--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Nov 25 13:44:00 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/346/PGRP-LB-PD/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2033.31 -2046.73
2 -2033.25 -2044.44
--------------------------------------
TOTAL -2033.28 -2046.14
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.429569 0.003279 0.325417 0.541663 0.423086 1388.67 1395.10 1.000
r(A<->C){all} 0.171477 0.001170 0.109790 0.240236 0.168847 776.49 1050.29 1.000
r(A<->G){all} 0.207973 0.001728 0.128421 0.288264 0.206254 641.06 882.34 1.000
r(A<->T){all} 0.132867 0.001639 0.055534 0.208155 0.130260 594.80 629.49 1.000
r(C<->G){all} 0.094964 0.000504 0.053544 0.141198 0.093294 770.33 941.45 1.000
r(C<->T){all} 0.287521 0.002089 0.203535 0.381699 0.286065 927.65 1013.66 1.000
r(G<->T){all} 0.105198 0.000923 0.049269 0.163644 0.103085 944.19 1014.89 1.000
pi(A){all} 0.214895 0.000187 0.188397 0.241696 0.214912 1291.03 1329.28 1.000
pi(C){all} 0.333231 0.000244 0.302095 0.362482 0.333285 1132.69 1185.57 1.001
pi(G){all} 0.275918 0.000229 0.244622 0.303762 0.275400 1070.95 1136.05 1.000
pi(T){all} 0.175956 0.000160 0.152789 0.201718 0.175528 1248.39 1297.34 1.000
alpha{1,2} 0.126714 0.004481 0.000208 0.231717 0.128822 1043.93 1068.19 1.000
alpha{3} 1.886459 0.579474 0.681053 3.407272 1.748901 1128.70 1251.37 1.001
pinvar{all} 0.191412 0.012988 0.000006 0.390345 0.184523 1055.21 1135.54 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1876.238336
Model 2: PositiveSelection -1875.321254
Model 0: one-ratio -1896.251769
Model 3: discrete -1875.288646
Model 7: beta -1878.591073
Model 8: beta&w>1 -1875.297185
Model 0 vs 1 40.026866000000155
Model 2 vs 1 1.8341639999998733
Model 8 vs 7 6.587776000000304
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PD)
Pr(w>1) post mean +- SE for w
13 G 0.997** 1.789
14 P 0.992** 1.780
17 L 0.716 1.318
26 L 0.675 1.248
214 I 0.904 1.633
216 D 0.891 1.613
220 V 0.965* 1.735
222 T 0.997** 1.789
235 A 0.847 1.538
237 Q 0.767 1.404
238 K 0.981* 1.763
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PD)
Pr(w>1) post mean +- SE for w
13 G 0.889 2.075 +- 0.921
14 P 0.903 2.119 +- 0.948
214 I 0.737 1.815 +- 1.064
216 D 0.542 1.414 +- 0.965
220 V 0.746 1.822 +- 1.005
222 T 0.904 2.119 +- 0.939
235 A 0.647 1.635 +- 1.084
237 Q 0.512 1.331 +- 1.005
238 K 0.828 1.979 +- 0.981
>C1
MGDKVSGSVSTSGPTSLAILMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHINDTEGVSSTTAPVVPHVHPQAAAPQKPHQSPP
AAPKVooooo
>C2
MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLNASDGESSTAAPVVPHVHAQAAAPQTPHQSPP
AAPKVooooo
>C3
MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLNATEGVSSTAAPVVPHVHAQAAAPQTPHQSPP
AAPKVooooo
>C4
MGDKVSGSVSTSSLTSPAILMDSEHWEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKAATQTPLAQSP
PAAPKVoooo
>C5
MGDKVSGSVSTSGTTSPAILMNTEHLQQQQLATSWGYSQHMQQANLGTAR
LLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQ
DFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAHAPKYNDRSVGIVLI
GDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLLGHRQVRDTECPGGR
LFAEISSWPHFTHINDTEGVSSTKAPVEPHVHPQAATQQTPPKSPPAAPK
Vooooooooo
>C6
MGDKASGSVSIPSTKPPAILTDSEHFEQQQLATTCGYSQHMQHANLGDGA
ATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVCYTTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISGWPHFTHLNATEGSTPVPIEPHAHPQAASQTPPQSPPQSP
PHAPAAAPKV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=272
C1 MGDKVSGSVSTSGPTSLAILMDSEQLEQQQLATSCGYSQHMQQANLGDGV
C2 MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
C3 MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
C4 MGDKVSGSVSTSSLTSPAILMDSEHWEQQQLATSCGYSQHMQQANLGDGV
C5 MGDKVSGSVSTSGTTSPAILMNTEHLQQQQLATSWGYSQHMQQANLG---
C6 MGDKASGSVSIPSTKPPAILTDSEHFEQQQLATTCGYSQHMQHANLGDGA
****.***** .. .. ** ::*: :******: *******:****
C1 ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
C2 ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
C3 ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
C4 ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVCYSTPECMKSM
C5 -TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
C6 ATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVCYTTPDCMKSM
******************:**:**************.***:**:*****
C1 RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
C2 RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
C3 RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
C4 RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAHAPKYNDKSVG
C5 RDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAHAPKYNDRSVG
C6 RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
*****************************:******:*********:***
C1 IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
C2 IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
C3 IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
C4 IVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLLGHRQVRDTEC
C5 IVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLLGHRQVRDTEC
C6 IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
********************::**:*************************
C1 PGGRLFAEISSWPHFTHINDTEGV-SSTTAPVVPHVHPQAAAP---QKPH
C2 PGGRLFAEISSWPHFTHLNASDGE-SSTAAPVVPHVHAQAAAP---QTPH
C3 PGGRLFAEISSWPHFTHLNATEGV-SSTAAPVVPHVHAQAAAP---QTPH
C4 PGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKAATQ---TPLA
C5 PGGRLFAEISSWPHFTHINDTEGV-SSTKAPVEPHVHPQAATQ---QTPP
C6 PGGRLFAEISGWPHFTHLNATEGS---TPVPIEPHAHPQAASQTPPQSPP
**********.******:. ::* * .*: **.*.:**:
C1 QSPP----AAPKVooooo----
C2 QSPP----AAPKVooooo----
C3 QSPP----AAPKVooooo----
C4 QSPP----AAPKVoooo-----
C5 KSPP----AAPKVooooooooo
C6 QSPPHAPAAAPKV---------
:*** *****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 260 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 260 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9004]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [9004]--->[8586]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.344 Mb, Max= 30.691 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MGDKVSGSVSTSGPTSLAILMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHINDTEGV-SSTTAPVVPHVHPQAAAP---QKPH
QSPP----AAPKVooooo----
>C2
MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLNASDGE-SSTAAPVVPHVHAQAAAP---QTPH
QSPP----AAPKVooooo----
>C3
MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLNATEGV-SSTAAPVVPHVHAQAAAP---QTPH
QSPP----AAPKVooooo----
>C4
MGDKVSGSVSTSSLTSPAILMDSEHWEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKAATQ---TPLA
QSPP----AAPKVoooo-----
>C5
MGDKVSGSVSTSGTTSPAILMNTEHLQQQQLATSWGYSQHMQQANLG---
-TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAHAPKYNDRSVG
IVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHINDTEGV-SSTKAPVEPHVHPQAATQ---QTPP
KSPP----AAPKVooooooooo
>C6
MGDKASGSVSIPSTKPPAILTDSEHFEQQQLATTCGYSQHMQHANLGDGA
ATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVCYTTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISGWPHFTHLNATEGS---TPVPIEPHAHPQAASQTPPQSPP
QSPPHAPAAAPKV---------
FORMAT of file /tmp/tmp3016354545656366050aln Not Supported[FATAL:T-COFFEE]
>C1
MGDKVSGSVSTSGPTSLAILMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHINDTEGV-SSTTAPVVPHVHPQAAAP---QKPH
QSPP----AAPKVooooo----
>C2
MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLNASDGE-SSTAAPVVPHVHAQAAAP---QTPH
QSPP----AAPKVooooo----
>C3
MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLNATEGV-SSTAAPVVPHVHAQAAAP---QTPH
QSPP----AAPKVooooo----
>C4
MGDKVSGSVSTSSLTSPAILMDSEHWEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKAATQ---TPLA
QSPP----AAPKVoooo-----
>C5
MGDKVSGSVSTSGTTSPAILMNTEHLQQQQLATSWGYSQHMQQANLG---
-TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAHAPKYNDRSVG
IVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHINDTEGV-SSTKAPVEPHVHPQAATQ---QTPP
KSPP----AAPKVooooooooo
>C6
MGDKASGSVSIPSTKPPAILTDSEHFEQQQLATTCGYSQHMQHANLGDGA
ATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVCYTTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISGWPHFTHLNATEGS---TPVPIEPHAHPQAASQTPPQSPP
QSPPHAPAAAPKV---------
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:272 S:96 BS:272
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 94.62 C1 C2 94.62
TOP 1 0 94.62 C2 C1 94.62
BOT 0 2 96.15 C1 C3 96.15
TOP 2 0 96.15 C3 C1 96.15
BOT 0 3 91.12 C1 C4 91.12
TOP 3 0 91.12 C4 C1 91.12
BOT 0 4 93.36 C1 C5 93.36
TOP 4 0 93.36 C5 C1 93.36
BOT 0 5 88.54 C1 C6 88.54
TOP 5 0 88.54 C6 C1 88.54
BOT 1 2 98.46 C2 C3 98.46
TOP 2 1 98.46 C3 C2 98.46
BOT 1 3 91.12 C2 C4 91.12
TOP 3 1 91.12 C4 C2 91.12
BOT 1 4 90.23 C2 C5 90.23
TOP 4 1 90.23 C5 C2 90.23
BOT 1 5 87.75 C2 C6 87.75
TOP 5 1 87.75 C6 C2 87.75
BOT 2 3 91.89 C3 C4 91.89
TOP 3 2 91.89 C4 C3 91.89
BOT 2 4 91.80 C3 C5 91.80
TOP 4 2 91.80 C5 C3 91.80
BOT 2 5 88.93 C3 C6 88.93
TOP 5 2 88.93 C6 C3 88.93
BOT 3 4 89.80 C4 C5 89.80
TOP 4 3 89.80 C5 C4 89.80
BOT 3 5 86.96 C4 C6 86.96
TOP 5 3 86.96 C6 C4 86.96
BOT 4 5 87.95 C5 C6 87.95
TOP 5 4 87.95 C6 C5 87.95
AVG 0 C1 * 92.76
AVG 1 C2 * 92.44
AVG 2 C3 * 93.45
AVG 3 C4 * 90.18
AVG 4 C5 * 90.63
AVG 5 C6 * 88.03
TOT TOT * 91.25
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGGCGACAAGGTGTCTGGATCCGTCTCCACTTCTGGCCCAACTTCCTT
C2 ATGGGCGACAAGGTGTCTGGATCCGTCTCCACTTCTAGCACAACTTCCTC
C3 ATGGGCGACAAGGTGTCTGGATCCGTCTCCACTTCTAGCACAACTTCCTC
C4 ATGGGCGACAAGGTGTCTGGATCCGTATCCACTTCTAGCTTAACTTCCCC
C5 ATGGGCGACAAGGTGTCTGGATCCGTATCCACTTCTGGCACAACTTCCCC
C6 ATGGGCGACAAAGCGTCTGGATCCGTCTCCATTCCCTCGACAAAACCCCC
***********.* ************.**** * * **.: **
C1 GGCAATCCTCATGGACTCGGAGCAATTGGAGCAGCAACAGCTGGCCACAA
C2 GGCAATCCCCATGGACTCGGAGCAATTGGAGCAGCAACAGCTGGCCACAA
C3 GGCAATCCCCATGGACTCGGAGCAATTGGAGCAGCAACAGCTGGCCACAA
C4 GGCAATCCTCATGGACTCGGAGCATTGGGAGCAGCAACAGCTGGCCACAA
C5 GGCAATTCTTATGAACACAGAGCATTTGCAGCAGCAACAGCTGGCCACAA
C6 AGCAATCCTCACGGACTCGGAGCATTTCGAGCAACAACAGCTGGCCACAA
.***** * * *.**:*.*****:* ****.****************
C1 GTTGTGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGCGACGGTGTG
C2 GTTGTGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGCGACGGTGTG
C3 GTTGTGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGCGACGGTGTG
C4 GTTGTGGCTATAGTCAGCACATGCAGCAGGCAAATCTGGGCGATGGTGTG
C5 GTTGGGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGC---------
C6 CTTGTGGCTATAGCCAGCACATGCAGCATGCGAATTTGGGCGATGGAGCG
*** ******** ************** **.*** *****
C1 GCCACCGCCCGCCTGCTGTCCCGATCCGACTGGGGTGCCCGGCTGCCCAA
C2 GCCACCGCCCGCCTGCTTTCCCGATCCGACTGGGGTGCCCGGCTGCCCAA
C3 GCCACCGCCCGCCTGCTTTCCCGATCCGACTGGGGTGCACGGCTGCCCAA
C4 GCCACCGCCCGACTGCTGTCCAGATCCGACTGGGGTGCCCGGCTGCCCAA
C5 ---ACCGCCCGGCTTCTGTCCCGATCCGACTGGGGTGCCCGCCTGCCCAA
C6 GCCACCGCTCGACTTCTGTCCCGCTCCGACTGGGGCGCCCGTCTGCCCAA
***** ** ** ** ***.*.*********** **.** ********
C1 GTCCGTGGAGCACTTCCAGGGTCCCGCGCCCTACGTCATCATCCATCACT
C2 GTCTGTGGACCACTTCCAGGGACCCGCGCCCTACGTCATCATCCACCACT
C3 GTCCGTGGAGCACTTCCAGGGACCAGCGCCTTACGTCATCATCCACCACT
C4 GTCCGTGGACCACTTTCAGGGACCCGCGCCCTACGTCATCATCCACCACT
C5 GTCCGTGGAGCACTTTCAAGGACCCGCGCCCTACGTGATCATCCACCACT
C6 GTCCGTGGAGCACTTCGAGGGTCCCGCCCCCTACGTGATCATCCACCACT
*** ***** ***** *.**:**.** ** ***** ******** ****
C1 CGTACATGCCGGCCGTGTGCTACTCCACTCCGGACTGCATGAAGAGCATG
C2 CGTACATGCCGGCCGTGTGCTACTCCACTCCGGAATGCATGAAGAGCATG
C3 CGTATATGCCGGCCGTGTGCTACTCAACTCCGGAATGCATGAAGAGCATG
C4 CGTACATGCCAGGCGTGTGCTACTCCACTCCGGAGTGCATGAAGAGCATG
C5 CGTACATGCCAGCCGTGTGCTACTCCACTCCGGACTGCATGAAGAGCATG
C6 CTTACATGCCGGCGGTGTGCTATACCACTCCCGACTGCATGAAGAGCATG
* ** *****.* ******** :*.***** ** ***************
C1 CGGGACATGCAGGACTTCCATCAGCTGGAGCGCGGATGGAACGATATTGG
C2 CGGGACATGCAGGACTTCCATCAGCTGGAGCGCGGATGGAACGATATTGG
C3 CGGGACATGCAGGACTTTCATCAGCTGGAGCGCGGATGGAACGATATTGG
C4 CGGGACATGCAGGACTTCCACCAGCTGGAGCGCGGATGGAACGATATCGG
C5 CGGGACATGCAGGACTTCCACCAGCTGGAGCGCGGTTGGAACGATATCGG
C6 CGCGACATGCAGGACTTCCACCAGCTGGAGCGCGGTTGGAACGACATCGG
** ************** ** **************:******** ** **
C1 TTATAGCTTTGGCATCGGCGGCGATGGCATGATTTACACCGGCAGGGGAT
C2 TTATAGCTTTGGCATCGGCGGCGATGGCATGATCTACACCGGCAGGGGAT
C3 TTATAGCTTTGGCATCGGCGGCGATGGCATGATCTACACCGGCAGGGGAT
C4 ATATAGCTTTGGCATCGGCGGCGATGGCATGATCTACACCGGCAGGGGAT
C5 ATATAGCTTTGGCATCGGCGGCGATGGCATGATCTACGCAGGCAGGGGAT
C6 CTATAGCTTCGGCATCGGCGGCGATGGCATGATCTACACCGGAAGGGGAT
******** *********************** ***.*.**.*******
C1 TCAATGTCATCGGAGCTCATGCACCCAAGTACAATGACAAGAGCGTGGGC
C2 TCAATGTCATCGGAGCTCATGCACCCAAGTACAATGACAAGAGCGTGGGC
C3 TCAATGTCATCGGAGCTCATGCACCGAAGTACAATGACAAGAGCGTGGGC
C4 TCAATGTCGTCGGAGCTCATGCGCCGAAGTACAATGACAAGAGCGTGGGC
C5 TCAATGTCATCGGAGCTCATGCGCCGAAGTACAATGACAGGAGCGTGGGC
C6 TCAACGTTATCGGAGCTCATGCACCCAAGTACAATGACAAGAGCGTGGGC
**** ** .*************.** *************.**********
C1 ATTGTGCTGATCGGAGATTGGAGAACCGAACTGCCGCCCAAGCAGATGCT
C2 ATCGTGCTGATCGGAGATTGGAGAACCGAACTGCCGCCCAAGCAGATGCT
C3 ATTGTGCTGATCGGAGATTGGAGAACCGAACTGCCGCCCAAGCAGATGCT
C4 ATCGTGCTGATCGGAGATTGGAGAACTGAACTGCCGCCCAAGCAGATGCT
C5 ATCGTGCTGATCGGAGATTGGAGAACTGAACTTCCGCCCAAGCAGATGCT
C6 ATCGTGCTGATCGGAGATTGGAGAACTGAACTGCCGCCCAAACAGATGCT
** *********************** ***** ********.********
C1 GGATGCGGCCAAGAACCTGATCGCCTTTGGCGTTTTCAAGGGCTACATTG
C2 GGATGCGGCCAAGAACCTGATCGCCTTCGGAGTTTTCAAGGGCTACATTG
C3 GGATGCGGCCAAGAACCTGATCGCCTTCGGCGTTTTCAAGGGCTACATTG
C4 GGATGCGGCCAGGAACCTGATCTCCTTCGGGGTGTTCAAGGGCTACATTG
C5 GGATGCGGCCAAGGACCTGATCGCCTTCGGGGTGTTCAAGGGCTACATTG
C6 GGACGCGGCCAAAAACCTGATCGCCTTCGGCGTGTTCAAGGGCTACATTG
*** *******...******** **** ** ** ****************
C1 ACCCTGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
C2 ACCCCGCCTACAAACTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
C3 ACCCCGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
C4 ACCCCGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
C5 ACCCCGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
C6 ACCCCGCATACAAGCTGCTGGGCCACCGACAGGTTCGTGACACCGAGTGT
**** **.*****.******************** ** ** *********
C1 CCTGGCGGCCGCCTGTTCGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
C2 CCTGGAGGCCGCCTCTTCGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
C3 CCTGGCGGCCGCCTCTTCGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
C4 CCTGGAGGCCGCCTGTTTGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
C5 CCTGGGGGCCGCCTGTTTGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
C6 CCCGGAGGCAGGCTGTTCGCGGAGATCTCCGGCTGGCCGCACTTTACCCA
** ** ***.* ** ** ** *********.*******************
C1 CATAAACGACACCGAAGGCGTC---AGCAGCACCACGGCGCCCGTCGTGC
C2 CCTAAACGCCAGCGACGGCGAG---AGCAGCACTGCGGCGCCCGTCGTGC
C3 CCTAAACGCCACCGAAGGCGTG---AGCAGCACTGCGGCGCCCGTCGTGC
C4 CCTAAGCGAAACCGAAGGCGTAGTTAGCAGCACTGCTGCGCCCGTCGAGC
C5 CATAAACGACACCGAAGGCGTT---AGCAGTACGAAGGCGCCGGTCGAGC
C6 CCTAAACGCCACCGAAGGCAGC---------ACCCCCGTCCCCATTGAAC
