038.814) * (-2043.576) [-2035.146] (-2040.069) (-2035.295) -- 0:03:09
      322000 -- [-2039.487] (-2035.261) (-2044.223) (-2038.457) * (-2046.269) (-2042.370) (-2036.427) [-2034.608] -- 0:03:09
      322500 -- (-2036.687) (-2033.123) (-2045.123) [-2035.881] * (-2048.582) (-2039.645) [-2034.240] (-2034.726) -- 0:03:09
      323000 -- (-2039.765) (-2037.588) [-2042.977] (-2037.779) * (-2043.165) [-2037.520] (-2034.420) (-2035.667) -- 0:03:08
      323500 -- [-2031.105] (-2038.661) (-2034.151) (-2036.617) * [-2044.622] (-2034.508) (-2030.419) (-2039.840) -- 0:03:08
      324000 -- (-2036.546) (-2036.963) [-2039.990] (-2033.927) * (-2035.700) (-2030.954) [-2035.451] (-2035.138) -- 0:03:07
      324500 -- [-2037.221] (-2036.578) (-2036.442) (-2035.243) * (-2033.603) [-2033.155] (-2038.794) (-2039.566) -- 0:03:07
      325000 -- (-2041.391) (-2037.383) (-2043.158) [-2041.508] * (-2037.982) (-2035.103) (-2042.694) [-2034.741] -- 0:03:08

      Average standard deviation of split frequencies: 0.003615

      325500 -- (-2043.535) [-2045.106] (-2039.284) (-2039.143) * (-2043.317) (-2043.964) [-2046.085] (-2033.749) -- 0:03:08
      326000 -- (-2044.737) [-2034.975] (-2032.573) (-2037.976) * (-2041.377) (-2031.694) [-2034.155] (-2032.570) -- 0:03:08
      326500 -- (-2039.817) [-2038.106] (-2041.555) (-2041.418) * (-2043.834) (-2036.948) [-2035.690] (-2045.398) -- 0:03:07
      327000 -- [-2039.441] (-2040.415) (-2040.896) (-2044.754) * (-2038.430) (-2036.612) [-2033.470] (-2033.841) -- 0:03:07
      327500 -- (-2036.661) (-2044.757) [-2035.007] (-2038.199) * [-2040.811] (-2039.834) (-2045.549) (-2040.349) -- 0:03:06
      328000 -- (-2047.190) [-2038.687] (-2035.664) (-2043.206) * (-2046.135) (-2036.729) [-2040.430] (-2034.651) -- 0:03:06
      328500 -- (-2037.809) [-2039.639] (-2034.962) (-2040.600) * [-2041.526] (-2033.369) (-2033.758) (-2034.810) -- 0:03:06
      329000 -- (-2043.893) (-2038.771) [-2037.148] (-2047.460) * [-2039.304] (-2036.979) (-2038.132) (-2037.200) -- 0:03:07
      329500 -- [-2032.462] (-2036.930) (-2037.215) (-2042.452) * [-2033.772] (-2043.913) (-2036.012) (-2034.917) -- 0:03:07
      330000 -- (-2033.664) [-2037.472] (-2035.847) (-2042.903) * (-2032.971) [-2034.501] (-2035.692) (-2035.069) -- 0:03:06

      Average standard deviation of split frequencies: 0.003208

      330500 -- [-2035.135] (-2037.361) (-2038.179) (-2046.038) * (-2035.843) (-2032.377) [-2037.911] (-2034.189) -- 0:03:06
      331000 -- [-2035.270] (-2031.601) (-2035.425) (-2042.739) * [-2034.622] (-2040.485) (-2041.646) (-2036.092) -- 0:03:05
      331500 -- [-2036.882] (-2036.468) (-2039.008) (-2046.645) * (-2037.226) (-2042.380) (-2044.688) [-2033.255] -- 0:03:05
      332000 -- (-2037.436) [-2035.952] (-2041.082) (-2046.174) * (-2037.560) (-2037.202) (-2036.624) [-2035.756] -- 0:03:05
      332500 -- (-2037.920) [-2038.277] (-2034.241) (-2036.276) * (-2035.810) (-2036.885) (-2034.517) [-2034.095] -- 0:03:06
      333000 -- [-2036.261] (-2036.727) (-2035.360) (-2041.364) * [-2035.844] (-2041.705) (-2040.937) (-2037.522) -- 0:03:06
      333500 -- (-2045.153) [-2035.012] (-2045.464) (-2037.125) * [-2036.741] (-2035.854) (-2047.297) (-2035.234) -- 0:03:05
      334000 -- (-2043.432) (-2037.402) (-2036.813) [-2034.092] * (-2034.840) [-2037.893] (-2036.234) (-2031.927) -- 0:03:05
      334500 -- [-2035.357] (-2036.617) (-2040.492) (-2039.835) * (-2037.048) (-2037.457) (-2031.998) [-2039.899] -- 0:03:05
      335000 -- (-2036.938) (-2044.550) [-2037.735] (-2035.631) * (-2041.985) (-2036.809) (-2038.981) [-2035.902] -- 0:03:04