*.***.**..* ***.***. ** . * ** .* *:.*
C1 CCCACGTCCATCCACAGGCGGCAGCACCA---------CAAAAGCCGCAC
C2 CCCATGTCCATGCACAGGCGGCAGCACCA---------CAAACGCCGCAC
C3 CCCATGTCCATGCACAGGCGGCAGCACCA---------CAAACGCCGCAC
C4 CCCACGTCCATCCAAAGGCGGCAACACAA---------ACGCCACTCGCC
C5 CCCACGTCCATCCACAGGCGGCAACACAA---------CAAACGCCGCCC
C6 CGCACGCACATCCCCAGGCGGCGTCCCAAACGCCACCCCAATCACCACCC
* ** * .*** *..*******. *.*.* ... ..* .*
C1 CAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
C2 CAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
C3 CAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
C4 CAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
C5 AAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
C6 CAATCGCCACCCCATGCCCCGGCAGCTGCGCCCAAGGTC-----------
.**** **.**. ***************
C1 ----------------
C2 ----------------
C3 ----------------
C4 ----------------
C5 ----------------
C6 ----------------
>C1
ATGGGCGACAAGGTGTCTGGATCCGTCTCCACTTCTGGCCCAACTTCCTT
GGCAATCCTCATGGACTCGGAGCAATTGGAGCAGCAACAGCTGGCCACAA
GTTGTGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGCGACGGTGTG
GCCACCGCCCGCCTGCTGTCCCGATCCGACTGGGGTGCCCGGCTGCCCAA
GTCCGTGGAGCACTTCCAGGGTCCCGCGCCCTACGTCATCATCCATCACT
CGTACATGCCGGCCGTGTGCTACTCCACTCCGGACTGCATGAAGAGCATG
CGGGACATGCAGGACTTCCATCAGCTGGAGCGCGGATGGAACGATATTGG
TTATAGCTTTGGCATCGGCGGCGATGGCATGATTTACACCGGCAGGGGAT
TCAATGTCATCGGAGCTCATGCACCCAAGTACAATGACAAGAGCGTGGGC
ATTGTGCTGATCGGAGATTGGAGAACCGAACTGCCGCCCAAGCAGATGCT
GGATGCGGCCAAGAACCTGATCGCCTTTGGCGTTTTCAAGGGCTACATTG
ACCCTGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
CCTGGCGGCCGCCTGTTCGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
CATAAACGACACCGAAGGCGTC---AGCAGCACCACGGCGCCCGTCGTGC
CCCACGTCCATCCACAGGCGGCAGCACCA---------CAAAAGCCGCAC
CAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
----------------
>C2
ATGGGCGACAAGGTGTCTGGATCCGTCTCCACTTCTAGCACAACTTCCTC
GGCAATCCCCATGGACTCGGAGCAATTGGAGCAGCAACAGCTGGCCACAA
GTTGTGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGCGACGGTGTG
GCCACCGCCCGCCTGCTTTCCCGATCCGACTGGGGTGCCCGGCTGCCCAA
GTCTGTGGACCACTTCCAGGGACCCGCGCCCTACGTCATCATCCACCACT
CGTACATGCCGGCCGTGTGCTACTCCACTCCGGAATGCATGAAGAGCATG
CGGGACATGCAGGACTTCCATCAGCTGGAGCGCGGATGGAACGATATTGG
TTATAGCTTTGGCATCGGCGGCGATGGCATGATCTACACCGGCAGGGGAT
TCAATGTCATCGGAGCTCATGCACCCAAGTACAATGACAAGAGCGTGGGC
ATCGTGCTGATCGGAGATTGGAGAACCGAACTGCCGCCCAAGCAGATGCT
GGATGCGGCCAAGAACCTGATCGCCTTCGGAGTTTTCAAGGGCTACATTG
ACCCCGCCTACAAACTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
CCTGGAGGCCGCCTCTTCGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
CCTAAACGCCAGCGACGGCGAG---AGCAGCACTGCGGCGCCCGTCGTGC
CCCATGTCCATGCACAGGCGGCAGCACCA---------CAAACGCCGCAC
CAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
----------------
>C3
ATGGGCGACAAGGTGTCTGGATCCGTCTCCACTTCTAGCACAACTTCCTC
GGCAATCCCCATGGACTCGGAGCAATTGGAGCAGCAACAGCTGGCCACAA
GTTGTGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGCGACGGTGTG
GCCACCGCCCGCCTGCTTTCCCGATCCGACTGGGGTGCACGGCTGCCCAA
GTCCGTGGAGCACTTCCAGGGACCAGCGCCTTACGTCATCATCCACCACT
CGTATATGCCGGCCGTGTGCTACTCAACTCCGGAATGCATGAAGAGCATG
CGGGACATGCAGGACTTTCATCAGCTGGAGCGCGGATGGAACGATATTGG
TTATAGCTTTGGCATCGGCGGCGATGGCATGATCTACACCGGCAGGGGAT
TCAATGTCATCGGAGCTCATGCACCGAAGTACAATGACAAGAGCGTGGGC
ATTGTGCTGATCGGAGATTGGAGAACCGAACTGCCGCCCAAGCAGATGCT
GGATGCGGCCAAGAACCTGATCGCCTTCGGCGTTTTCAAGGGCTACATTG
ACCCCGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
CCTGGCGGCCGCCTCTTCGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
CCTAAACGCCACCGAAGGCGTG---AGCAGCACTGCGGCGCCCGTCGTGC
CCCATGTCCATGCACAGGCGGCAGCACCA---------CAAACGCCGCAC
CAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
----------------
>C4
ATGGGCGACAAGGTGTCTGGATCCGTATCCACTTCTAGCTTAACTTCCCC
GGCAATCCTCATGGACTCGGAGCATTGGGAGCAGCAACAGCTGGCCACAA
GTTGTGGCTATAGTCAGCACATGCAGCAGGCAAATCTGGGCGATGGTGTG
GCCACCGCCCGACTGCTGTCCAGATCCGACTGGGGTGCCCGGCTGCCCAA
GTCCGTGGACCACTTTCAGGGACCCGCGCCCTACGTCATCATCCACCACT
CGTACATGCCAGGCGTGTGCTACTCCACTCCGGAGTGCATGAAGAGCATG
CGGGACATGCAGGACTTCCACCAGCTGGAGCGCGGATGGAACGATATCGG
ATATAGCTTTGGCATCGGCGGCGATGGCATGATCTACACCGGCAGGGGAT
TCAATGTCGTCGGAGCTCATGCGCCGAAGTACAATGACAAGAGCGTGGGC
ATCGTGCTGATCGGAGATTGGAGAACTGAACTGCCGCCCAAGCAGATGCT
GGATGCGGCCAGGAACCTGATCTCCTTCGGGGTGTTCAAGGGCTACATTG
ACCCCGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
CCTGGAGGCCGCCTGTTTGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
CCTAAGCGAAACCGAAGGCGTAGTTAGCAGCACTGCTGCGCCCGTCGAGC
CCCACGTCCATCCAAAGGCGGCAACACAA---------ACGCCACTCGCC
CAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
----------------
>C5
ATGGGCGACAAGGTGTCTGGATCCGTATCCACTTCTGGCACAACTTCCCC
GGCAATTCTTATGAACACAGAGCATTTGCAGCAGCAACAGCTGGCCACAA
GTTGGGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGC---------
---ACCGCCCGGCTTCTGTCCCGATCCGACTGGGGTGCCCGCCTGCCCAA
GTCCGTGGAGCACTTTCAAGGACCCGCGCCCTACGTGATCATCCACCACT
CGTACATGCCAGCCGTGTGCTACTCCACTCCGGACTGCATGAAGAGCATG
CGGGACATGCAGGACTTCCACCAGCTGGAGCGCGGTTGGAACGATATCGG
ATATAGCTTTGGCATCGGCGGCGATGGCATGATCTACGCAGGCAGGGGAT
TCAATGTCATCGGAGCTCATGCGCCGAAGTACAATGACAGGAGCGTGGGC
ATCGTGCTGATCGGAGATTGGAGAACTGAACTTCCGCCCAAGCAGATGCT
GGATGCGGCCAAGGACCTGATCGCCTTCGGGGTGTTCAAGGGCTACATTG
ACCCCGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT
CCTGGGGGCCGCCTGTTTGCCGAGATCTCCAGCTGGCCGCACTTTACCCA
CATAAACGACACCGAAGGCGTT---AGCAGTACGAAGGCGCCGGTCGAGC
CCCACGTCCATCCACAGGCGGCAACACAA---------CAAACGCCGCCC
AAATCCCCGCCA------------GCTGCGCCCAAGGTC-----------
----------------
>C6
ATGGGCGACAAAGCGTCTGGATCCGTCTCCATTCCCTCGACAAAACCCCC
AGCAATCCTCACGGACTCGGAGCATTTCGAGCAACAACAGCTGGCCACAA
CTTGTGGCTATAGCCAGCACATGCAGCATGCGAATTTGGGCGATGGAGCG
GCCACCGCTCGACTTCTGTCCCGCTCCGACTGGGGCGCCCGTCTGCCCAA
GTCCGTGGAGCACTTCGAGGGTCCCGCCCCCTACGTGATCATCCACCACT
CTTACATGCCGGCGGTGTGCTATACCACTCCCGACTGCATGAAGAGCATG
CGCGACATGCAGGACTTCCACCAGCTGGAGCGCGGTTGGAACGACATCGG
CTATAGCTTCGGCATCGGCGGCGATGGCATGATCTACACCGGAAGGGGAT
TCAACGTTATCGGAGCTCATGCACCCAAGTACAATGACAAGAGCGTGGGC
ATCGTGCTGATCGGAGATTGGAGAACTGAACTGCCGCCCAAACAGATGCT
GGACGCGGCCAAAAACCTGATCGCCTTCGGCGTGTTCAAGGGCTACATTG
ACCCCGCATACAAGCTGCTGGGCCACCGACAGGTTCGTGACACCGAGTGT
CCCGGAGGCAGGCTGTTCGCGGAGATCTCCGGCTGGCCGCACTTTACCCA
CCTAAACGCCACCGAAGGCAGC---------ACCCCCGTCCCCATTGAAC
CGCACGCACATCCCCAGGCGGCGTCCCAAACGCCACCCCAATCACCACCC
CAATCGCCACCCCATGCCCCGGCAGCTGCGCCCAAGGTC-----------
----------------
>C1
MGDKVSGSVSTSGPTSLAILMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHINDTEGVoSSTTAPVVPHVHPQAAAPoooQKPH
QSPPooooAAPKV
>C2
MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLNASDGEoSSTAAPVVPHVHAQAAAPoooQTPH
QSPPooooAAPKV
>C3
MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLNATEGVoSSTAAPVVPHVHAQAAAPoooQTPH
QSPPooooAAPKV
>C4
MGDKVSGSVSTSSLTSPAILMDSEHWEQQQLATSCGYSQHMQQANLGDGV
ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVCYSTPECMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKAATQoooTPLA
QSPPooooAAPKV
>C5
MGDKVSGSVSTSGTTSPAILMNTEHLQQQQLATSWGYSQHMQQANLGooo
oTARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAHAPKYNDRSVG
IVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISSWPHFTHINDTEGVoSSTKAPVEPHVHPQAATQoooQTPP
KSPPooooAAPKV
>C6
MGDKASGSVSIPSTKPPAILTDSEHFEQQQLATTCGYSQHMQHANLGDGA
ATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVCYTTPDCMKSM
RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
PGGRLFAEISGWPHFTHLNATEGSoooTPVPIEPHAHPQAASQTPPQSPP
QSPPHAPAAAPKV
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 816 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480081029
Setting output file names to "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1150854165
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 6872989632
Seed = 5993488
Swapseed = 1480081029
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 35 unique site patterns
Division 2 has 33 unique site patterns
Division 3 has 70 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2429.902395 -- -24.965149
Chain 2 -- -2453.408033 -- -24.965149
Chain 3 -- -2475.616655 -- -24.965149
Chain 4 -- -2455.225181 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2455.225181 -- -24.965149
Chain 2 -- -2436.902277 -- -24.965149
Chain 3 -- -2437.768580 -- -24.965149
Chain 4 -- -2427.949812 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2429.902] (-2453.408) (-2475.617) (-2455.225) * [-2455.225] (-2436.902) (-2437.769) (-2427.950)
500 -- (-2060.900) (-2057.917) [-2065.259] (-2072.599) * (-2057.383) [-2060.804] (-2067.249) (-2063.441) -- 0:33:19
1000 -- (-2052.323) [-2056.038] (-2051.144) (-2051.183) * [-2048.921] (-2049.485) (-2050.793) (-2051.661) -- 0:16:39
1500 -- [-2052.399] (-2047.263) (-2051.497) (-2040.363) * [-2042.134] (-2052.130) (-2047.747) (-2041.678) -- 0:11:05
2000 -- (-2048.884) (-2041.765) (-2037.896) [-2034.619] * [-2036.635] (-2035.328) (-2040.827) (-2042.279) -- 0:08:19
2500 -- (-2033.187) (-2040.145) (-2036.910) [-2040.348] * (-2039.600) (-2037.468) (-2034.570) [-2036.263] -- 0:06:39
3000 -- (-2036.713) (-2038.782) [-2043.162] (-2034.622) * (-2040.530) (-2037.811) (-2034.855) [-2034.105] -- 0:05:32
3500 -- (-2040.609) (-2037.552) (-2046.915) [-2035.360] * (-2039.357) [-2036.508] (-2040.146) (-2044.503) -- 0:04:44
4000 -- (-2039.888) (-2033.112) (-2034.223) [-2033.738] * [-2035.152] (-2036.430) (-2033.588) (-2036.330) -- 0:08:18
4500 -- (-2040.535) [-2037.910] (-2038.119) (-2038.361) * [-2034.931] (-2040.056) (-2036.506) (-2039.419) -- 0:07:22
5000 -- (-2037.110) (-2038.663) (-2040.026) [-2040.511] * (-2033.503) (-2039.004) [-2039.453] (-2034.908) -- 0:06:38
Average standard deviation of split frequencies: 0.062854
5500 -- (-2035.200) (-2044.377) (-2044.867) [-2039.310] * [-2032.636] (-2032.435) (-2036.797) (-2038.583) -- 0:06:01
6000 -- [-2035.454] (-2041.424) (-2035.893) (-2034.908) * [-2034.925] (-2036.107) (-2038.087) (-2045.716) -- 0:05:31
6500 -- (-2042.174) (-2036.116) [-2036.193] (-2032.390) * (-2039.542) (-2033.822) [-2031.120] (-2044.362) -- 0:05:05
7000 -- (-2038.315) (-2044.355) [-2036.496] (-2037.420) * [-2035.356] (-2042.841) (-2037.425) (-2035.289) -- 0:04:43
7500 -- [-2033.976] (-2044.166) (-2033.781) (-2043.513) * [-2037.394] (-2046.129) (-2039.486) (-2030.279) -- 0:06:37
8000 -- [-2036.139] (-2051.454) (-2038.960) (-2038.767) * (-2040.555) (-2040.497) (-2040.608) [-2032.515] -- 0:06:12
8500 -- (-2039.326) (-2044.015) [-2031.145] (-2042.963) * (-2044.934) [-2044.739] (-2037.724) (-2031.391) -- 0:05:49
9000 -- (-2035.328) [-2040.630] (-2032.591) (-2038.335) * [-2036.212] (-2041.904) (-2038.157) (-2033.355) -- 0:05:30
9500 -- (-2045.015) (-2034.472) [-2033.216] (-2037.112) * (-2039.408) [-2045.985] (-2044.569) (-2037.607) -- 0:05:12
10000 -- (-2041.184) (-2034.703) [-2041.086] (-2034.345) * (-2034.312) (-2040.535) (-2045.175) [-2034.165] -- 0:04:57
Average standard deviation of split frequencies: 0.077340
10500 -- (-2031.233) (-2036.030) [-2034.200] (-2040.536) * [-2034.323] (-2037.334) (-2042.427) (-2039.589) -- 0:04:42
11000 -- (-2041.243) [-2032.742] (-2038.576) (-2038.418) * (-2035.307) [-2037.527] (-2038.689) (-2031.995) -- 0:05:59
11500 -- (-2039.204) (-2032.516) [-2033.368] (-2036.595) * (-2040.294) [-2035.956] (-2042.529) (-2033.967) -- 0:05:43
12000 -- (-2032.711) (-2036.119) (-2041.518) [-2036.581] * (-2037.118) (-2039.252) (-2041.082) [-2035.914] -- 0:05:29
12500 -- [-2036.846] (-2041.419) (-2036.827) (-2041.516) * (-2036.609) [-2037.074] (-2040.678) (-2034.737) -- 0:05:16
13000 -- [-2037.753] (-2037.389) (-2031.630) (-2039.229) * (-2036.525) (-2036.719) [-2040.192] (-2037.142) -- 0:05:03
13500 -- (-2047.922) (-2037.823) (-2038.141) [-2039.301] * (-2041.729) (-2037.952) (-2041.502) [-2033.031] -- 0:04:52
14000 -- [-2047.315] (-2035.046) (-2039.857) (-2034.294) * (-2037.617) [-2037.377] (-2038.997) (-2032.671) -- 0:04:41
14500 -- (-2040.755) (-2035.277) (-2040.580) [-2044.027] * (-2036.631) (-2036.445) (-2033.622) [-2037.575] -- 0:05:39
15000 -- (-2033.542) [-2036.168] (-2039.284) (-2038.769) * (-2045.344) [-2037.300] (-2039.059) (-2034.840) -- 0:05:28
Average standard deviation of split frequencies: 0.044194
15500 -- (-2039.719) (-2032.924) [-2043.248] (-2031.577) * [-2035.868] (-2040.612) (-2040.520) (-2038.569) -- 0:05:17
16000 -- [-2035.927] (-2045.379) (-2040.855) (-2034.349) * (-2039.014) (-2040.028) (-2041.883) [-2038.343] -- 0:05:07
16500 -- (-2046.671) (-2046.281) [-2038.973] (-2038.836) * [-2035.133] (-2035.109) (-2038.844) (-2038.758) -- 0:04:58
17000 -- (-2037.409) (-2035.872) [-2042.206] (-2039.636) * (-2036.479) (-2033.584) (-2040.054) [-2033.465] -- 0:04:49
17500 -- (-2034.898) (-2036.838) (-2040.543) [-2035.139] * [-2031.607] (-2040.148) (-2038.817) (-2043.223) -- 0:04:40
18000 -- (-2036.084) (-2038.833) [-2044.382] (-2037.854) * (-2033.533) [-2032.875] (-2037.864) (-2045.928) -- 0:05:27
18500 -- (-2041.640) (-2039.569) (-2038.801) [-2033.446] * (-2036.540) [-2037.379] (-2035.486) (-2039.705) -- 0:05:18
19000 -- (-2036.632) (-2037.932) [-2032.828] (-2036.951) * [-2034.936] (-2041.594) (-2039.322) (-2041.332) -- 0:05:09
19500 -- (-2043.283) (-2035.929) [-2040.794] (-2034.576) * (-2036.064) (-2038.040) (-2037.370) [-2036.045] -- 0:05:01
20000 -- (-2042.365) [-2035.567] (-2043.808) (-2036.256) * (-2029.559) (-2039.392) [-2036.939] (-2038.028) -- 0:04:54
Average standard deviation of split frequencies: 0.045620
20500 -- (-2045.743) [-2038.614] (-2040.279) (-2040.518) * (-2034.540) (-2038.287) [-2036.579] (-2040.196) -- 0:04:46
21000 -- (-2042.132) [-2030.812] (-2038.354) (-2038.665) * [-2038.553] (-2039.532) (-2039.197) (-2041.936) -- 0:04:39
21500 -- (-2041.305) (-2036.274) [-2033.730] (-2033.998) * (-2034.630) [-2047.683] (-2039.568) (-2034.766) -- 0:04:33
22000 -- (-2040.246) (-2030.289) [-2030.756] (-2032.719) * [-2032.988] (-2034.722) (-2038.379) (-2040.375) -- 0:05:11
22500 -- (-2034.846) (-2043.478) [-2034.616] (-2034.825) * (-2037.781) (-2038.756) [-2038.301] (-2035.419) -- 0:05:04
23000 -- (-2041.683) [-2035.032] (-2036.863) (-2038.059) * (-2035.449) (-2038.140) [-2035.986] (-2040.605) -- 0:04:57
23500 -- (-2045.172) [-2036.315] (-2040.085) (-2036.732) * [-2039.787] (-2037.905) (-2044.002) (-2038.919) -- 0:04:50
24000 -- [-2041.534] (-2039.705) (-2036.934) (-2038.648) * (-2040.272) [-2035.988] (-2035.473) (-2040.399) -- 0:04:44
24500 -- (-2038.376) [-2037.270] (-2035.638) (-2038.561) * (-2038.839) (-2036.417) [-2031.682] (-2043.331) -- 0:04:38
25000 -- [-2035.151] (-2040.194) (-2040.361) (-2043.704) * (-2040.943) (-2040.252) [-2037.269] (-2040.284) -- 0:04:33
Average standard deviation of split frequencies: 0.045327
25500 -- [-2034.768] (-2036.250) (-2036.434) (-2038.035) * (-2038.101) (-2039.753) [-2037.054] (-2038.287) -- 0:05:05
26000 -- (-2039.939) (-2036.876) [-2032.794] (-2032.622) * (-2033.041) [-2041.057] (-2035.329) (-2044.885) -- 0:04:59
26500 -- (-2034.360) (-2042.139) (-2036.800) [-2034.444] * (-2033.275) (-2035.032) [-2044.341] (-2057.903) -- 0:04:53
27000 -- [-2034.984] (-2032.164) (-2034.890) (-2032.357) * (-2043.211) [-2034.429] (-2041.886) (-2038.504) -- 0:04:48
27500 -- (-2034.533) [-2030.840] (-2040.882) (-2042.804) * (-2046.091) [-2034.534] (-2037.536) (-2037.450) -- 0:04:42
28000 -- (-2036.292) (-2038.477) [-2031.865] (-2033.595) * (-2038.269) [-2035.763] (-2045.544) (-2040.093) -- 0:04:37
28500 -- [-2035.475] (-2041.158) (-2032.200) (-2032.624) * [-2036.279] (-2043.191) (-2039.433) (-2045.547) -- 0:04:32
29000 -- [-2034.561] (-2035.769) (-2035.966) (-2038.264) * (-2042.230) (-2038.834) [-2037.990] (-2039.564) -- 0:05:01
29500 -- (-2030.225) [-2038.260] (-2039.251) (-2035.396) * (-2038.186) (-2044.732) (-2039.369) [-2035.383] -- 0:04:56
30000 -- (-2037.639) [-2036.274] (-2042.420) (-2044.639) * [-2037.238] (-2040.058) (-2036.889) (-2042.658) -- 0:04:51
Average standard deviation of split frequencies: 0.023058
30500 -- (-2035.161) (-2040.766) (-2034.812) [-2037.113] * (-2035.569) (-2038.319) (-2041.925) [-2035.395] -- 0:04:46
31000 -- (-2032.978) (-2034.721) (-2032.697) [-2036.167] * (-2036.419) (-2033.879) (-2038.068) [-2038.724] -- 0:04:41
31500 -- (-2037.149) [-2033.922] (-2034.236) (-2048.556) * [-2036.726] (-2034.783) (-2040.794) (-2033.474) -- 0:04:36
32000 -- (-2034.218) (-2037.815) [-2036.884] (-2035.494) * (-2043.286) [-2036.221] (-2035.223) (-2032.703) -- 0:04:32
32500 -- (-2039.476) [-2037.235] (-2035.108) (-2041.058) * (-2039.421) [-2036.145] (-2038.371) (-2032.551) -- 0:04:57
33000 -- (-2040.822) (-2036.025) (-2042.028) [-2035.539] * (-2041.771) (-2043.012) (-2038.712) [-2033.919] -- 0:04:53
33500 -- (-2044.836) [-2032.627] (-2035.951) (-2042.414) * (-2036.887) (-2040.560) (-2037.503) [-2031.896] -- 0:04:48
34000 -- [-2039.647] (-2039.905) (-2042.630) (-2037.426) * (-2041.540) [-2037.753] (-2040.553) (-2036.888) -- 0:04:44
34500 -- [-2038.992] (-2033.200) (-2042.121) (-2036.478) * (-2034.845) [-2035.148] (-2041.894) (-2040.031) -- 0:04:39
35000 -- (-2037.736) [-2035.206] (-2037.955) (-2043.055) * (-2032.045) (-2039.738) [-2032.422] (-2033.133) -- 0:04:35
Average standard deviation of split frequencies: 0.013095
35500 -- (-2044.400) (-2036.362) (-2041.672) [-2034.790] * [-2032.821] (-2034.486) (-2037.313) (-2042.928) -- 0:04:31
36000 -- (-2034.441) (-2033.160) [-2036.176] (-2039.660) * [-2032.855] (-2040.499) (-2034.441) (-2035.224) -- 0:04:54
36500 -- (-2036.695) (-2034.628) (-2044.805) [-2034.523] * (-2037.315) (-2044.489) [-2033.226] (-2036.411) -- 0:04:50
37000 -- (-2040.274) (-2038.425) [-2036.827] (-2044.626) * (-2034.631) [-2037.925] (-2031.499) (-2045.435) -- 0:04:46
37500 -- (-2052.263) (-2032.939) (-2038.450) [-2039.611] * (-2038.540) (-2036.226) (-2038.441) [-2036.819] -- 0:04:42
38000 -- (-2048.453) (-2039.043) (-2050.838) [-2038.849] * (-2039.577) [-2034.186] (-2035.243) (-2041.204) -- 0:04:38
38500 -- (-2041.612) (-2037.990) (-2042.959) [-2036.744] * (-2036.047) (-2038.610) (-2041.516) [-2040.444] -- 0:04:34
39000 -- (-2040.423) (-2036.086) (-2041.999) [-2036.073] * [-2035.303] (-2034.506) (-2052.242) (-2038.466) -- 0:04:31
39500 -- (-2038.723) [-2031.553] (-2039.331) (-2037.956) * [-2033.733] (-2033.484) (-2038.136) (-2045.437) -- 0:04:27
40000 -- (-2039.097) (-2037.298) [-2041.959] (-2033.290) * (-2036.241) (-2037.071) [-2041.237] (-2040.187) -- 0:04:48
Average standard deviation of split frequencies: 0.023184
40500 -- (-2038.817) (-2037.194) [-2038.817] (-2041.246) * (-2031.692) [-2032.284] (-2036.973) (-2037.137) -- 0:04:44
41000 -- (-2032.713) (-2038.755) [-2035.963] (-2038.027) * (-2039.103) (-2037.782) (-2035.280) [-2039.761] -- 0:04:40
41500 -- [-2045.263] (-2039.488) (-2040.062) (-2035.946) * (-2041.789) [-2035.450] (-2035.444) (-2034.517) -- 0:04:37
42000 -- (-2038.851) [-2033.926] (-2035.644) (-2038.722) * (-2038.437) (-2038.957) [-2037.239] (-2042.911) -- 0:04:33
42500 -- (-2036.459) (-2043.887) (-2041.290) [-2037.121] * (-2036.414) (-2044.873) [-2037.359] (-2032.895) -- 0:04:30
43000 -- (-2044.300) (-2035.446) (-2040.077) [-2038.347] * [-2038.333] (-2035.685) (-2048.074) (-2039.262) -- 0:04:27
43500 -- (-2042.214) (-2038.414) [-2033.243] (-2041.671) * (-2035.528) [-2038.188] (-2036.355) (-2037.295) -- 0:04:45
44000 -- (-2037.928) (-2037.581) (-2039.636) [-2042.432] * [-2033.947] (-2034.220) (-2033.188) (-2035.833) -- 0:04:42
44500 -- (-2040.351) (-2040.897) (-2040.110) [-2038.569] * (-2041.453) (-2036.807) (-2039.825) [-2033.969] -- 0:04:39
45000 -- (-2038.832) (-2040.100) (-2035.273) [-2034.829] * (-2038.809) (-2046.994) [-2038.335] (-2032.526) -- 0:04:35
Average standard deviation of split frequencies: 0.007686
45500 -- (-2041.172) [-2040.799] (-2041.599) (-2036.336) * (-2035.315) (-2034.203) [-2034.873] (-2033.309) -- 0:04:32
46000 -- (-2040.016) [-2034.913] (-2047.249) (-2043.544) * (-2036.431) (-2035.470) (-2034.085) [-2042.958] -- 0:04:29
46500 -- (-2040.337) [-2036.842] (-2045.469) (-2031.974) * [-2035.053] (-2041.403) (-2042.150) (-2037.886) -- 0:04:26
47000 -- (-2040.559) [-2038.357] (-2037.199) (-2033.071) * [-2035.854] (-2045.368) (-2036.517) (-2047.034) -- 0:04:43
47500 -- (-2039.602) (-2036.623) (-2038.767) [-2036.292] * (-2040.039) (-2043.546) (-2044.304) [-2040.022] -- 0:04:40
48000 -- (-2036.215) (-2036.505) (-2037.294) [-2032.276] * (-2038.315) (-2045.002) (-2046.806) [-2038.511] -- 0:04:37
48500 -- (-2042.599) [-2029.990] (-2037.360) (-2037.770) * [-2037.917] (-2034.251) (-2035.656) (-2033.715) -- 0:04:34
49000 -- (-2040.289) (-2036.063) (-2035.474) [-2037.459] * (-2038.775) [-2041.707] (-2037.483) (-2033.577) -- 0:04:31
49500 -- [-2034.049] (-2035.670) (-2035.727) (-2035.770) * (-2036.156) [-2047.762] (-2032.998) (-2034.857) -- 0:04:28
50000 -- (-2042.470) [-2036.972] (-2039.433) (-2034.770) * (-2035.584) (-2049.307) (-2036.937) [-2042.103] -- 0:04:26
Average standard deviation of split frequencies: 0.002326
50500 -- (-2034.077) (-2037.667) (-2037.749) [-2034.720] * (-2036.979) [-2039.637] (-2031.662) (-2039.273) -- 0:04:42
51000 -- (-2034.908) (-2041.514) [-2040.993] (-2038.953) * (-2032.744) (-2040.649) (-2033.665) [-2038.117] -- 0:04:39
51500 -- (-2044.339) (-2039.419) (-2040.343) [-2033.998] * [-2036.122] (-2034.387) (-2034.205) (-2036.434) -- 0:04:36
52000 -- (-2036.056) [-2041.698] (-2046.077) (-2034.577) * (-2048.356) (-2047.980) [-2033.220] (-2037.777) -- 0:04:33
52500 -- (-2036.768) (-2031.709) (-2039.540) [-2037.369] * (-2043.942) (-2040.607) (-2041.892) [-2033.589] -- 0:04:30
53000 -- (-2037.635) (-2032.990) (-2040.834) [-2033.836] * (-2037.781) (-2033.832) [-2034.311] (-2045.806) -- 0:04:28
53500 -- [-2039.653] (-2033.150) (-2041.811) (-2035.860) * (-2040.244) (-2031.783) (-2034.710) [-2039.673] -- 0:04:25
54000 -- (-2033.809) (-2031.770) (-2041.167) [-2032.917] * [-2037.187] (-2031.443) (-2034.039) (-2041.092) -- 0:04:22
54500 -- (-2040.844) [-2039.148] (-2039.311) (-2036.166) * (-2040.881) (-2034.959) [-2035.414] (-2037.189) -- 0:04:37
55000 -- [-2042.827] (-2035.748) (-2038.924) (-2039.051) * [-2036.072] (-2034.659) (-2037.261) (-2036.653) -- 0:04:34
Average standard deviation of split frequencies: 0.008418
55500 -- (-2038.453) (-2034.746) (-2030.428) [-2040.361] * (-2040.253) [-2030.024] (-2039.600) (-2032.831) -- 0:04:32
56000 -- (-2038.157) (-2041.963) (-2037.322) [-2035.885] * [-2039.355] (-2044.695) (-2034.219) (-2035.802) -- 0:04:29
56500 -- (-2037.842) (-2048.050) [-2037.720] (-2035.332) * (-2037.904) (-2047.615) [-2033.429] (-2033.096) -- 0:04:27
57000 -- (-2035.925) (-2038.831) [-2035.151] (-2038.529) * (-2042.300) [-2041.394] (-2037.319) (-2035.578) -- 0:04:24
57500 -- [-2033.246] (-2042.692) (-2038.310) (-2035.068) * (-2041.507) [-2033.021] (-2038.827) (-2036.782) -- 0:04:22
58000 -- (-2036.374) (-2038.202) (-2033.736) [-2039.533] * (-2038.923) (-2032.317) (-2047.201) [-2031.265] -- 0:04:36
58500 -- [-2039.956] (-2035.857) (-2035.949) (-2034.395) * (-2043.702) (-2037.119) (-2040.476) [-2036.069] -- 0:04:33
59000 -- (-2036.825) [-2036.376] (-2040.772) (-2037.552) * (-2041.716) [-2029.491] (-2039.031) (-2038.878) -- 0:04:31
59500 -- (-2037.325) (-2033.181) (-2037.736) [-2035.789] * (-2037.067) (-2038.881) (-2047.164) [-2037.216] -- 0:04:28
60000 -- (-2036.363) (-2036.354) (-2043.004) [-2041.515] * (-2038.362) [-2035.389] (-2049.872) (-2039.413) -- 0:04:26
Average standard deviation of split frequencies: 0.001943
60500 -- [-2046.011] (-2047.184) (-2038.701) (-2037.418) * (-2039.033) [-2034.961] (-2048.558) (-2039.961) -- 0:04:23
61000 -- (-2045.022) (-2039.915) (-2044.294) [-2043.560] * (-2041.374) (-2036.720) (-2037.403) [-2042.178] -- 0:04:21
61500 -- (-2039.942) (-2038.057) (-2037.871) [-2034.754] * (-2042.772) (-2035.176) [-2045.165] (-2040.475) -- 0:04:34
62000 -- (-2033.317) (-2036.330) (-2039.518) [-2032.363] * [-2036.927] (-2046.213) (-2033.786) (-2038.083) -- 0:04:32
62500 -- [-2029.756] (-2037.145) (-2043.185) (-2042.590) * (-2033.568) (-2030.828) (-2042.183) [-2040.176] -- 0:04:30
63000 -- [-2031.480] (-2033.320) (-2035.890) (-2036.418) * (-2037.464) (-2033.752) (-2037.790) [-2033.806] -- 0:04:27
63500 -- (-2034.406) (-2039.139) (-2036.887) [-2041.122] * (-2039.137) (-2039.133) (-2034.493) [-2035.078] -- 0:04:25
64000 -- [-2033.485] (-2036.077) (-2039.100) (-2038.095) * (-2033.969) (-2035.053) (-2035.741) [-2035.595] -- 0:04:23
64500 -- (-2037.852) [-2045.866] (-2039.572) (-2041.566) * (-2043.820) (-2039.729) [-2040.999] (-2036.586) -- 0:04:21
65000 -- (-2034.885) [-2036.852] (-2035.359) (-2035.169) * (-2037.687) (-2046.128) [-2039.128] (-2039.296) -- 0:04:33
Average standard deviation of split frequencies: 0.007142
65500 -- (-2032.967) (-2037.108) [-2038.397] (-2039.507) * (-2041.289) [-2043.430] (-2042.216) (-2033.303) -- 0:04:31
66000 -- [-2035.938] (-2040.102) (-2044.455) (-2038.134) * [-2032.586] (-2042.780) (-2048.004) (-2036.892) -- 0:04:28
66500 -- [-2035.693] (-2035.448) (-2034.594) (-2043.692) * (-2034.166) (-2037.501) (-2040.751) [-2038.391] -- 0:04:26
67000 -- (-2043.030) (-2038.214) [-2037.477] (-2037.481) * (-2035.726) (-2039.546) (-2038.958) [-2037.540] -- 0:04:24
67500 -- (-2039.394) (-2037.206) [-2032.100] (-2036.951) * (-2032.005) [-2034.261] (-2036.551) (-2033.626) -- 0:04:22
68000 -- (-2036.145) (-2042.121) [-2034.732] (-2040.460) * (-2041.453) (-2036.982) [-2038.884] (-2038.818) -- 0:04:20
68500 -- (-2035.646) (-2042.875) (-2041.032) [-2044.750] * [-2032.636] (-2036.832) (-2042.340) (-2036.402) -- 0:04:18
69000 -- [-2033.522] (-2034.541) (-2032.063) (-2036.843) * [-2031.618] (-2035.061) (-2045.826) (-2033.100) -- 0:04:29
69500 -- (-2030.930) [-2034.126] (-2036.737) (-2036.131) * (-2041.709) (-2030.936) (-2037.162) [-2033.548] -- 0:04:27
70000 -- (-2037.439) (-2036.796) (-2042.137) [-2033.871] * (-2034.142) (-2041.375) [-2036.683] (-2036.827) -- 0:04:25
Average standard deviation of split frequencies: 0.005003
70500 -- [-2040.444] (-2037.749) (-2042.957) (-2034.265) * (-2038.027) (-2041.096) [-2036.146] (-2040.764) -- 0:04:23
71000 -- (-2043.791) [-2041.063] (-2037.349) (-2039.499) * (-2034.488) (-2043.047) [-2034.004] (-2040.537) -- 0:04:21
71500 -- (-2038.129) (-2049.287) [-2033.613] (-2035.352) * (-2035.728) (-2037.723) [-2037.489] (-2046.672) -- 0:04:19
72000 -- (-2034.791) [-2043.020] (-2030.885) (-2043.660) * (-2036.001) (-2041.474) [-2034.205] (-2040.349) -- 0:04:17
72500 -- (-2043.918) [-2040.393] (-2039.317) (-2033.422) * (-2041.925) (-2039.551) [-2033.068] (-2037.895) -- 0:04:28
73000 -- (-2041.109) (-2040.244) (-2038.195) [-2032.551] * (-2048.625) (-2034.828) (-2032.877) [-2039.031] -- 0:04:26
73500 -- (-2038.702) [-2037.096] (-2036.060) (-2040.655) * (-2040.752) (-2038.515) (-2036.094) [-2037.392] -- 0:04:24
74000 -- (-2048.637) [-2035.076] (-2036.719) (-2034.692) * (-2043.655) (-2047.018) (-2041.465) [-2033.202] -- 0:04:22
74500 -- (-2037.939) (-2032.307) [-2039.057] (-2032.688) * (-2034.310) (-2045.625) (-2034.151) [-2038.230] -- 0:04:20
75000 -- (-2038.836) (-2039.535) [-2036.609] (-2038.481) * (-2037.697) (-2034.733) (-2035.525) [-2030.725] -- 0:04:19
Average standard deviation of split frequencies: 0.003101
75500 -- (-2035.178) [-2034.607] (-2041.123) (-2041.790) * (-2037.255) [-2032.516] (-2037.950) (-2034.498) -- 0:04:17
76000 -- [-2035.195] (-2037.527) (-2041.439) (-2039.993) * (-2037.851) [-2038.005] (-2041.356) (-2033.071) -- 0:04:27
76500 -- [-2034.580] (-2034.394) (-2039.591) (-2038.726) * (-2037.602) [-2033.684] (-2041.779) (-2033.696) -- 0:04:25
77000 -- (-2040.056) [-2034.527] (-2051.028) (-2039.008) * [-2037.800] (-2034.422) (-2038.004) (-2044.950) -- 0:04:23
77500 -- [-2040.266] (-2037.390) (-2047.241) (-2042.537) * (-2045.115) [-2034.493] (-2040.193) (-2040.475) -- 0:04:21
78000 -- (-2036.205) [-2040.329] (-2041.870) (-2041.875) * (-2039.167) (-2043.864) (-2038.854) [-2038.772] -- 0:04:20
78500 -- [-2033.479] (-2046.320) (-2041.977) (-2034.265) * (-2035.260) (-2038.851) (-2043.910) [-2036.885] -- 0:04:18
79000 -- (-2031.954) [-2042.104] (-2047.292) (-2036.059) * (-2034.155) (-2039.191) (-2037.015) [-2039.995] -- 0:04:16
79500 -- (-2034.994) (-2043.025) [-2041.323] (-2037.744) * (-2036.361) [-2034.373] (-2036.817) (-2038.795) -- 0:04:26
80000 -- (-2044.397) (-2043.500) (-2039.707) [-2038.373] * [-2034.764] (-2040.987) (-2039.304) (-2033.782) -- 0:04:24
Average standard deviation of split frequencies: 0.007305
80500 -- (-2038.719) (-2040.827) (-2037.615) [-2035.960] * [-2040.846] (-2040.416) (-2050.074) (-2033.518) -- 0:04:22
81000 -- (-2037.314) (-2042.275) (-2037.017) [-2039.231] * [-2033.727] (-2046.410) (-2042.376) (-2037.933) -- 0:04:20
81500 -- [-2041.724] (-2039.846) (-2036.533) (-2032.712) * (-2039.522) (-2040.156) [-2039.590] (-2043.570) -- 0:04:19
82000 -- (-2041.153) (-2033.152) [-2038.690] (-2036.024) * [-2040.469] (-2040.397) (-2041.537) (-2042.953) -- 0:04:17
82500 -- (-2038.563) (-2039.042) (-2040.207) [-2034.099] * (-2038.340) (-2044.451) [-2041.416] (-2052.092) -- 0:04:15
83000 -- (-2032.280) [-2035.471] (-2048.890) (-2042.153) * (-2040.025) (-2043.102) (-2037.664) [-2040.229] -- 0:04:14
83500 -- (-2038.947) (-2036.156) [-2038.782] (-2034.382) * (-2043.068) (-2043.517) (-2050.397) [-2042.997] -- 0:04:23
84000 -- (-2043.295) [-2033.926] (-2038.362) (-2035.345) * (-2041.315) [-2044.370] (-2047.067) (-2039.126) -- 0:04:21