      Average standard deviation of split frequencies: 0.004209

      335500 -- (-2037.292) (-2043.715) (-2044.211) [-2030.373] * (-2038.772) (-2033.866) (-2038.824) [-2032.697] -- 0:03:04
      336000 -- (-2034.959) [-2045.452] (-2045.647) (-2032.972) * (-2047.706) (-2036.901) (-2041.443) [-2034.650] -- 0:03:05
      336500 -- (-2037.136) (-2043.433) [-2037.991] (-2031.490) * (-2040.965) (-2038.569) (-2035.346) [-2038.863] -- 0:03:05
      337000 -- (-2039.268) (-2036.679) (-2039.690) [-2034.224] * (-2046.091) (-2032.587) (-2035.717) [-2033.622] -- 0:03:04
      337500 -- (-2034.937) [-2037.463] (-2040.058) (-2036.762) * (-2039.838) (-2038.113) [-2038.534] (-2041.199) -- 0:03:04
      338000 -- (-2039.469) [-2034.640] (-2035.007) (-2035.049) * (-2037.253) (-2039.688) (-2040.162) [-2032.974] -- 0:03:04
      338500 -- (-2035.897) [-2034.250] (-2030.541) (-2039.904) * (-2039.361) (-2032.298) [-2042.442] (-2035.642) -- 0:03:03
      339000 -- [-2040.045] (-2035.812) (-2044.942) (-2035.769) * [-2035.569] (-2036.057) (-2039.203) (-2036.298) -- 0:03:03
      339500 -- [-2036.777] (-2040.508) (-2043.305) (-2044.468) * (-2036.546) (-2036.859) (-2035.827) [-2035.653] -- 0:03:04
      340000 -- (-2034.302) (-2038.021) (-2049.408) [-2036.257] * (-2034.027) (-2037.197) [-2037.650] (-2040.541) -- 0:03:04

      Average standard deviation of split frequencies: 0.004843

      340500 -- [-2037.901] (-2035.900) (-2042.836) (-2037.980) * [-2034.245] (-2031.369) (-2034.176) (-2052.602) -- 0:03:04
      341000 -- (-2037.844) [-2040.920] (-2038.945) (-2032.897) * (-2043.340) (-2038.064) (-2038.121) [-2035.545] -- 0:03:03
      341500 -- (-2035.160) [-2037.321] (-2035.928) (-2041.817) * (-2039.107) (-2035.365) (-2039.110) [-2039.136] -- 0:03:03
      342000 -- (-2034.664) (-2038.330) [-2045.140] (-2039.009) * (-2038.279) (-2034.658) [-2042.241] (-2036.255) -- 0:03:02
      342500 -- (-2033.843) [-2038.564] (-2041.605) (-2037.412) * (-2037.201) (-2037.088) [-2036.611] (-2040.639) -- 0:03:02
      343000 -- (-2034.360) [-2041.698] (-2037.043) (-2037.226) * (-2038.778) (-2034.181) [-2042.113] (-2043.383) -- 0:03:01
      343500 -- (-2039.055) [-2038.818] (-2038.096) (-2032.563) * (-2042.704) (-2035.994) (-2035.865) [-2037.719] -- 0:03:03
      344000 -- [-2040.611] (-2039.354) (-2037.168) (-2030.698) * [-2037.507] (-2039.827) (-2037.195) (-2042.288) -- 0:03:03
      344500 -- (-2035.667) [-2040.099] (-2043.158) (-2034.098) * [-2031.800] (-2037.134) (-2041.964) (-2039.060) -- 0:03:02
      345000 -- [-2037.595] (-2037.511) (-2046.850) (-2034.588) * (-2036.976) (-2032.562) [-2037.256] (-2035.979) -- 0:03:02

      Average standard deviation of split frequencies: 0.003747

      345500 -- (-2040.917) [-2036.745] (-2035.864) (-2046.673) * (-2043.106) (-2047.181) [-2035.057] (-2040.851) -- 0:03:01
      346000 -- [-2034.693] (-2038.443) (-2032.668) (-2037.327) * (-2038.260) (-2040.604) (-2036.080) [-2039.769] -- 0:03:01
      346500 -- (-2034.529) (-2035.304) (-2037.948) [-2041.895] * [-2037.467] (-2034.308) (-2036.435) (-2036.535) -- 0:03:01
      347000 -- (-2038.503) (-2035.573) [-2030.992] (-2038.414) * (-2039.665) (-2037.629) [-2040.310] (-2043.005) -- 0:03:02
      347500 -- (-2034.608) [-2036.670] (-2037.856) (-2039.416) * (-2034.503) (-2042.275) [-2038.666] (-2034.969) -- 0:03:02
      348000 -- (-2039.507) (-2035.304) [-2038.822] (-2034.632) * (-2042.096) (-2041.321) (-2037.064) [-2037.170] -- 0:03:01
      348500 -- (-2