84500 -- (-2036.543) (-2047.395) (-2034.777) [-2034.858] * (-2033.665) [-2046.143] (-2039.297) (-2039.227) -- 0:04:20
85000 -- (-2045.358) (-2039.044) (-2035.509) [-2037.202] * (-2040.135) [-2039.092] (-2039.329) (-2039.398) -- 0:04:18
Average standard deviation of split frequencies: 0.001370
85500 -- [-2033.857] (-2035.793) (-2045.783) (-2044.934) * (-2037.554) (-2048.785) (-2037.968) [-2039.194] -- 0:04:16
86000 -- (-2036.863) (-2037.053) (-2037.043) [-2039.875] * [-2039.303] (-2034.151) (-2034.076) (-2034.133) -- 0:04:15
86500 -- (-2037.160) (-2033.511) [-2035.321] (-2036.223) * (-2031.045) (-2037.373) (-2036.271) [-2036.039] -- 0:04:13
87000 -- (-2035.703) (-2035.651) (-2036.455) [-2032.375] * (-2037.359) (-2040.135) [-2036.131] (-2034.469) -- 0:04:22
87500 -- (-2037.743) (-2038.076) [-2035.828] (-2031.330) * [-2034.557] (-2036.368) (-2039.159) (-2036.762) -- 0:04:20
88000 -- (-2039.657) (-2036.015) (-2038.462) [-2031.153] * (-2034.983) (-2039.304) (-2034.268) [-2031.669] -- 0:04:19
88500 -- (-2032.259) (-2039.775) [-2036.575] (-2032.398) * (-2036.888) [-2035.034] (-2037.350) (-2039.186) -- 0:04:17
89000 -- [-2033.524] (-2040.128) (-2041.569) (-2037.428) * (-2038.100) [-2036.471] (-2037.159) (-2035.055) -- 0:04:15
89500 -- [-2035.639] (-2036.987) (-2041.237) (-2038.919) * [-2040.492] (-2038.088) (-2037.384) (-2038.413) -- 0:04:14
90000 -- (-2043.106) [-2038.407] (-2038.873) (-2036.664) * (-2041.871) (-2043.957) (-2041.405) [-2037.729] -- 0:04:12
Average standard deviation of split frequencies: 0.001300
90500 -- (-2049.802) (-2038.194) (-2040.080) [-2037.075] * (-2038.372) [-2036.173] (-2036.503) (-2035.026) -- 0:04:21
91000 -- (-2042.991) [-2035.099] (-2035.176) (-2042.718) * (-2047.893) (-2036.993) (-2036.435) [-2035.637] -- 0:04:19
91500 -- (-2038.844) (-2036.701) [-2034.990] (-2042.733) * [-2042.990] (-2035.548) (-2037.477) (-2042.819) -- 0:04:18
92000 -- (-2042.255) (-2037.498) (-2040.325) [-2033.114] * (-2038.681) [-2035.355] (-2031.318) (-2034.551) -- 0:04:16
92500 -- (-2036.750) [-2040.379] (-2039.221) (-2040.485) * (-2034.032) (-2035.932) [-2032.792] (-2042.190) -- 0:04:15
93000 -- (-2042.409) (-2034.456) [-2033.242] (-2038.976) * (-2040.969) (-2038.741) (-2036.445) [-2038.457] -- 0:04:13
93500 -- (-2039.955) [-2036.298] (-2038.396) (-2037.880) * [-2031.901] (-2038.326) (-2035.083) (-2042.733) -- 0:04:12
94000 -- (-2040.610) (-2036.820) [-2037.426] (-2035.684) * (-2041.470) [-2040.243] (-2039.367) (-2041.492) -- 0:04:20
94500 -- (-2039.397) (-2041.993) (-2037.540) [-2037.416] * (-2042.837) (-2046.435) (-2036.249) [-2035.040] -- 0:04:18
95000 -- [-2039.598] (-2042.290) (-2040.084) (-2045.458) * (-2042.919) (-2036.857) (-2038.526) [-2036.947] -- 0:04:17
Average standard deviation of split frequencies: 0.001228
95500 -- [-2034.002] (-2033.324) (-2037.393) (-2041.394) * [-2041.771] (-2040.050) (-2042.853) (-2038.733) -- 0:04:15
96000 -- (-2036.439) [-2034.944] (-2043.451) (-2040.089) * [-2034.716] (-2035.198) (-2037.264) (-2041.098) -- 0:04:14
96500 -- [-2042.231] (-2034.953) (-2039.552) (-2036.194) * (-2035.357) (-2035.524) (-2035.446) [-2036.870] -- 0:04:12
97000 -- (-2036.931) (-2034.455) (-2044.768) [-2037.836] * (-2037.216) (-2042.277) [-2031.766] (-2042.501) -- 0:04:11
97500 -- [-2037.132] (-2042.821) (-2043.264) (-2037.483) * (-2037.031) [-2037.972] (-2039.936) (-2043.133) -- 0:04:19
98000 -- (-2040.013) [-2040.171] (-2036.262) (-2035.701) * (-2031.854) (-2041.851) [-2036.263] (-2045.866) -- 0:04:17
98500 -- (-2042.788) [-2035.392] (-2049.657) (-2037.100) * (-2033.969) (-2039.917) (-2037.780) [-2045.952] -- 0:04:16
99000 -- (-2039.020) [-2033.100] (-2041.162) (-2039.613) * (-2035.452) (-2034.109) (-2037.747) [-2043.981] -- 0:04:14
99500 -- (-2037.262) [-2037.873] (-2032.855) (-2036.117) * (-2036.102) [-2034.520] (-2044.573) (-2035.200) -- 0:04:13
100000 -- [-2040.366] (-2039.625) (-2035.969) (-2037.143) * [-2029.946] (-2037.360) (-2035.657) (-2043.969) -- 0:04:11
Average standard deviation of split frequencies: 0.001171
100500 -- (-2039.390) (-2034.950) (-2035.175) [-2040.409] * (-2032.208) [-2031.333] (-2033.537) (-2038.469) -- 0:04:10
101000 -- (-2033.109) [-2036.076] (-2038.579) (-2037.342) * [-2035.031] (-2032.081) (-2032.233) (-2037.018) -- 0:04:09
101500 -- (-2047.626) [-2036.123] (-2039.237) (-2033.652) * (-2033.425) [-2035.960] (-2038.638) (-2040.778) -- 0:04:16
102000 -- (-2038.832) (-2044.044) (-2038.765) [-2039.228] * (-2041.889) (-2039.129) (-2037.101) [-2035.167] -- 0:04:15
102500 -- (-2039.939) (-2047.503) (-2041.827) [-2032.505] * (-2040.953) [-2037.404] (-2037.011) (-2037.062) -- 0:04:13
103000 -- (-2039.931) (-2046.035) (-2046.835) [-2034.800] * [-2032.304] (-2036.750) (-2033.095) (-2045.664) -- 0:04:12
103500 -- (-2045.085) [-2042.583] (-2037.514) (-2039.501) * (-2039.483) (-2037.116) [-2033.381] (-2043.087) -- 0:04:11
104000 -- (-2049.133) (-2056.548) [-2038.698] (-2041.830) * (-2044.918) [-2037.636] (-2035.590) (-2040.405) -- 0:04:09
104500 -- (-2036.374) (-2045.263) [-2034.129] (-2035.165) * [-2037.178] (-2036.332) (-2042.115) (-2037.830) -- 0:04:08
105000 -- (-2036.162) (-2043.141) (-2049.782) [-2034.357] * (-2037.517) (-2039.110) (-2032.392) [-2035.401] -- 0:04:15
Average standard deviation of split frequencies: 0.005559
105500 -- (-2039.463) (-2044.815) (-2036.478) [-2037.166] * (-2043.472) (-2043.726) [-2032.884] (-2041.310) -- 0:04:14
106000 -- (-2038.396) (-2047.586) (-2037.911) [-2034.060] * [-2037.886] (-2038.062) (-2034.334) (-2034.689) -- 0:04:13
106500 -- (-2036.676) (-2038.510) (-2036.711) [-2038.444] * [-2039.057] (-2035.287) (-2036.624) (-2039.893) -- 0:04:11
107000 -- [-2038.246] (-2037.858) (-2035.012) (-2040.432) * [-2034.810] (-2038.377) (-2039.460) (-2040.440) -- 0:04:10
107500 -- (-2034.860) [-2038.069] (-2039.529) (-2038.775) * [-2040.491] (-2038.809) (-2035.094) (-2040.681) -- 0:04:09
108000 -- (-2037.569) (-2034.137) [-2043.795] (-2037.141) * (-2043.211) (-2034.923) [-2035.690] (-2043.179) -- 0:04:07
108500 -- (-2032.489) (-2037.771) (-2032.680) [-2033.782] * (-2032.442) [-2036.827] (-2035.202) (-2051.912) -- 0:04:14
109000 -- [-2039.227] (-2037.917) (-2036.187) (-2035.157) * (-2040.541) (-2038.359) (-2038.872) [-2041.107] -- 0:04:13
109500 -- (-2044.650) [-2035.967] (-2035.243) (-2036.323) * [-2034.137] (-2045.448) (-2040.664) (-2040.080) -- 0:04:12
110000 -- (-2045.135) [-2041.775] (-2033.808) (-2038.704) * (-2033.919) (-2039.390) (-2039.780) [-2038.531] -- 0:04:10
Average standard deviation of split frequencies: 0.004260
110500 -- (-2036.696) (-2041.780) (-2032.406) [-2032.704] * [-2034.258] (-2045.296) (-2038.476) (-2036.426) -- 0:04:09
111000 -- (-2038.173) (-2042.611) (-2035.720) [-2035.853] * (-2040.643) (-2048.565) (-2041.105) [-2035.976] -- 0:04:08
111500 -- [-2035.768] (-2048.656) (-2041.187) (-2036.428) * (-2040.080) (-2039.026) [-2031.421] (-2041.949) -- 0:04:07
112000 -- (-2039.453) (-2051.118) (-2046.327) [-2035.126] * (-2037.908) (-2034.909) [-2034.756] (-2034.884) -- 0:04:13
112500 -- (-2043.641) (-2042.634) [-2040.618] (-2035.077) * (-2042.937) (-2037.491) (-2032.398) [-2037.578] -- 0:04:12
113000 -- (-2035.843) (-2042.845) (-2045.000) [-2033.899] * (-2039.949) (-2033.663) [-2030.784] (-2038.938) -- 0:04:11
113500 -- (-2057.128) [-2033.875] (-2036.930) (-2040.276) * (-2038.358) (-2036.461) [-2031.249] (-2035.608) -- 0:04:09
114000 -- (-2036.845) (-2038.910) (-2042.179) [-2032.537] * [-2035.584] (-2036.364) (-2038.121) (-2036.264) -- 0:04:08
114500 -- (-2035.987) (-2034.104) (-2038.576) [-2036.254] * (-2031.599) (-2044.414) (-2036.311) [-2034.841] -- 0:04:07
115000 -- [-2033.607] (-2032.290) (-2034.867) (-2038.653) * (-2035.005) [-2038.372] (-2036.960) (-2039.431) -- 0:04:06
Average standard deviation of split frequencies: 0.002032
115500 -- (-2041.013) (-2038.464) (-2042.545) [-2036.814] * [-2032.114] (-2038.114) (-2035.846) (-2034.810) -- 0:04:05
116000 -- (-2036.094) (-2037.011) (-2046.825) [-2036.606] * (-2037.643) (-2034.445) (-2036.313) [-2035.128] -- 0:04:11
116500 -- (-2036.900) [-2036.906] (-2039.188) (-2041.534) * (-2034.947) (-2035.543) (-2034.852) [-2037.636] -- 0:04:10
117000 -- [-2038.045] (-2034.663) (-2035.686) (-2031.065) * (-2034.769) (-2037.099) (-2043.628) [-2033.958] -- 0:04:09
117500 -- (-2040.349) (-2044.820) [-2034.425] (-2034.298) * [-2030.861] (-2035.105) (-2032.769) (-2039.177) -- 0:04:07
118000 -- (-2038.994) (-2052.186) (-2046.713) [-2033.635] * (-2036.500) [-2042.735] (-2032.065) (-2033.991) -- 0:04:06
118500 -- [-2038.827] (-2045.986) (-2041.435) (-2031.900) * [-2029.743] (-2036.769) (-2035.531) (-2038.154) -- 0:04:05
119000 -- (-2035.299) (-2040.719) [-2040.989] (-2035.202) * (-2034.993) (-2047.572) [-2031.036] (-2039.657) -- 0:04:04
119500 -- (-2036.098) (-2040.643) (-2035.408) [-2039.148] * (-2036.715) (-2042.073) [-2031.725] (-2034.403) -- 0:04:10
120000 -- (-2033.716) (-2041.503) [-2038.624] (-2037.384) * (-2036.744) (-2035.962) (-2032.523) [-2036.142] -- 0:04:09
Average standard deviation of split frequencies: 0.004883
120500 -- [-2038.986] (-2036.832) (-2037.382) (-2034.821) * (-2032.777) (-2043.334) [-2038.031] (-2039.822) -- 0:04:08
121000 -- (-2036.223) (-2039.603) [-2036.108] (-2038.839) * [-2032.861] (-2040.093) (-2041.122) (-2035.681) -- 0:04:06
121500 -- (-2035.158) (-2035.111) (-2035.696) [-2033.881] * (-2031.031) [-2038.236] (-2041.965) (-2046.921) -- 0:04:05
122000 -- (-2034.386) (-2036.914) (-2042.534) [-2035.455] * (-2036.444) [-2035.059] (-2035.024) (-2037.354) -- 0:04:04
122500 -- (-2036.662) [-2037.036] (-2037.752) (-2042.946) * [-2036.527] (-2039.831) (-2039.573) (-2044.214) -- 0:04:03
123000 -- (-2037.248) (-2041.441) [-2036.740] (-2041.143) * (-2036.880) [-2038.087] (-2037.440) (-2037.187) -- 0:04:09
123500 -- (-2036.994) (-2038.627) [-2041.439] (-2043.442) * (-2034.334) (-2041.300) (-2034.729) [-2035.754] -- 0:04:08
124000 -- (-2045.463) (-2041.065) [-2038.145] (-2036.218) * (-2032.518) [-2036.930] (-2037.245) (-2034.545) -- 0:04:07
124500 -- [-2034.785] (-2034.800) (-2037.812) (-2043.407) * [-2036.746] (-2041.489) (-2036.940) (-2037.730) -- 0:04:06
125000 -- [-2034.972] (-2036.444) (-2039.009) (-2047.563) * (-2036.249) (-2042.278) [-2040.348] (-2036.315) -- 0:04:04
Average standard deviation of split frequencies: 0.002806
125500 -- [-2040.832] (-2035.423) (-2045.172) (-2033.230) * (-2037.696) [-2036.286] (-2034.976) (-2035.369) -- 0:04:03
126000 -- [-2033.543] (-2033.223) (-2041.905) (-2035.897) * [-2034.467] (-2037.899) (-2031.870) (-2040.155) -- 0:04:02
126500 -- [-2035.682] (-2045.539) (-2046.678) (-2038.568) * (-2040.200) [-2033.723] (-2041.023) (-2041.999) -- 0:04:01
127000 -- (-2034.189) [-2035.054] (-2045.856) (-2035.436) * (-2037.056) (-2038.538) (-2035.136) [-2039.409] -- 0:04:07
127500 -- (-2041.254) [-2038.505] (-2047.554) (-2037.785) * [-2035.741] (-2041.417) (-2044.995) (-2049.543) -- 0:04:06
128000 -- (-2040.251) (-2040.549) (-2040.952) [-2035.348] * (-2045.398) [-2035.963] (-2036.239) (-2045.284) -- 0:04:05
128500 -- (-2035.355) [-2047.777] (-2037.370) (-2034.809) * (-2042.944) [-2037.262] (-2034.481) (-2036.214) -- 0:04:04
129000 -- [-2033.838] (-2044.038) (-2038.827) (-2039.546) * (-2043.988) (-2034.829) [-2040.037] (-2036.223) -- 0:04:03
129500 -- (-2039.051) [-2035.952] (-2038.517) (-2041.127) * (-2038.215) (-2037.759) [-2033.804] (-2033.881) -- 0:04:01
130000 -- (-2040.517) (-2033.531) (-2035.864) [-2037.603] * [-2042.960] (-2037.636) (-2038.339) (-2037.297) -- 0:04:00
Average standard deviation of split frequencies: 0.007215
130500 -- (-2040.321) [-2032.812] (-2041.401) (-2034.084) * (-2039.510) (-2041.324) [-2039.290] (-2039.500) -- 0:04:06
131000 -- [-2043.126] (-2036.585) (-2043.023) (-2033.824) * (-2038.224) (-2043.459) (-2029.693) [-2036.206] -- 0:04:05
131500 -- (-2036.873) (-2039.438) (-2044.066) [-2037.219] * (-2038.834) (-2036.023) [-2031.477] (-2045.625) -- 0:04:04
132000 -- (-2032.488) (-2038.694) (-2041.407) [-2031.779] * (-2032.815) (-2035.457) [-2037.799] (-2035.182) -- 0:04:03
132500 -- (-2036.674) (-2034.125) [-2044.650] (-2034.322) * (-2036.111) [-2044.106] (-2037.566) (-2039.759) -- 0:04:02
133000 -- [-2036.770] (-2038.142) (-2040.476) (-2038.431) * [-2032.247] (-2040.526) (-2037.895) (-2038.844) -- 0:04:01
133500 -- (-2043.857) [-2034.637] (-2046.059) (-2043.852) * [-2038.257] (-2044.672) (-2035.031) (-2034.293) -- 0:04:00
134000 -- (-2036.864) [-2036.668] (-2039.920) (-2035.559) * (-2037.431) [-2041.687] (-2036.242) (-2044.630) -- 0:04:05
134500 -- (-2037.564) (-2041.261) (-2035.635) [-2037.398] * [-2038.250] (-2036.729) (-2034.735) (-2033.140) -- 0:04:04
135000 -- (-2035.916) [-2036.647] (-2037.118) (-2036.549) * (-2037.768) (-2037.540) [-2033.479] (-2039.234) -- 0:04:03
Average standard deviation of split frequencies: 0.004333
135500 -- (-2043.366) (-2040.616) [-2036.925] (-2038.150) * (-2035.118) [-2039.885] (-2036.231) (-2036.335) -- 0:04:02
136000 -- (-2045.303) (-2043.099) (-2044.546) [-2036.063] * (-2043.344) (-2035.481) [-2040.491] (-2037.365) -- 0:04:01
136500 -- (-2049.890) [-2038.938] (-2039.039) (-2046.151) * (-2035.057) (-2042.486) (-2041.357) [-2036.045] -- 0:04:00
137000 -- (-2041.704) (-2038.044) (-2037.487) [-2036.245] * (-2032.138) (-2044.453) (-2043.712) [-2035.774] -- 0:03:59
137500 -- (-2040.695) (-2034.388) (-2038.500) [-2038.466] * [-2036.183] (-2044.236) (-2033.236) (-2031.514) -- 0:04:04
138000 -- (-2045.658) (-2033.845) [-2042.432] (-2041.340) * (-2035.470) (-2045.412) [-2036.305] (-2033.221) -- 0:04:03
138500 -- (-2049.374) [-2039.607] (-2039.715) (-2037.867) * (-2036.591) (-2042.816) [-2036.959] (-2037.693) -- 0:04:02
139000 -- (-2046.712) [-2032.726] (-2036.832) (-2044.068) * (-2037.825) [-2032.950] (-2037.012) (-2038.137) -- 0:04:01
139500 -- (-2036.638) (-2034.509) [-2035.459] (-2037.499) * (-2051.108) (-2041.614) (-2032.165) [-2037.975] -- 0:04:00
140000 -- (-2035.341) (-2031.469) [-2041.410] (-2039.976) * (-2041.903) [-2037.085] (-2032.822) (-2037.688) -- 0:03:59
Average standard deviation of split frequencies: 0.003351
140500 -- (-2048.708) (-2032.798) [-2038.840] (-2039.337) * (-2045.910) (-2041.350) (-2039.344) [-2039.692] -- 0:03:58
141000 -- (-2039.344) [-2032.322] (-2041.220) (-2044.468) * (-2044.800) (-2033.891) (-2046.119) [-2036.976] -- 0:04:03
141500 -- (-2038.849) [-2034.004] (-2041.382) (-2041.618) * (-2045.002) [-2033.535] (-2036.277) (-2041.063) -- 0:04:02
142000 -- (-2043.291) [-2038.235] (-2035.474) (-2044.292) * (-2039.279) (-2035.430) [-2034.707] (-2037.806) -- 0:04:01
142500 -- (-2051.058) (-2036.509) [-2035.222] (-2035.327) * (-2037.672) (-2038.510) (-2034.049) [-2033.794] -- 0:04:00
143000 -- (-2046.043) (-2036.917) (-2039.013) [-2036.252] * (-2034.949) (-2037.819) [-2034.435] (-2037.664) -- 0:03:59
143500 -- (-2050.378) (-2043.475) (-2035.208) [-2034.395] * (-2035.972) (-2035.986) (-2037.703) [-2033.099] -- 0:03:58
144000 -- (-2035.607) (-2043.231) (-2040.918) [-2036.392] * (-2034.721) [-2033.066] (-2041.201) (-2037.895) -- 0:03:57
144500 -- (-2036.827) [-2038.184] (-2042.604) (-2036.341) * (-2032.684) (-2034.955) [-2037.031] (-2036.798) -- 0:03:56
145000 -- (-2040.076) (-2038.747) (-2040.427) [-2036.217] * [-2034.517] (-2038.800) (-2038.987) (-2037.696) -- 0:04:01
Average standard deviation of split frequencies: 0.002422
145500 -- (-2040.581) (-2036.820) (-2038.001) [-2036.462] * (-2034.795) (-2040.754) (-2040.035) [-2033.376] -- 0:04:00
146000 -- (-2033.452) (-2048.111) (-2042.764) [-2038.482] * [-2038.062] (-2034.930) (-2040.304) (-2040.040) -- 0:03:59
146500 -- (-2033.307) (-2042.964) [-2038.552] (-2042.784) * [-2040.338] (-2033.292) (-2043.640) (-2038.797) -- 0:03:58
147000 -- (-2040.745) (-2039.829) [-2043.989] (-2038.543) * (-2039.727) (-2043.772) (-2044.204) [-2037.712] -- 0:03:57
147500 -- (-2033.072) (-2038.228) (-2040.708) [-2037.351] * (-2033.046) (-2034.876) (-2043.202) [-2031.062] -- 0:03:56
148000 -- [-2038.042] (-2036.361) (-2044.488) (-2045.756) * (-2034.433) [-2041.888] (-2035.379) (-2037.022) -- 0:03:56
148500 -- (-2037.496) [-2039.299] (-2037.950) (-2041.117) * (-2042.778) (-2040.587) (-2042.791) [-2046.765] -- 0:04:00
149000 -- (-2036.102) (-2035.604) (-2039.856) [-2037.487] * (-2042.236) (-2042.075) (-2038.655) [-2039.184] -- 0:03:59
149500 -- (-2041.318) (-2034.619) (-2039.528) [-2035.968] * (-2041.810) (-2038.447) [-2034.434] (-2035.105) -- 0:03:58
150000 -- (-2043.638) (-2034.026) [-2039.335] (-2040.726) * (-2036.894) [-2036.224] (-2034.379) (-2036.278) -- 0:03:57
Average standard deviation of split frequencies: 0.002347
150500 -- (-2042.227) (-2033.322) (-2039.158) [-2036.325] * (-2041.034) (-2031.859) (-2039.411) [-2033.353] -- 0:03:57
151000 -- (-2040.684) (-2033.120) (-2031.790) [-2033.599] * (-2040.077) (-2033.305) (-2042.082) [-2036.775] -- 0:03:56
151500 -- (-2039.494) [-2043.740] (-2031.929) (-2037.755) * (-2033.144) (-2037.413) (-2042.809) [-2036.250] -- 0:03:55
152000 -- (-2040.663) (-2036.274) (-2045.014) [-2038.876] * [-2032.924] (-2038.634) (-2034.979) (-2043.559) -- 0:03:59
152500 -- (-2036.387) [-2037.797] (-2044.053) (-2033.428) * (-2038.124) (-2037.960) (-2037.981) [-2042.418] -- 0:03:58
153000 -- (-2034.197) (-2048.044) (-2035.914) [-2036.828] * (-2050.041) [-2036.675] (-2036.943) (-2046.157) -- 0:03:58
153500 -- (-2034.087) (-2039.068) [-2035.167] (-2037.136) * [-2037.644] (-2042.920) (-2040.420) (-2041.649) -- 0:03:57
154000 -- (-2035.988) (-2037.248) [-2035.836] (-2040.908) * (-2037.318) [-2037.898] (-2038.552) (-2039.775) -- 0:03:56
154500 -- (-2039.929) (-2043.187) [-2036.059] (-2040.573) * (-2035.961) (-2050.196) (-2045.513) [-2037.141] -- 0:03:55
155000 -- (-2039.568) [-2031.999] (-2034.475) (-2041.003) * (-2040.929) (-2040.630) [-2040.139] (-2042.095) -- 0:03:54
Average standard deviation of split frequencies: 0.003777
155500 -- [-2034.133] (-2041.166) (-2035.638) (-2047.378) * (-2054.447) (-2042.453) (-2046.186) [-2042.212] -- 0:03:58
156000 -- (-2037.012) (-2035.907) (-2036.954) [-2033.933] * (-2038.962) [-2043.831] (-2047.653) (-2037.050) -- 0:03:58
156500 -- (-2037.111) (-2035.861) [-2038.884] (-2041.206) * (-2035.809) (-2047.274) (-2033.558) [-2031.524] -- 0:03:57
157000 -- (-2038.893) (-2036.390) [-2034.402] (-2040.474) * (-2036.730) (-2037.764) (-2039.001) [-2037.106] -- 0:03:56
157500 -- (-2038.075) (-2041.483) (-2036.679) [-2038.069] * (-2033.294) (-2040.594) [-2045.875] (-2037.502) -- 0:03:55
158000 -- [-2029.727] (-2036.832) (-2036.820) (-2041.605) * (-2038.742) (-2037.169) [-2037.699] (-2036.589) -- 0:03:54
158500 -- (-2034.134) (-2037.281) [-2033.340] (-2040.348) * (-2036.536) (-2035.187) [-2035.105] (-2041.968) -- 0:03:53
159000 -- [-2032.859] (-2044.547) (-2035.649) (-2038.303) * (-2038.549) (-2036.746) (-2037.799) [-2036.761] -- 0:03:58
159500 -- (-2041.943) [-2036.932] (-2046.027) (-2042.845) * (-2040.718) (-2034.972) [-2037.375] (-2033.726) -- 0:03:57
160000 -- (-2044.156) [-2037.381] (-2033.552) (-2035.874) * (-2045.016) [-2032.496] (-2038.280) (-2038.901) -- 0:03:56
Average standard deviation of split frequencies: 0.005135
160500 -- (-2034.563) [-2035.893] (-2047.036) (-2033.595) * (-2033.548) (-2034.793) [-2037.317] (-2038.955) -- 0:03:55
161000 -- (-2030.491) (-2044.564) (-2041.919) [-2039.889] * (-2037.084) (-2036.443) [-2037.435] (-2043.102) -- 0:03:54
161500 -- [-2034.477] (-2041.007) (-2038.151) (-2035.635) * (-2034.156) (-2038.121) [-2037.466] (-2040.242) -- 0:03:53
162000 -- (-2037.370) (-2038.415) (-2046.903) [-2037.647] * [-2044.678] (-2042.197) (-2038.902) (-2041.440) -- 0:03:52
162500 -- [-2040.448] (-2052.336) (-2036.431) (-2039.285) * (-2040.639) [-2040.917] (-2041.614) (-2040.426) -- 0:03:57
163000 -- (-2040.312) [-2039.342] (-2040.112) (-2035.299) * [-2032.824] (-2044.054) (-2037.808) (-2030.080) -- 0:03:56
163500 -- (-2038.434) [-2038.266] (-2038.359) (-2037.927) * [-2033.021] (-2040.325) (-2037.494) (-2036.353) -- 0:03:55
164000 -- [-2038.699] (-2038.546) (-2041.230) (-2041.122) * (-2037.811) [-2038.676] (-2037.309) (-2041.480) -- 0:03:54
164500 -- (-2041.798) (-2049.047) [-2039.642] (-2035.049) * (-2036.952) (-2039.323) (-2044.778) [-2036.771] -- 0:03:53
165000 -- (-2041.229) (-2043.598) (-2038.084) [-2035.894] * (-2031.713) (-2036.706) [-2033.776] (-2040.625) -- 0:03:52
Average standard deviation of split frequencies: 0.004970
165500 -- (-2035.924) (-2037.925) [-2040.193] (-2038.103) * (-2038.142) (-2042.307) [-2031.475] (-2039.589) -- 0:03:51
166000 -- (-2037.158) (-2040.258) [-2037.086] (-2045.424) * (-2038.518) (-2047.293) (-2037.764) [-2030.629] -- 0:03:56
166500 -- (-2035.719) (-2035.754) [-2035.180] (-2043.225) * [-2032.198] (-2044.733) (-2041.696) (-2038.072) -- 0:03:55
167000 -- (-2037.690) [-2031.315] (-2036.523) (-2037.235) * (-2036.358) [-2038.957] (-2036.712) (-2046.159) -- 0:03:54
167500 -- (-2040.546) (-2034.583) [-2038.331] (-2038.044) * [-2037.274] (-2035.462) (-2040.024) (-2038.534) -- 0:03:53
168000 -- (-2036.730) (-2042.119) [-2035.809] (-2035.134) * [-2042.351] (-2040.694) (-2036.125) (-2036.083) -- 0:03:52
168500 -- [-2033.898] (-2048.104) (-2036.859) (-2036.112) * (-2040.958) (-2037.826) [-2033.331] (-2034.945) -- 0:03:51
169000 -- [-2035.610] (-2040.452) (-2042.944) (-2032.662) * (-2035.333) (-2038.059) [-2039.582] (-2037.259) -- 0:03:51
169500 -- (-2039.534) (-2040.378) [-2037.037] (-2037.703) * (-2040.698) (-2034.783) (-2043.737) [-2038.244] -- 0:03:50
170000 -- (-2035.220) (-2031.682) (-2042.297) [-2035.203] * (-2037.700) [-2033.567] (-2032.407) (-2034.814) -- 0:03:54
Average standard deviation of split frequencies: 0.004834
170500 -- (-2033.665) (-2040.580) (-2034.512) [-2034.101] * (-2034.599) (-2040.081) (-2033.740) [-2031.887] -- 0:03:53
171000 -- (-2033.250) (-2037.128) [-2038.705] (-2037.304) * (-2037.194) [-2037.155] (-2031.180) (-2048.549) -- 0:03:52
171500 -- (-2032.965) (-2034.942) [-2032.532] (-2038.777) * (-2039.797) (-2034.783) [-2040.345] (-2040.701) -- 0:03:51
172000 -- (-2035.302) [-2035.447] (-2036.487) (-2045.004) * (-2038.941) [-2032.246] (-2038.148) (-2034.891) -- 0:03:51
172500 -- [-2033.759] (-2036.601) (-2044.703) (-2037.311) * (-2038.249) (-2040.327) [-2040.122] (-2035.338) -- 0:03:50
173000 -- [-2035.951] (-2035.665) (-2045.998) (-2035.043) * (-2035.466) (-2039.343) [-2041.694] (-2036.860) -- 0:03:49
173500 -- (-2038.967) [-2036.796] (-2039.339) (-2041.643) * (-2039.381) [-2031.414] (-2044.578) (-2036.232) -- 0:03:53
174000 -- (-2033.589) (-2038.843) (-2034.098) [-2040.675] * (-2043.073) (-2038.420) [-2042.972] (-2036.884) -- 0:03:52
174500 -- (-2033.864) [-2033.318] (-2044.147) (-2041.587) * (-2034.978) [-2036.918] (-2035.167) (-2044.146) -- 0:03:51
175000 -- [-2031.656] (-2037.754) (-2043.503) (-2041.128) * [-2045.496] (-2039.824) (-2036.955) (-2035.916) -- 0:03:50
Average standard deviation of split frequencies: 0.004687
175500 -- [-2040.487] (-2039.297) (-2040.541) (-2041.012) * (-2038.072) (-2044.740) (-2035.503) [-2041.873] -- 0:03:50
176000 -- (-2038.611) [-2038.033] (-2039.140) (-2045.288) * (-2048.280) [-2037.522] (-2034.790) (-2036.795) -- 0:03:49
176500 -- (-2037.999) (-2037.107) [-2037.560] (-2034.302) * (-2036.554) (-2039.348) (-2039.418) [-2032.830] -- 0:03:48
177000 -- (-2040.738) [-2041.884] (-2035.274) (-2037.416) * (-2037.301) [-2033.125] (-2034.032) (-2038.773) -- 0:03:52
177500 -- (-2035.419) [-2037.153] (-2044.297) (-2046.763) * [-2032.426] (-2038.877) (-2039.872) (-2037.087) -- 0:03:51
178000 -- (-2039.454) [-2031.071] (-2039.282) (-2042.468) * (-2033.212) (-2033.729) (-2032.702) [-2035.351] -- 0:03:50
178500 -- [-2036.000] (-2036.817) (-2042.434) (-2040.641) * (-2039.764) (-2037.049) (-2037.404) [-2035.460] -- 0:03:50
179000 -- [-2035.816] (-2036.909) (-2032.389) (-2038.543) * (-2042.873) (-2037.366) [-2039.628] (-2033.160) -- 0:03:49
179500 -- (-2033.200) (-2034.778) [-2032.479] (-2037.546) * (-2040.607) [-2037.071] (-2038.881) (-2033.675) -- 0:03:48
180000 -- (-2031.392) (-2034.647) (-2051.483) [-2034.820] * (-2040.576) (-2039.444) [-2039.651] (-2033.724) -- 0:03:47
Average standard deviation of split frequencies: 0.003914
180500 -- [-2039.916] (-2035.790) (-2045.295) (-2038.249) * [-2035.965] (-2045.715) (-2042.885) (-2038.949) -- 0:03:51
181000 -- (-2038.509) (-2038.311) (-2039.296) [-2033.230] * (-2042.592) [-2042.630] (-2031.595) (-2036.612) -- 0:03:50
181500 -- (-2036.587) [-2033.228] (-2046.937) (-2033.977) * (-2043.717) (-2045.420) (-2038.673) [-2032.671] -- 0:03:49
182000 -- (-2038.576) (-2036.779) [-2044.017] (-2032.052) * (-2036.056) (-2043.793) (-2041.165) [-2037.517] -- 0:03:49
182500 -- (-2037.173) (-2039.354) (-2039.729) [-2034.683] * (-2037.700) (-2041.838) [-2034.042] (-2036.351) -- 0:03:48
183000 -- (-2041.821) (-2033.691) (-2034.973) [-2033.986] * (-2034.277) (-2042.744) [-2033.773] (-2042.688) -- 0:03:47
183500 -- (-2036.334) (-2039.342) [-2039.173] (-2033.075) * (-2037.111) [-2045.795] (-2033.465) (-2047.252) -- 0:03:46
184000 -- [-2037.754] (-2038.141) (-2031.849) (-2035.834) * (-2042.308) [-2040.366] (-2032.309) (-2047.834) -- 0:03:46
184500 -- (-2040.463) (-2040.968) [-2034.124] (-2031.402) * (-2041.642) [-2036.603] (-2038.407) (-2035.964) -- 0:03:49
185000 -- (-2036.851) (-2041.041) (-2034.764) [-2037.183] * (-2035.989) (-2039.808) [-2035.213] (-2035.362) -- 0:03:49
Average standard deviation of split frequencies: 0.005069
185500 -- (-2035.603) (-2047.820) [-2036.059] (-2040.815) * [-2033.368] (-2040.969) (-2038.993) (-2034.777) -- 0:03:48
186000 -- (-2040.379) (-2041.925) [-2040.877] (-2039.663) * (-2032.151) (-2037.020) (-2045.332) [-2036.365] -- 0:03:47
186500 -- (-2039.729) (-2037.377) (-2035.950) [-2036.575] * (-2042.145) (-2037.455) [-2038.903] (-2048.351) -- 0:03:46
187000 -- (-2035.658) (-2037.718) (-2034.917) [-2033.572] * [-2042.244] (-2040.050) (-2037.253) (-2033.538) -- 0:03:46
187500 -- (-2043.463) (-2036.881) [-2039.321] (-2034.106) * (-2039.677) (-2041.746) [-2034.991] (-2033.613) -- 0:03:45
188000 -- (-2038.294) (-2040.643) [-2037.106] (-2042.164) * (-2035.963) [-2036.751] (-2035.016) (-2042.144) -- 0:03:48
188500 -- (-2039.127) [-2033.921] (-2037.557) (-2037.982) * (-2039.053) (-2037.056) (-2036.103) [-2032.705] -- 0:03:48
189000 -- (-2042.788) [-2033.486] (-2040.292) (-2033.252) * [-2033.350] (-2045.205) (-2047.094) (-2033.362) -- 0:03:47
189500 -- (-2031.078) [-2034.441] (-2042.503) (-2033.593) * (-2041.396) [-2034.850] (-2032.472) (-2039.220) -- 0:03:46
190000 -- (-2039.459) (-2044.362) (-2042.753) [-2034.538] * (-2033.521) (-2036.362) (-2037.764) [-2034.237] -- 0:03:45
Average standard deviation of split frequencies: 0.005563
190500 -- (-2036.085) [-2032.957] (-2040.454) (-2037.422) * (-2035.816) (-2034.825) (-2034.693) [-2049.106] -- 0:03:45
191000 -- [-2036.805] (-2036.378) (-2036.209) (-2041.629) * [-2036.460] (-2033.717) (-2039.516) (-2044.438) -- 0:03:44
191500 -- (-2033.201) [-2035.140] (-2035.590) (-2039.678) * (-2033.841) (-2037.450) (-2037.554) [-2035.501] -- 0:03:47
192000 -- (-2036.504) (-2041.415) (-2036.007) [-2032.907] * [-2034.950] (-2038.659) (-2048.200) (-2040.058) -- 0:03:47
192500 -- [-2036.237] (-2036.788) (-2038.383) (-2033.562) * (-2037.636) (-2035.143) [-2039.266] (-2037.684) -- 0:03:46
193000 -- [-2036.322] (-2032.991) (-2043.989) (-2036.511) * (-2039.501) (-2035.596) (-2037.110) [-2033.026] -- 0:03:45
193500 -- (-2034.083) (-2035.868) [-2038.774] (-2039.067) * (-2034.561) [-2035.837] (-2037.120) (-2038.440) -- 0:03:45
194000 -- (-2030.100) (-2040.831) [-2037.438] (-2036.482) * (-2040.253) [-2035.499] (-2038.436) (-2044.903) -- 0:03:44
194500 -- [-2031.180] (-2037.818) (-2036.441) (-2038.723) * (-2045.824) (-2035.675) [-2042.252] (-2046.617) -- 0:03:43
195000 -- [-2034.121] (-2039.232) (-2040.621) (-2039.399) * (-2035.270) [-2040.077] (-2038.419) (-2051.229) -- 0:03:42
Average standard deviation of split frequencies: 0.006614
195500 -- (-2039.080) [-2043.094] (-2033.908) (-2037.605) * [-2047.697] (-2039.951) (-2037.796) (-2043.744) -- 0:03:46
196000 -- (-2035.690) [-2036.706] (-2040.476) (-2036.913) * (-2038.452) [-2038.275] (-2040.878) (-2036.478) -- 0:03:45
196500 -- (-2039.797) [-2036.323] (-2036.555) (-2052.120) * [-2034.432] (-2042.447) (-2037.178) (-2037.945) -- 0:03:44
197000 -- (-2035.907) (-2031.585) [-2039.015] (-2039.243) * [-2037.027] (-2042.997) (-2041.321) (-2040.774) -- 0:03:44
197500 -- (-2040.862) (-2042.724) (-2044.795) [-2034.035] * (-2034.444) (-2039.353) (-2037.996) [-2041.925] -- 0:03:43
198000 -- (-2037.868) (-2037.990) (-2037.122) [-2034.914] * [-2034.278] (-2035.102) (-2038.180) (-2050.339) -- 0:03:42
198500 -- (-2035.138) (-2040.271) [-2033.604] (-2032.252) * (-2044.743) (-2035.336) [-2034.789] (-2045.082) -- 0:03:42
199000 -- (-2042.666) (-2037.840) [-2031.748] (-2046.460) * [-2036.798] (-2038.807) (-2037.379) (-2042.054) -- 0:03:45
199500 -- (-2048.177) (-2041.335) (-2032.695) [-2034.294] * (-2035.751) (-2045.989) [-2035.086] (-2039.210) -- 0:03:44
200000 -- (-2043.495) [-2035.502] (-2042.432) (-2035.398) * (-2046.724) (-2047.549) (-2032.373) [-2035.719] -- 0:03:43
Average standard deviation of split frequencies: 0.008222
200500 -- (-2042.814) (-2046.519) (-2031.064) [-2037.994] * (-2036.488) (-2037.686) (-2043.480) [-2041.905] -- 0:03:43
201000 -- [-2036.765] (-2043.497) (-2032.723) (-2033.964) * (-2034.276) (-2036.926) (-2047.531) [-2037.719] -- 0:03:42
201500 -- [-2033.464] (-2039.738) (-2034.981) (-2043.262) * (-2034.933) [-2046.627] (-2032.537) (-2037.555) -- 0:03:41
202000 -- [-2035.904] (-2044.140) (-2034.159) (-2040.585) * (-2043.179) [-2040.312] (-2037.404) (-2040.121) -- 0:03:41
202500 -- (-2039.811) (-2037.930) (-2036.041) [-2036.923] * (-2042.921) [-2039.797] (-2046.911) (-2044.713) -- 0:03:44
203000 -- (-2036.896) [-2040.308] (-2037.814) (-2037.231) * (-2039.614) (-2034.491) [-2038.373] (-2035.149) -- 0:03:43
203500 -- (-2041.910) [-2032.568] (-2044.583) (-2038.567) * (-2036.340) (-2033.881) (-2041.018) [-2039.669] -- 0:03:43
204000 -- (-2040.339) [-2036.568] (-2054.696) (-2037.137) * [-2035.343] (-2039.584) (-2035.234) (-2037.943) -- 0:03:42
204500 -- [-2037.589] (-2043.758) (-2045.646) (-2043.508) * (-2043.896) (-2036.718) [-2038.396] (-2034.592) -- 0:03:41
205000 -- (-2031.817) (-2033.970) (-2036.895) [-2039.299] * [-2035.428] (-2039.363) (-2041.079) (-2033.793) -- 0:03:41
Average standard deviation of split frequencies: 0.005721
205500 -- (-2034.924) [-2037.009] (-2032.035) (-2040.734) * (-2040.100) (-2042.268) (-2038.093) [-2032.450] -- 0:03:40
206000 -- (-2035.730) [-2034.430] (-2031.992) (-2036.620) * (-2038.938) (-2038.286) [-2039.452] (-2037.465) -- 0:03:43
206500 -- [-2035.237] (-2038.965) (-2039.073) (-2039.537) * [-2036.509] (-2041.543) (-2040.349) (-2038.229) -- 0:03:42
207000 -- (-2036.668) [-2031.151] (-2039.004) (-2031.568) * (-2037.688) (-2043.005) [-2039.184] (-2037.188) -- 0:03:42
207500 -- (-2035.855) (-2040.720) (-2034.504) [-2036.213] * (-2035.139) (-2037.726) (-2039.022) [-2034.681] -- 0:03:41
208000 -- (-2036.246) (-2033.416) (-2034.653) [-2037.013] * (-2037.521) (-2037.412) (-2036.881) [-2040.771] -- 0:03:40
208500 -- (-2037.570) (-2042.009) [-2031.469] (-2039.947) * (-2045.066) (-2035.922) (-2037.879) [-2038.570] -- 0:03:40
209000 -- (-2036.937) (-2043.266) [-2037.791] (-2034.719) * (-2032.635) (-2032.380) (-2038.061) [-2036.450] -- 0:03:39
209500 -- (-2032.748) [-2040.048] (-2043.106) (-2039.128) * (-2035.676) (-2042.545) (-2040.695) [-2040.745] -- 0:03:42
210000 -- [-2041.498] (-2034.832) (-2035.400) (-2035.643) * (-2031.680) (-2037.813) [-2032.581] (-2035.253) -- 0:03:41
Average standard deviation of split frequencies: 0.005594
210500 -- (-2041.206) (-2037.428) [-2040.509] (-2035.510) * [-2040.257] (-2033.958) (-2032.953) (-2036.344) -- 0:03:41
211000 -- [-2033.302] (-2036.606) (-2038.801) (-2039.942) * (-2040.116) [-2030.127] (-2044.970) (-2035.775) -- 0:03:40
211500 -- (-2036.005) (-2038.780) [-2035.047] (-2040.584) * (-2035.624) [-2035.999] (-2046.927) (-2042.362) -- 0:03:39
212000 -- (-2037.583) [-2040.229] (-2034.685) (-2038.013) * (-2039.361) [-2034.189] (-2041.557) (-2035.306) -- 0:03:39
212500 -- (-2037.407) [-2032.155] (-2034.625) (-2034.078) * (-2037.346) [-2035.175] (-2041.764) (-2035.878) -- 0:03:38
213000 -- [-2038.064] (-2033.549) (-2034.143) (-2033.005) * (-2040.087) (-2036.810) [-2035.249] (-2043.779) -- 0:03:37
213500 -- (-2037.333) (-2036.963) [-2036.227] (-2031.334) * (-2034.017) [-2034.472] (-2040.348) (-2034.255) -- 0:03:41
214000 -- (-2041.961) (-2036.111) [-2040.223] (-2043.748) * (-2036.314) (-2042.270) (-2036.675) [-2035.134] -- 0:03:40
214500 -- (-2041.729) [-2036.345] (-2040.279) (-2047.338) * (-2038.375) (-2034.352) (-2035.345) [-2038.708] -- 0:03:39
215000 -- (-2038.184) [-2034.054] (-2050.916) (-2037.225) * (-2036.061) [-2033.179] (-2043.764) (-2035.690) -- 0:03:39
Average standard deviation of split frequencies: 0.007638
215500 -- (-2044.056) (-2038.061) [-2038.283] (-2035.265) * (-2035.048) (-2035.026) (-2034.996) [-2040.027] -- 0:03:38
216000 -- (-2046.215) [-2043.075] (-2035.903) (-2036.757) * (-2032.711) (-2034.830) (-2039.600) [-2040.779] -- 0:03:37
216500 -- (-2042.426) [-2036.242] (-2042.263) (-2037.100) * (-2038.577) (-2055.008) (-2037.843) [-2038.025] -- 0:03:37
217000 -- (-2046.680) (-2036.331) (-2043.170) [-2038.179] * [-2030.915] (-2056.654) (-2041.094) (-2034.176) -- 0:03:40
217500 -- (-2039.507) (-2039.213) (-2035.936) [-2035.010] * [-2035.215] (-2060.491) (-2040.396) (-2039.400) -- 0:03:39
218000 -- (-2038.334) (-2044.063) (-2036.430) [-2033.507] * (-2040.865) (-2038.527) [-2037.548] (-2039.117) -- 0:03:38
218500 -- [-2040.273] (-2040.994) (-2036.085) (-2035.414) * (-2037.524) (-2047.534) [-2035.392] (-2036.354) -- 0:03:38
219000 -- (-2033.550) (-2032.573) [-2038.450] (-2045.926) * (-2037.198) (-2038.013) (-2038.929) [-2033.589] -- 0:03:37
219500 -- [-2035.291] (-2032.026) (-2041.563) (-2039.498) * (-2034.069) (-2035.653) (-2035.207) [-2037.049] -- 0:03:36
220000 -- [-2042.239] (-2035.250) (-2049.945) (-2045.263) * (-2034.784) (-2034.726) (-2043.630) [-2040.493] -- 0:03:36
Average standard deviation of split frequencies: 0.005341
220500 -- (-2040.569) (-2036.225) [-2042.961] (-2043.599) * (-2039.459) (-2040.776) (-2033.341) [-2041.813] -- 0:03:39
221000 -- [-2036.984] (-2036.685) (-2041.761) (-2039.695) * (-2036.903) (-2033.503) (-2036.885) [-2041.841] -- 0:03:38
221500 -- [-2031.689] (-2038.697) (-2043.128) (-2042.755) * (-2039.357) (-2038.776) (-2038.925) [-2036.177] -- 0:03:37
222000 -- [-2034.564] (-2040.071) (-2043.784) (-2048.319) * (-2035.556) [-2036.214] (-2035.051) (-2034.427) -- 0:03:37
222500 -- [-2036.660] (-2033.571) (-2033.575) (-2040.663) * (-2038.952) (-2040.234) (-2036.913) [-2041.930] -- 0:03:36
223000 -- (-2035.098) (-2037.959) (-2037.876) [-2033.883] * [-2032.737] (-2037.095) (-2038.308) (-2038.809) -- 0:03:36
223500 -- [-2032.767] (-2040.863) (-2034.992) (-2035.985) * (-2047.194) (-2035.225) (-2040.762) [-2038.519] -- 0:03:35
224000 -- (-2035.060) [-2037.600] (-2034.443) (-2031.318) * (-2038.824) (-2035.559) (-2045.970) [-2039.463] -- 0:03:38
224500 -- (-2035.798) [-2036.906] (-2036.512) (-2033.399) * (-2038.301) [-2033.139] (-2040.814) (-2037.868) -- 0:03:37
225000 -- [-2035.736] (-2032.755) (-2036.711) (-2038.347) * [-2038.556] (-2039.844) (-2041.093) (-2048.040) -- 0:03:36
Average standard deviation of split frequencies: 0.006779
225500 -- (-2033.679) (-2038.763) [-2038.424] (-2040.107) * (-2043.669) (-2033.752) (-2035.846) [-2030.200] -- 0:03:36
226000 -- (-2042.840) [-2033.605] (-2035.701) (-2039.744) * (-2031.027) [-2040.695] (-2037.486) (-2036.360) -- 0:03:35
226500 -- (-2035.054) (-2032.285) [-2036.037] (-2048.460) * (-2037.533) [-2037.733] (-2044.353) (-2035.005) -- 0:03:35
227000 -- (-2038.144) (-2034.557) [-2032.021] (-2039.302) * (-2040.880) (-2036.105) [-2032.337] (-2047.321) -- 0:03:34
227500 -- (-2036.309) (-2033.714) [-2034.259] (-2039.440) * (-2042.656) (-2034.983) [-2032.033] (-2037.846) -- 0:03:33
228000 -- [-2034.461] (-2039.047) (-2039.198) (-2036.313) * (-2036.161) (-2038.881) [-2032.017] (-2038.601) -- 0:03:36
228500 -- (-2042.350) (-2039.899) [-2043.207] (-2043.384) * (-2037.142) (-2039.173) [-2034.228] (-2040.070) -- 0:03:36
229000 -- (-2035.175) (-2038.067) [-2041.747] (-2037.093) * [-2039.163] (-2038.761) (-2033.905) (-2041.559) -- 0:03:35
229500 -- (-2037.143) (-2037.329) [-2032.794] (-2041.234) * (-2034.770) [-2039.204] (-2039.457) (-2047.370) -- 0:03:34
230000 -- (-2033.864) [-2047.305] (-2040.376) (-2042.333) * (-2039.351) [-2036.631] (-2036.251) (-2044.895) -- 0:03:34
Average standard deviation of split frequencies: 0.005620
230500 -- (-2043.776) [-2040.643] (-2041.804) (-2038.777) * (-2035.696) [-2042.828] (-2037.098) (-2045.408) -- 0:03:33
231000 -- (-2048.215) (-2035.184) (-2035.410) [-2032.275] * [-2037.075] (-2035.700) (-2041.477) (-2044.839) -- 0:03:33
231500 -- (-2051.699) (-2039.739) (-2037.405) [-2031.189] * (-2038.617) [-2035.554] (-2037.644) (-2038.082) -- 0:03:35
232000 -- (-2042.619) [-2045.544] (-2035.199) (-2036.379) * (-2035.670) (-2044.948) (-2033.992) [-2037.888] -- 0:03:35
232500 -- (-2041.338) (-2035.913) [-2037.961] (-2033.222) * (-2034.606) [-2038.423] (-2035.316) (-2042.363) -- 0:03:34
233000 -- (-2043.907) [-2034.540] (-2043.796) (-2041.262) * [-2036.186] (-2035.059) (-2032.099) (-2042.023) -- 0:03:33
233500 -- (-2053.461) (-2037.864) (-2050.249) [-2037.594] * (-2035.576) (-2045.515) [-2038.061] (-2045.402) -- 0:03:33
234000 -- (-2045.918) (-2043.765) (-2041.445) [-2042.130] * (-2044.353) (-2044.132) [-2036.103] (-2041.610) -- 0:03:32
234500 -- (-2038.195) [-2044.044] (-2037.246) (-2044.974) * (-2044.552) (-2039.597) (-2040.129) [-2031.225] -- 0:03:32
235000 -- [-2042.297] (-2035.216) (-2039.803) (-2038.682) * (-2037.239) (-2037.138) [-2039.375] (-2037.671) -- 0:03:34
Average standard deviation of split frequencies: 0.005493
235500 -- (-2040.578) [-2040.933] (-2048.084) (-2038.747) * (-2035.410) (-2035.886) (-2041.280) [-2032.515] -- 0:03:34
236000 -- (-2037.556) [-2034.264] (-2044.467) (-2039.845) * [-2039.979] (-2036.620) (-2038.572) (-2031.116) -- 0:03:33
236500 -- [-2035.719] (-2038.326) (-2035.776) (-2038.974) * [-2032.245] (-2044.439) (-2036.526) (-2033.376) -- 0:03:33
237000 -- (-2045.036) (-2034.940) [-2034.684] (-2036.714) * [-2035.174] (-2046.792) (-2038.848) (-2038.080) -- 0:03:32
237500 -- (-2039.310) (-2033.648) [-2033.785] (-2037.059) * (-2039.105) (-2030.460) [-2038.518] (-2044.493) -- 0:03:31
238000 -- (-2038.974) [-2034.518] (-2033.636) (-2038.083) * [-2035.110] (-2034.121) (-2042.344) (-2042.256) -- 0:03:31
238500 -- (-2047.039) [-2035.487] (-2037.078) (-2038.532) * (-2045.604) [-2033.830] (-2039.084) (-2045.399) -- 0:03:33
239000 -- (-2045.641) [-2033.626] (-2039.242) (-2042.685) * [-2034.290] (-2047.091) (-2041.785) (-2037.464) -- 0:03:33
239500 -- (-2038.691) (-2034.493) [-2033.828] (-2041.564) * (-2035.013) [-2039.915] (-2037.216) (-2040.414) -- 0:03:32
240000 -- [-2033.001] (-2039.583) (-2033.623) (-2034.266) * [-2037.327] (-2049.279) (-2036.693) (-2044.425) -- 0:03:32
Average standard deviation of split frequencies: 0.005876
240500 -- (-2033.404) (-2035.736) (-2039.264) [-2036.908] * [-2040.301] (-2037.365) (-2037.678) (-2039.264) -- 0:03:31
241000 -- (-2035.539) [-2036.086] (-2044.426) (-2033.037) * [-2035.656] (-2040.329) (-2044.286) (-2034.688) -- 0:03:31
241500 -- (-2038.227) (-2036.502) (-2041.105) [-2040.123] * [-2037.016] (-2040.503) (-2036.390) (-2039.668) -- 0:03:30
242000 -- (-2044.369) (-2038.414) (-2043.626) [-2037.797] * [-2032.725] (-2031.927) (-2036.468) (-2042.073) -- 0:03:29
242500 -- (-2044.076) (-2041.170) (-2037.504) [-2034.186] * [-2038.534] (-2034.629) (-2038.162) (-2039.356) -- 0:03:32
243000 -- [-2035.348] (-2038.637) (-2047.646) (-2042.476) * (-2032.887) (-2036.761) (-2037.865) [-2038.228] -- 0:03:31
243500 -- (-2033.407) (-2035.344) [-2038.802] (-2034.927) * (-2043.143) [-2035.557] (-2035.644) (-2032.112) -- 0:03:31
244000 -- (-2039.706) (-2042.722) (-2035.642) [-2040.947] * (-2036.838) [-2033.090] (-2035.679) (-2032.825) -- 0:03:30
244500 -- [-2033.865] (-2037.363) (-2031.812) (-2041.113) * (-2037.734) (-2041.531) [-2039.732] (-2040.666) -- 0:03:30
245000 -- (-2036.812) (-2040.210) [-2033.790] (-2035.876) * [-2037.123] (-2040.490) (-2040.713) (-2035.588) -- 0:03:29
Average standard deviation of split frequencies: 0.004791
245500 -- [-2037.455] (-2035.981) (-2039.218) (-2042.887) * (-2040.838) [-2038.017] (-2035.243) (-2035.380) -- 0:03:28
246000 -- [-2039.399] (-2036.108) (-2038.069) (-2033.745) * (-2041.174) (-2034.250) [-2037.162] (-2034.567) -- 0:03:31
246500 -- (-2034.269) (-2034.548) (-2044.952) [-2040.142] * (-2037.864) (-2039.680) (-2033.245) [-2037.018] -- 0:03:30
247000 -- (-2036.427) (-2036.952) [-2034.779] (-2039.706) * (-2038.210) (-2034.637) (-2035.681) [-2038.570] -- 0:03:30
247500 -- (-2039.460) [-2038.927] (-2045.578) (-2032.812) * (-2040.272) [-2038.681] (-2037.700) (-2033.596) -- 0:03:29
248000 -- [-2035.292] (-2037.464) (-2036.082) (-2037.577) * (-2039.437) (-2040.530) [-2034.007] (-2032.071) -- 0:03:29
248500 -- [-2037.117] (-2039.761) (-2046.126) (-2045.804) * (-2032.650) (-2032.974) [-2040.977] (-2040.796) -- 0:03:28
249000 -- [-2036.767] (-2038.864) (-2052.364) (-2040.724) * [-2032.541] (-2041.256) (-2040.686) (-2035.681) -- 0:03:28
249500 -- (-2042.173) (-2041.984) (-2041.194) [-2042.306] * (-2040.200) (-2037.632) (-2036.137) [-2040.782] -- 0:03:30
250000 -- (-2041.475) (-2041.639) [-2032.583] (-2034.328) * (-2044.977) [-2040.027] (-2042.737) (-2045.026) -- 0:03:29
Average standard deviation of split frequencies: 0.004702
250500 -- (-2035.775) (-2046.308) (-2040.188) [-2041.578] * (-2038.488) (-2039.171) [-2037.776] (-2040.847) -- 0:03:29
251000 -- (-2041.342) (-2043.282) (-2040.125) [-2035.545] * [-2032.785] (-2038.919) (-2034.402) (-2035.089) -- 0:03:28
251500 -- (-2045.036) (-2042.383) [-2037.144] (-2034.079) * [-2037.247] (-2034.729) (-2036.612) (-2033.490) -- 0:03:28
252000 -- (-2045.380) (-2036.412) (-2037.362) [-2037.400] * [-2030.753] (-2037.655) (-2033.219) (-2036.226) -- 0:03:27
252500 -- (-2038.647) (-2038.362) (-2042.791) [-2037.027] * (-2036.412) [-2038.397] (-2040.294) (-2041.383) -- 0:03:27
253000 -- (-2037.869) (-2035.659) (-2040.143) [-2034.928] * (-2033.329) [-2036.740] (-2048.175) (-2037.035) -- 0:03:29
253500 -- [-2034.643] (-2042.893) (-2041.315) (-2033.502) * [-2032.335] (-2032.623) (-2040.620) (-2034.714) -- 0:03:29
254000 -- (-2037.304) (-2040.771) [-2039.759] (-2039.087) * [-2039.159] (-2034.650) (-2043.941) (-2037.467) -- 0:03:28
254500 -- (-2035.660) [-2038.128] (-2043.522) (-2035.069) * (-2036.557) [-2033.788] (-2037.547) (-2037.132) -- 0:03:27
255000 -- (-2036.587) (-2045.151) (-2046.183) [-2042.529] * [-2036.114] (-2034.111) (-2038.281) (-2042.039) -- 0:03:27
Average standard deviation of split frequencies: 0.005064
255500 -- [-2038.966] (-2038.029) (-2042.724) (-2040.567) * [-2034.132] (-2038.433) (-2039.714) (-2040.541) -- 0:03:26
256000 -- (-2036.066) (-2037.967) [-2034.597] (-2041.986) * (-2039.018) [-2032.697] (-2035.075) (-2045.672) -- 0:03:26
256500 -- (-2041.222) (-2041.586) (-2042.644) [-2037.460] * (-2046.727) (-2038.129) [-2034.757] (-2040.070) -- 0:03:25
257000 -- [-2031.407] (-2041.737) (-2040.843) (-2039.547) * (-2039.866) [-2039.568] (-2032.124) (-2036.653) -- 0:03:28
257500 -- (-2040.509) (-2040.239) (-2039.479) [-2034.213] * (-2041.234) (-2037.481) (-2031.604) [-2038.564] -- 0:03:27
258000 -- (-2044.751) (-2042.950) (-2032.528) [-2042.588] * (-2037.811) (-2038.628) [-2035.021] (-2036.072) -- 0:03:27
258500 -- (-2037.221) (-2041.970) (-2036.593) [-2035.330] * (-2040.413) [-2034.097] (-2037.343) (-2054.200) -- 0:03:26
259000 -- (-2036.311) [-2042.288] (-2033.756) (-2036.797) * (-2037.464) (-2032.951) [-2033.518] (-2038.380) -- 0:03:25
259500 -- (-2033.840) (-2050.207) [-2039.412] (-2043.843) * (-2037.496) (-2041.686) [-2037.232] (-2038.906) -- 0:03:25
260000 -- (-2039.438) (-2039.259) (-2035.987) [-2035.855] * [-2035.012] (-2036.636) (-2042.542) (-2042.709) -- 0:03:24
Average standard deviation of split frequencies: 0.004973
260500 -- (-2037.654) [-2047.873] (-2042.682) (-2034.900) * [-2032.185] (-2037.412) (-2042.183) (-2036.196) -- 0:03:27
261000 -- (-2036.975) (-2035.776) [-2034.078] (-2042.208) * (-2037.437) (-2041.525) [-2036.880] (-2040.024) -- 0:03:26
261500 -- (-2038.033) [-2036.273] (-2035.992) (-2038.372) * [-2035.904] (-2038.810) (-2038.275) (-2039.311) -- 0:03:26
262000 -- (-2035.898) (-2044.649) (-2042.816) [-2033.146] * (-2035.738) (-2038.524) (-2037.001) [-2038.957] -- 0:03:25
262500 -- [-2035.890] (-2033.984) (-2042.411) (-2038.490) * (-2038.663) (-2034.963) [-2037.087] (-2043.604) -- 0:03:25
263000 -- [-2038.048] (-2037.535) (-2042.339) (-2043.867) * (-2039.124) [-2037.211] (-2040.997) (-2040.523) -- 0:03:24
263500 -- [-2040.109] (-2034.985) (-2042.050) (-2039.011) * (-2035.126) [-2033.867] (-2043.398) (-2040.311) -- 0:03:24
264000 -- (-2042.659) [-2037.169] (-2035.579) (-2042.996) * (-2037.887) [-2035.070] (-2038.631) (-2048.871) -- 0:03:26
264500 -- (-2036.226) [-2038.376] (-2035.660) (-2046.837) * (-2039.466) [-2036.462] (-2040.430) (-2053.793) -- 0:03:25
265000 -- [-2035.676] (-2036.417) (-2042.880) (-2041.338) * (-2034.588) (-2040.281) (-2037.421) [-2035.692] -- 0:03:25
Average standard deviation of split frequencies: 0.004874
265500 -- (-2038.556) (-2032.959) (-2039.399) [-2036.138] * [-2035.044] (-2050.040) (-2034.806) (-2036.332) -- 0:03:24
266000 -- (-2039.447) [-2034.580] (-2035.381) (-2033.438) * [-2033.310] (-2034.536) (-2037.024) (-2036.401) -- 0:03:24
266500 -- [-2037.087] (-2032.501) (-2032.978) (-2045.561) * [-2034.647] (-2044.774) (-2043.058) (-2035.356) -- 0:03:23
267000 -- (-2039.454) [-2035.988] (-2035.871) (-2036.316) * (-2039.558) (-2038.892) (-2045.043) [-2035.479] -- 0:03:23
267500 -- (-2037.661) (-2042.538) [-2039.591] (-2038.587) * [-2032.159] (-2038.580) (-2037.665) (-2043.559) -- 0:03:25
268000 -- (-2039.782) (-2045.925) (-2041.753) [-2034.489] * (-2035.448) (-2043.576) (-2037.982) [-2036.571] -- 0:03:24
268500 -- [-2045.728] (-2039.240) (-2033.870) (-2033.779) * (-2042.946) (-2041.032) [-2035.665] (-2034.757) -- 0:03:24
269000 -- (-2033.940) (-2041.026) (-2039.365) [-2031.845] * (-2037.530) (-2043.302) (-2031.788) [-2039.608] -- 0:03:23
269500 -- [-2040.743] (-2042.422) (-2038.142) (-2037.703) * (-2039.496) (-2037.218) (-2038.551) [-2033.233] -- 0:03:23
270000 -- (-2031.895) (-2036.203) [-2034.896] (-2035.445) * [-2036.733] (-2042.781) (-2043.917) (-2034.693) -- 0:03:22
Average standard deviation of split frequencies: 0.004354
270500 -- (-2034.026) (-2037.622) [-2035.770] (-2052.201) * (-2037.549) (-2037.954) (-2037.347) [-2033.286] -- 0:03:22
271000 -- (-2041.513) (-2041.566) [-2041.783] (-2043.086) * [-2037.425] (-2034.448) (-2034.444) (-2036.575) -- 0:03:24
271500 -- (-2040.971) (-2038.016) (-2041.581) [-2036.557] * (-2035.683) [-2041.874] (-2034.194) (-2036.332) -- 0:03:23
272000 -- (-2036.567) [-2037.984] (-2041.871) (-2036.595) * (-2040.189) [-2032.126] (-2042.601) (-2039.064) -- 0:03:23
272500 -- (-2034.799) [-2030.786] (-2040.486) (-2037.689) * (-2041.381) (-2035.984) [-2034.474] (-2042.378) -- 0:03:22
273000 -- [-2038.568] (-2033.083) (-2037.803) (-2036.721) * (-2035.447) (-2047.813) (-2039.545) [-2038.720] -- 0:03:22
273500 -- (-2035.940) (-2034.377) (-2034.106) [-2031.996] * (-2046.935) (-2035.894) [-2033.125] (-2037.926) -- 0:03:21
274000 -- (-2040.316) (-2041.349) [-2038.961] (-2038.729) * [-2044.577] (-2043.911) (-2044.009) (-2037.615) -- 0:03:21
274500 -- (-2041.947) [-2039.626] (-2036.478) (-2045.084) * (-2043.574) (-2037.436) (-2040.095) [-2033.522] -- 0:03:20
275000 -- [-2040.113] (-2039.540) (-2042.365) (-2045.869) * (-2044.657) [-2033.057] (-2045.214) (-2040.573) -- 0:03:22
Average standard deviation of split frequencies: 0.004270
275500 -- (-2049.693) (-2037.142) (-2036.487) [-2039.612] * [-2036.903] (-2036.341) (-2043.886) (-2037.610) -- 0:03:22
276000 -- (-2043.674) [-2031.648] (-2037.452) (-2038.487) * [-2034.069] (-2040.036) (-2040.363) (-2041.709) -- 0:03:21
276500 -- (-2040.401) (-2033.264) [-2033.022] (-2040.235) * (-2037.833) (-2041.118) [-2037.251] (-2037.831) -- 0:03:21
277000 -- (-2036.135) (-2040.555) [-2031.843] (-2033.531) * (-2036.010) [-2037.987] (-2040.554) (-2038.532) -- 0:03:20
277500 -- (-2038.046) (-2040.449) (-2036.629) [-2033.232] * (-2038.171) [-2035.594] (-2033.803) (-2033.826) -- 0:03:20
278000 -- (-2035.251) (-2037.783) (-2037.828) [-2040.002] * [-2044.661] (-2034.511) (-2037.808) (-2044.114) -- 0:03:19
278500 -- (-2038.705) (-2045.062) (-2045.273) [-2037.532] * (-2041.581) (-2035.377) [-2034.619] (-2041.179) -- 0:03:22
279000 -- (-2033.953) (-2035.630) (-2045.613) [-2038.093] * (-2036.587) [-2035.020] (-2037.436) (-2034.826) -- 0:03:21
279500 -- (-2035.317) [-2035.104] (-2037.410) (-2035.219) * (-2039.424) (-2038.240) [-2037.604] (-2042.189) -- 0:03:21
280000 -- (-2038.257) [-2042.849] (-2041.080) (-2036.961) * (-2036.813) (-2034.831) [-2040.866] (-2041.526) -- 0:03:20
Average standard deviation of split frequencies: 0.003779
280500 -- (-2038.061) [-2031.144] (-2036.375) (-2033.015) * (-2041.701) [-2035.513] (-2031.515) (-2045.611) -- 0:03:20
281000 -- [-2032.189] (-2035.247) (-2038.170) (-2038.939) * (-2037.621) (-2035.642) (-2041.429) [-2034.866] -- 0:03:19
281500 -- (-2037.034) [-2036.747] (-2039.033) (-2035.757) * [-2037.117] (-2040.304) (-2039.288) (-2033.734) -- 0:03:19
282000 -- (-2033.217) [-2035.644] (-2039.317) (-2036.251) * (-2041.837) (-2034.267) [-2033.721] (-2035.835) -- 0:03:21
282500 -- (-2038.528) (-2042.266) (-2032.531) [-2034.898] * (-2038.958) (-2036.963) (-2040.115) [-2039.587] -- 0:03:20
283000 -- (-2037.400) (-2034.680) (-2042.588) [-2039.610] * [-2038.008] (-2035.152) (-2037.125) (-2032.162) -- 0:03:20
283500 -- (-2039.118) (-2035.060) [-2041.032] (-2045.242) * (-2036.309) [-2036.296] (-2036.470) (-2033.133) -- 0:03:19
284000 -- (-2037.246) (-2040.668) [-2034.195] (-2043.803) * (-2031.401) [-2036.149] (-2032.375) (-2036.543) -- 0:03:19
284500 -- (-2033.469) (-2036.520) [-2035.479] (-2040.565) * [-2035.608] (-2041.147) (-2035.516) (-2036.965) -- 0:03:18
285000 -- (-2037.325) [-2031.103] (-2038.415) (-2039.770) * (-2037.446) (-2043.701) [-2035.727] (-2035.966) -- 0:03:18
Average standard deviation of split frequencies: 0.003709
285500 -- (-2041.571) (-2038.939) [-2034.021] (-2045.093) * (-2033.012) (-2043.201) (-2034.847) [-2036.583] -- 0:03:20
286000 -- [-2044.127] (-2035.005) (-2031.594) (-2038.145) * (-2037.168) (-2042.369) [-2038.843] (-2041.046) -- 0:03:19
286500 -- (-2043.474) (-2035.972) [-2032.178] (-2034.126) * [-2036.595] (-2038.791) (-2038.222) (-2038.931) -- 0:03:19
287000 -- (-2038.933) (-2036.256) (-2042.159) [-2034.441] * (-2047.390) (-2039.126) [-2034.673] (-2045.136) -- 0:03:18
287500 -- (-2047.570) [-2032.179] (-2037.125) (-2039.314) * [-2033.040] (-2037.852) (-2037.319) (-2043.661) -- 0:03:18
288000 -- (-2038.679) (-2034.175) [-2038.590] (-2034.219) * (-2034.582) (-2042.601) (-2037.167) [-2038.008] -- 0:03:17
288500 -- (-2036.448) (-2045.103) [-2037.774] (-2042.050) * (-2033.904) (-2050.797) (-2036.310) [-2045.791] -- 0:03:17
289000 -- (-2046.909) (-2041.820) [-2053.180] (-2039.557) * (-2038.299) [-2045.202] (-2036.086) (-2043.259) -- 0:03:16
289500 -- (-2036.427) [-2030.531] (-2039.785) (-2034.819) * (-2037.449) (-2036.405) [-2035.108] (-2047.952) -- 0:03:18
290000 -- [-2040.416] (-2035.385) (-2039.726) (-2032.733) * (-2038.205) (-2036.379) [-2035.518] (-2042.875) -- 0:03:18
Average standard deviation of split frequencies: 0.003244
290500 -- (-2037.526) (-2038.963) [-2034.807] (-2038.277) * [-2039.414] (-2034.794) (-2037.890) (-2038.749) -- 0:03:17
291000 -- (-2043.552) (-2040.997) [-2037.154] (-2039.518) * [-2032.030] (-2034.541) (-2045.203) (-2040.205) -- 0:03:17
291500 -- (-2041.276) [-2034.543] (-2044.014) (-2038.421) * (-2044.823) [-2035.980] (-2033.925) (-2037.645) -- 0:03:16
292000 -- (-2039.592) [-2032.543] (-2040.366) (-2030.812) * [-2035.660] (-2039.372) (-2038.014) (-2043.909) -- 0:03:16
292500 -- (-2040.491) (-2045.996) (-2036.043) [-2035.052] * (-2036.939) (-2041.542) (-2035.345) [-2037.503] -- 0:03:15
293000 -- [-2037.839] (-2035.558) (-2043.229) (-2035.985) * [-2036.021] (-2045.278) (-2037.227) (-2035.311) -- 0:03:17
293500 -- (-2043.881) [-2034.778] (-2035.800) (-2034.632) * (-2039.036) (-2043.744) (-2036.233) [-2033.912] -- 0:03:17
294000 -- (-2041.848) (-2038.175) (-2038.138) [-2036.296] * (-2049.251) (-2045.470) [-2036.819] (-2029.988) -- 0:03:16
294500 -- (-2048.575) (-2038.498) (-2037.941) [-2033.389] * (-2044.664) (-2038.876) [-2035.321] (-2038.753) -- 0:03:16
295000 -- (-2043.718) (-2041.394) (-2035.135) [-2029.712] * (-2036.448) (-2034.634) (-2040.738) [-2034.863] -- 0:03:15
Average standard deviation of split frequencies: 0.003185
295500 -- (-2042.057) (-2040.399) [-2039.648] (-2035.338) * (-2039.679) [-2035.348] (-2038.939) (-2031.242) -- 0:03:15
296000 -- [-2039.840] (-2038.108) (-2042.171) (-2050.490) * (-2035.898) (-2033.023) (-2031.461) [-2038.578] -- 0:03:15
296500 -- (-2046.339) (-2041.288) (-2034.400) [-2037.359] * (-2037.295) [-2034.607] (-2042.199) (-2031.999) -- 0:03:16
297000 -- (-2032.755) [-2036.696] (-2039.887) (-2042.741) * (-2037.658) (-2032.321) [-2039.954] (-2040.158) -- 0:03:16
297500 -- (-2047.879) (-2034.984) [-2034.906] (-2040.130) * (-2040.872) [-2031.608] (-2045.153) (-2040.019) -- 0:03:15
298000 -- (-2038.703) (-2038.098) [-2032.820] (-2037.217) * (-2040.864) [-2037.848] (-2041.312) (-2033.445) -- 0:03:15
298500 -- [-2030.499] (-2039.616) (-2033.288) (-2038.521) * (-2055.573) (-2040.496) (-2033.436) [-2032.096] -- 0:03:15
299000 -- (-2033.109) (-2038.806) [-2038.125] (-2039.956) * (-2043.006) (-2037.585) [-2032.658] (-2037.793) -- 0:03:14
299500 -- [-2033.830] (-2038.908) (-2042.214) (-2037.246) * (-2056.045) (-2037.000) (-2044.837) [-2031.780] -- 0:03:14
300000 -- (-2037.278) (-2039.352) (-2040.556) [-2036.818] * (-2044.577) [-2042.346] (-2038.054) (-2043.472) -- 0:03:15
Average standard deviation of split frequencies: 0.003920
300500 -- [-2034.514] (-2037.402) (-2036.134) (-2033.529) * (-2042.158) (-2040.494) (-2036.258) [-2030.480] -- 0:03:15
301000 -- (-2047.304) (-2034.866) [-2046.983] (-2039.319) * (-2039.728) (-2041.518) (-2034.376) [-2040.009] -- 0:03:15
301500 -- (-2030.259) [-2037.836] (-2042.868) (-2035.140) * (-2040.085) (-2035.480) (-2034.684) [-2037.661] -- 0:03:14
302000 -- [-2035.542] (-2037.350) (-2045.406) (-2036.787) * (-2033.189) (-2043.098) (-2039.760) [-2040.833] -- 0:03:14
302500 -- (-2042.476) (-2037.588) [-2039.676] (-2038.051) * (-2037.457) (-2042.100) [-2035.254] (-2036.553) -- 0:03:13
303000 -- (-2043.273) [-2037.804] (-2035.848) (-2038.427) * [-2046.763] (-2043.292) (-2031.901) (-2034.390) -- 0:03:13
303500 -- [-2037.893] (-2037.059) (-2035.485) (-2039.967) * [-2035.020] (-2037.867) (-2035.184) (-2043.740) -- 0:03:15
304000 -- (-2041.318) [-2042.930] (-2039.115) (-2043.153) * [-2034.584] (-2034.018) (-2038.498) (-2036.531) -- 0:03:14
304500 -- [-2036.505] (-2037.920) (-2041.161) (-2043.234) * (-2037.123) [-2039.818] (-2034.786) (-2036.033) -- 0:03:14
305000 -- (-2031.075) (-2038.409) [-2035.968] (-2041.165) * (-2048.791) (-2033.575) [-2031.070] (-2039.843) -- 0:03:13
Average standard deviation of split frequencies: 0.003851
305500 -- (-2037.285) (-2045.441) [-2034.769] (-2039.103) * (-2038.212) (-2034.823) (-2035.234) [-2034.470] -- 0:03:13
306000 -- (-2038.675) (-2042.210) [-2043.835] (-2039.763) * (-2038.057) (-2034.148) [-2037.775] (-2040.334) -- 0:03:12
306500 -- (-2033.692) (-2038.184) (-2033.012) [-2033.909] * (-2040.504) (-2037.637) (-2035.009) [-2037.554] -- 0:03:12
307000 -- [-2030.937] (-2038.741) (-2036.805) (-2040.302) * (-2044.272) [-2038.342] (-2037.317) (-2037.052) -- 0:03:11
307500 -- (-2036.142) (-2038.365) (-2038.885) [-2038.048] * (-2038.278) [-2033.406] (-2043.339) (-2037.435) -- 0:03:13
308000 -- [-2035.152] (-2044.016) (-2036.815) (-2041.756) * (-2035.699) (-2042.508) (-2041.396) [-2035.210] -- 0:03:13
308500 -- [-2040.036] (-2044.567) (-2044.741) (-2036.160) * (-2035.483) [-2034.047] (-2039.826) (-2034.013) -- 0:03:12
309000 -- (-2043.783) [-2039.708] (-2035.216) (-2041.122) * (-2044.186) (-2035.509) (-2040.089) [-2035.352] -- 0:03:12
309500 -- [-2044.507] (-2042.129) (-2034.144) (-2042.267) * (-2033.654) (-2049.694) [-2034.946] (-2032.772) -- 0:03:11
310000 -- (-2036.533) (-2036.721) [-2037.017] (-2037.749) * (-2034.047) (-2041.978) [-2035.820] (-2037.871) -- 0:03:11
Average standard deviation of split frequencies: 0.003414
310500 -- (-2036.753) (-2051.938) (-2047.664) [-2039.422] * [-2037.595] (-2041.646) (-2038.239) (-2039.021) -- 0:03:10
311000 -- [-2038.246] (-2042.351) (-2039.457) (-2037.849) * (-2036.838) (-2045.935) [-2038.829] (-2038.607) -- 0:03:12
311500 -- (-2036.839) (-2043.826) (-2038.658) [-2035.494] * (-2035.524) (-2042.972) [-2034.660] (-2045.935) -- 0:03:12
312000 -- [-2037.016] (-2040.597) (-2044.347) (-2045.505) * (-2040.870) [-2036.620] (-2034.175) (-2041.081) -- 0:03:11
312500 -- (-2041.138) (-2043.327) [-2038.345] (-2043.686) * [-2039.996] (-2051.988) (-2042.963) (-2042.536) -- 0:03:11
313000 -- (-2037.060) (-2033.936) [-2037.716] (-2035.295) * [-2041.643] (-2042.260) (-2043.062) (-2039.423) -- 0:03:10
313500 -- (-2056.346) (-2037.036) (-2038.708) [-2037.802] * [-2037.446] (-2041.276) (-2040.583) (-2039.539) -- 0:03:10
314000 -- (-2039.818) (-2045.198) [-2032.496] (-2037.851) * [-2032.244] (-2043.527) (-2046.171) (-2042.712) -- 0:03:10
314500 -- (-2034.168) (-2046.553) (-2036.736) [-2043.634] * (-2037.230) [-2039.024] (-2030.934) (-2036.793) -- 0:03:11
315000 -- [-2035.380] (-2038.102) (-2041.324) (-2046.236) * [-2036.946] (-2036.787) (-2033.089) (-2041.825) -- 0:03:11
Average standard deviation of split frequencies: 0.004102
315500 -- [-2036.068] (-2040.636) (-2040.563) (-2039.955) * [-2036.912] (-2033.831) (-2037.939) (-2041.197) -- 0:03:10
316000 -- [-2034.168] (-2044.629) (-2038.326) (-2039.750) * [-2039.633] (-2034.472) (-2036.941) (-2048.763) -- 0:03:10
316500 -- (-2040.712) (-2036.444) (-2039.806) [-2035.554] * [-2040.267] (-2041.321) (-2043.447) (-2039.392) -- 0:03:10
317000 -- (-2031.754) [-2035.818] (-2040.422) (-2036.692) * (-2040.381) [-2038.346] (-2034.220) (-2038.843) -- 0:03:09
317500 -- [-2033.833] (-2032.035) (-2039.304) (-2040.908) * (-2035.975) (-2042.737) [-2033.744] (-2036.201) -- 0:03:09
318000 -- [-2040.218] (-2042.469) (-2034.497) (-2033.599) * (-2039.991) [-2040.887] (-2039.129) (-2034.776) -- 0:03:10
318500 -- (-2038.148) (-2039.602) [-2035.551] (-2037.996) * (-2034.382) (-2039.078) (-2040.939) [-2037.914] -- 0:03:10
319000 -- (-2037.466) (-2041.540) [-2034.772] (-2044.277) * [-2042.239] (-2042.013) (-2043.135) (-2035.248) -- 0:03:09
319500 -- (-2038.450) (-2040.566) [-2033.309] (-2040.657) * (-2038.556) (-2038.351) (-2040.988) [-2036.398] -- 0:03:09
320000 -- (-2035.121) (-2040.583) [-2033.145] (-2039.191) * (-2036.065) (-2041.210) (-2042.220) [-2035.565] -- 0:03:09
Average standard deviation of split frequencies: 0.002940
320500 -- (-2039.457) [-2036.114] (-2036.396) (-2037.806) * (-2032.511) [-2033.256] (-2036.355) (-2033.658) -- 0:03:08
321000 -- (-2035.219) [-2037.902] (-2032.255) (-2044.560) * [-2032.053] (-2033.004) (-2037.255) (-2036.381) -- 0:03:08
321500 -- [-2030.593] (-2036.085) (-2048.520) (-2038.814) * (-2043.576) [-2035.146] (-2040.069) (-2035.295) -- 0:03:09
322000 -- [-2039.487] (-2035.261) (-2044.223) (-2038.457) * (-2046.269) (-2042.370) (-2036.427) [-2034.608] -- 0:03:09
322500 -- (-2036.687) (-2033.123) (-2045.123) [-2035.881] * (-2048.582) (-2039.645) [-2034.240] (-2034.726) -- 0:03:09
323000 -- (-2039.765) (-2037.588) [-2042.977] (-2037.779) * (-2043.165) [-2037.520] (-2034.420) (-2035.667) -- 0:03:08
323500 -- [-2031.105] (-2038.661) (-2034.151) (-2036.617) * [-2044.622] (-2034.508) (-2030.419) (-2039.840) -- 0:03:08
324000 -- (-2036.546) (-2036.963) [-2039.990] (-2033.927) * (-2035.700) (-2030.954) [-2035.451] (-2035.138) -- 0:03:07
324500 -- [-2037.221] (-2036.578) (-2036.442) (-2035.243) * (-2033.603) [-2033.155] (-2038.794) (-2039.566) -- 0:03:07
325000 -- (-2041.391) (-2037.383) (-2043.158) [-2041.508] * (-2037.982) (-2035.103) (-2042.694) [-2034.741] -- 0:03:08
Average standard deviation of split frequencies: 0.003615
325500 -- (-2043.535) [-2045.106] (-2039.284) (-2039.143) * (-2043.317) (-2043.964) [-2046.085] (-2033.749) -- 0:03:08
326000 -- (-2044.737) [-2034.975] (-2032.573) (-2037.976) * (-2041.377) (-2031.694) [-2034.155] (-2032.570) -- 0:03:08
326500 -- (-2039.817) [-2038.106] (-2041.555) (-2041.418) * (-2043.834) (-2036.948) [-2035.690] (-2045.398) -- 0:03:07
327000 -- [-2039.441] (-2040.415) (-2040.896) (-2044.754) * (-2038.430) (-2036.612) [-2033.470] (-2033.841) -- 0:03:07
327500 -- (-2036.661) (-2044.757) [-2035.007] (-2038.199) * [-2040.811] (-2039.834) (-2045.549) (-2040.349) -- 0:03:06
328000 -- (-2047.190) [-2038.687] (-2035.664) (-2043.206) * (-2046.135) (-2036.729) [-2040.430] (-2034.651) -- 0:03:06
328500 -- (-2037.809) [-2039.639] (-2034.962) (-2040.600) * [-2041.526] (-2033.369) (-2033.758) (-2034.810) -- 0:03:06
329000 -- (-2043.893) (-2038.771) [-2037.148] (-2047.460) * [-2039.304] (-2036.979) (-2038.132) (-2037.200) -- 0:03:07
329500 -- [-2032.462] (-2036.930) (-2037.215) (-2042.452) * [-2033.772] (-2043.913) (-2036.012) (-2034.917) -- 0:03:07
330000 -- (-2033.664) [-2037.472] (-2035.847) (-2042.903) * (-2032.971) [-2034.501] (-2035.692) (-2035.069) -- 0:03:06
Average standard deviation of split frequencies: 0.003208
330500 -- [-2035.135] (-2037.361) (-2038.179) (-2046.038) * (-2035.843) (-2032.377) [-2037.911] (-2034.189) -- 0:03:06
331000 -- [-2035.270] (-2031.601) (-2035.425) (-2042.739) * [-2034.622] (-2040.485) (-2041.646) (-2036.092) -- 0:03:05
331500 -- [-2036.882] (-2036.468) (-2039.008) (-2046.645) * (-2037.226) (-2042.380) (-2044.688) [-2033.255] -- 0:03:05
332000 -- (-2037.436) [-2035.952] (-2041.082) (-2046.174) * (-2037.560) (-2037.202) (-2036.624) [-2035.756] -- 0:03:05
332500 -- (-2037.920) [-2038.277] (-2034.241) (-2036.276) * (-2035.810) (-2036.885) (-2034.517) [-2034.095] -- 0:03:06
333000 -- [-2036.261] (-2036.727) (-2035.360) (-2041.364) * [-2035.844] (-2041.705) (-2040.937) (-2037.522) -- 0:03:06
333500 -- (-2045.153) [-2035.012] (-2045.464) (-2037.125) * [-2036.741] (-2035.854) (-2047.297) (-2035.234) -- 0:03:05
334000 -- (-2043.432) (-2037.402) (-2036.813) [-2034.092] * (-2034.840) [-2037.893] (-2036.234) (-2031.927) -- 0:03:05
334500 -- [-2035.357] (-2036.617) (-2040.492) (-2039.835) * (-2037.048) (-2037.457) (-2031.998) [-2039.899] -- 0:03:05
335000 -- (-2036.938) (-2044.550) [-2037.735] (-2035.631) * (-2041.985) (-2036.809) (-2038.981) [-2035.902] -- 0:03:04
Average standard deviation of split frequencies: 0.004209
335500 -- (-2037.292) (-2043.715) (-2044.211) [-2030.373] * (-2038.772) (-2033.866) (-2038.824) [-2032.697] -- 0:03:04
336000 -- (-2034.959) [-2045.452] (-2045.647) (-2032.972) * (-2047.706) (-2036.901) (-2041.443) [-2034.650] -- 0:03:05
336500 -- (-2037.136) (-2043.433) [-2037.991] (-2031.490) * (-2040.965) (-2038.569) (-2035.346) [-2038.863] -- 0:03:05
337000 -- (-2039.268) (-2036.679) (-2039.690) [-2034.224] * (-2046.091) (-2032.587) (-2035.717) [-2033.622] -- 0:03:04
337500 -- (-2034.937) [-2037.463] (-2040.058) (-2036.762) * (-2039.838) (-2038.113) [-2038.534] (-2041.199) -- 0:03:04
338000 -- (-2039.469) [-2034.640] (-2035.007) (-2035.049) * (-2037.253) (-2039.688) (-2040.162) [-2032.974] -- 0:03:04
338500 -- (-2035.897) [-2034.250] (-2030.541) (-2039.904) * (-2039.361) (-2032.298) [-2042.442] (-2035.642) -- 0:03:03
339000 -- [-2040.045] (-2035.812) (-2044.942) (-2035.769) * [-2035.569] (-2036.057) (-2039.203) (-2036.298) -- 0:03:03
339500 -- [-2036.777] (-2040.508) (-2043.305) (-2044.468) * (-2036.546) (-2036.859) (-2035.827) [-2035.653] -- 0:03:04
340000 -- (-2034.302) (-2038.021) (-2049.408) [-2036.257] * (-2034.027) (-2037.197) [-2037.650] (-2040.541) -- 0:03:04
Average standard deviation of split frequencies: 0.004843
340500 -- [-2037.901] (-2035.900) (-2042.836) (-2037.980) * [-2034.245] (-2031.369) (-2034.176) (-2052.602) -- 0:03:04
341000 -- (-2037.844) [-2040.920] (-2038.945) (-2032.897) * (-2043.340) (-2038.064) (-2038.121) [-2035.545] -- 0:03:03
341500 -- (-2035.160) [-2037.321] (-2035.928) (-2041.817) * (-2039.107) (-2035.365) (-2039.110) [-2039.136] -- 0:03:03
342000 -- (-2034.664) (-2038.330) [-2045.140] (-2039.009) * (-2038.279) (-2034.658) [-2042.241] (-2036.255) -- 0:03:02
342500 -- (-2033.843) [-2038.564] (-2041.605) (-2037.412) * (-2037.201) (-2037.088) [-2036.611] (-2040.639) -- 0:03:02
343000 -- (-2034.360) [-2041.698] (-2037.043) (-2037.226) * (-2038.778) (-2034.181) [-2042.113] (-2043.383) -- 0:03:01
343500 -- (-2039.055) [-2038.818] (-2038.096) (-2032.563) * (-2042.704) (-2035.994) (-2035.865) [-2037.719] -- 0:03:03
344000 -- [-2040.611] (-2039.354) (-2037.168) (-2030.698) * [-2037.507] (-2039.827) (-2037.195) (-2042.288) -- 0:03:03
344500 -- (-2035.667) [-2040.099] (-2043.158) (-2034.098) * [-2031.800] (-2037.134) (-2041.964) (-2039.060) -- 0:03:02
345000 -- [-2037.595] (-2037.511) (-2046.850) (-2034.588) * (-2036.976) (-2032.562) [-2037.256] (-2035.979) -- 0:03:02
Average standard deviation of split frequencies: 0.003747
345500 -- (-2040.917) [-2036.745] (-2035.864) (-2046.673) * (-2043.106) (-2047.181) [-2035.057] (-2040.851) -- 0:03:01
346000 -- [-2034.693] (-2038.443) (-2032.668) (-2037.327) * (-2038.260) (-2040.604) (-2036.080) [-2039.769] -- 0:03:01
346500 -- (-2034.529) (-2035.304) (-2037.948) [-2041.895] * [-2037.467] (-2034.308) (-2036.435) (-2036.535) -- 0:03:01
347000 -- (-2038.503) (-2035.573) [-2030.992] (-2038.414) * (-2039.665) (-2037.629) [-2040.310] (-2043.005) -- 0:03:02
347500 -- (-2034.608) [-2036.670] (-2037.856) (-2039.416) * (-2034.503) (-2042.275) [-2038.666] (-2034.969) -- 0:03:02
348000 -- (-2039.507) (-2035.304) [-2038.822] (-2034.632) * (-2042.096) (-2041.321) (-2037.064) [-2037.170] -- 0:03:01
348500 -- (-2034.743) (-2044.005) (-2033.747) [-2040.209] * (-2034.315) (-2045.724) (-2049.374) [-2032.328] -- 0:03:01
349000 -- [-2034.186] (-2038.951) (-2044.238) (-2036.606) * (-2036.977) (-2044.524) [-2037.982] (-2033.756) -- 0:03:00
349500 -- (-2036.596) (-2041.750) [-2043.476] (-2043.834) * (-2039.558) (-2044.643) [-2033.298] (-2038.166) -- 0:03:00
350000 -- [-2039.947] (-2039.512) (-2044.387) (-2032.396) * (-2042.308) (-2048.040) [-2036.475] (-2036.038) -- 0:03:00
Average standard deviation of split frequencies: 0.002353
350500 -- (-2036.092) (-2043.665) (-2038.963) [-2035.940] * [-2033.653] (-2045.343) (-2038.521) (-2041.592) -- 0:03:01
351000 -- (-2037.300) [-2038.660] (-2038.172) (-2040.195) * [-2031.403] (-2033.078) (-2039.783) (-2036.980) -- 0:03:01
351500 -- (-2035.782) (-2037.485) [-2037.540] (-2036.114) * [-2038.911] (-2035.223) (-2038.067) (-2041.441) -- 0:03:00
352000 -- (-2040.928) [-2042.035] (-2033.937) (-2035.193) * [-2040.573] (-2044.146) (-2040.582) (-2040.241) -- 0:03:00
352500 -- (-2038.234) (-2041.975) (-2039.095) [-2033.434] * (-2036.772) (-2034.751) (-2036.415) [-2032.897] -- 0:03:00
353000 -- (-2036.399) (-2042.320) [-2032.588] (-2035.681) * [-2035.214] (-2035.976) (-2038.419) (-2036.979) -- 0:02:59
353500 -- [-2044.157] (-2038.377) (-2036.675) (-2041.612) * (-2036.213) [-2043.511] (-2038.192) (-2045.876) -- 0:02:59
354000 -- (-2035.289) (-2033.363) (-2032.929) [-2044.268] * (-2039.500) (-2042.937) (-2035.374) [-2036.854] -- 0:03:00
354500 -- [-2032.933] (-2032.334) (-2034.710) (-2041.948) * [-2043.209] (-2038.641) (-2034.005) (-2033.263) -- 0:03:00
355000 -- (-2035.437) [-2038.927] (-2032.192) (-2041.283) * (-2038.525) (-2047.881) [-2034.275] (-2041.528) -- 0:02:59
Average standard deviation of split frequencies: 0.001986
355500 -- (-2035.378) (-2039.525) [-2036.172] (-2039.732) * (-2036.906) (-2043.249) [-2036.911] (-2043.822) -- 0:02:59
356000 -- [-2037.370] (-2041.336) (-2039.973) (-2034.621) * (-2039.646) (-2032.074) (-2038.169) [-2039.286] -- 0:02:59
356500 -- (-2047.852) (-2045.677) (-2034.705) [-2035.934] * (-2036.941) (-2036.438) [-2036.134] (-2037.102) -- 0:02:58
357000 -- [-2036.525] (-2034.974) (-2038.143) (-2036.679) * (-2038.746) (-2039.071) [-2035.780] (-2034.209) -- 0:02:58
357500 -- (-2033.987) (-2048.312) [-2034.249] (-2036.060) * (-2039.290) (-2031.987) (-2045.639) [-2039.284] -- 0:02:57
358000 -- (-2036.341) (-2046.440) [-2035.956] (-2031.624) * (-2036.622) [-2035.890] (-2043.260) (-2038.092) -- 0:02:59
358500 -- (-2034.440) (-2038.501) (-2033.622) [-2035.994] * (-2043.167) (-2036.147) (-2042.351) [-2042.822] -- 0:02:58
359000 -- [-2035.290] (-2039.000) (-2034.502) (-2038.867) * [-2032.521] (-2033.278) (-2038.018) (-2040.673) -- 0:02:58
359500 -- (-2034.992) [-2041.785] (-2040.333) (-2052.519) * (-2036.221) [-2034.374] (-2041.214) (-2038.241) -- 0:02:58
360000 -- (-2040.870) [-2035.401] (-2042.740) (-2039.418) * (-2034.233) (-2038.995) [-2033.526] (-2040.247) -- 0:02:57
Average standard deviation of split frequencies: 0.002287
360500 -- (-2033.802) (-2041.345) (-2035.216) [-2033.193] * (-2039.975) (-2033.475) [-2035.986] (-2031.787) -- 0:02:57
361000 -- [-2039.073] (-2037.640) (-2038.098) (-2037.896) * (-2039.968) (-2034.198) (-2038.454) [-2030.615] -- 0:02:57
361500 -- (-2038.924) (-2040.361) [-2041.365] (-2041.177) * (-2040.787) [-2035.694] (-2036.000) (-2040.013) -- 0:02:58
362000 -- (-2039.826) (-2039.048) (-2040.167) [-2034.426] * (-2040.788) (-2033.069) (-2035.746) [-2042.637] -- 0:02:58
362500 -- (-2042.429) (-2040.493) [-2034.293] (-2042.808) * (-2036.955) [-2036.793] (-2035.121) (-2036.809) -- 0:02:57
363000 -- (-2034.259) [-2042.930] (-2039.910) (-2044.034) * (-2033.431) (-2035.689) (-2030.852) [-2034.520] -- 0:02:57
363500 -- (-2039.562) [-2037.743] (-2044.083) (-2040.706) * (-2032.234) (-2043.831) (-2039.058) [-2039.099] -- 0:02:56
364000 -- (-2036.836) (-2035.522) (-2041.170) [-2040.219] * (-2035.318) [-2036.052] (-2042.658) (-2036.882) -- 0:02:56
364500 -- [-2034.318] (-2043.180) (-2034.928) (-2048.853) * (-2035.587) (-2043.213) (-2033.293) [-2037.842] -- 0:02:56
365000 -- (-2037.645) (-2041.642) (-2037.935) [-2035.697] * [-2033.384] (-2042.632) (-2039.783) (-2039.456) -- 0:02:57
Average standard deviation of split frequencies: 0.002576
365500 -- (-2036.161) (-2050.292) [-2036.674] (-2035.588) * (-2041.907) (-2036.586) (-2038.139) [-2040.255] -- 0:02:57
366000 -- (-2038.985) (-2032.767) [-2037.317] (-2038.957) * (-2035.635) (-2037.056) (-2041.371) [-2030.885] -- 0:02:56
366500 -- (-2033.579) (-2044.902) [-2036.358] (-2040.846) * (-2036.902) [-2036.721] (-2037.119) (-2038.842) -- 0:02:56
367000 -- (-2037.258) (-2042.659) (-2038.668) [-2042.924] * (-2036.730) (-2034.227) [-2035.308] (-2038.595) -- 0:02:55
367500 -- (-2033.987) (-2037.477) (-2044.105) [-2031.555] * (-2033.558) [-2039.530] (-2039.671) (-2034.074) -- 0:02:55
368000 -- [-2034.690] (-2037.018) (-2042.441) (-2038.158) * (-2032.569) (-2034.968) [-2034.795] (-2040.984) -- 0:02:55
368500 -- (-2036.927) [-2038.814] (-2035.900) (-2043.979) * (-2036.267) (-2034.250) [-2037.015] (-2037.307) -- 0:02:56
369000 -- (-2045.408) [-2037.541] (-2036.289) (-2048.346) * [-2039.225] (-2043.706) (-2034.722) (-2039.147) -- 0:02:56
369500 -- (-2033.344) (-2034.934) [-2035.332] (-2040.736) * (-2036.354) (-2036.227) [-2036.647] (-2036.128) -- 0:02:55
370000 -- [-2032.119] (-2034.958) (-2034.326) (-2041.365) * (-2046.521) (-2040.988) (-2038.343) [-2035.312] -- 0:02:55
Average standard deviation of split frequencies: 0.002544
370500 -- (-2041.418) (-2036.762) (-2043.204) [-2036.788] * [-2037.217] (-2036.213) (-2038.995) (-2038.718) -- 0:02:55
371000 -- (-2036.969) (-2039.250) [-2039.854] (-2043.432) * (-2037.738) (-2035.963) (-2042.944) [-2034.816] -- 0:02:54
371500 -- (-2035.913) [-2034.179] (-2039.382) (-2040.938) * (-2039.663) [-2036.523] (-2034.280) (-2036.413) -- 0:02:54
372000 -- (-2043.744) (-2036.222) (-2042.453) [-2044.505] * (-2033.566) (-2032.148) [-2040.718] (-2039.295) -- 0:02:55
372500 -- (-2041.414) [-2034.567] (-2042.318) (-2039.822) * (-2045.989) (-2033.941) [-2041.224] (-2040.981) -- 0:02:55
373000 -- (-2048.284) [-2037.701] (-2034.821) (-2038.679) * (-2036.055) (-2035.031) (-2039.246) [-2036.048] -- 0:02:54
373500 -- (-2036.426) (-2034.054) (-2038.756) [-2032.937] * [-2035.109] (-2035.623) (-2035.394) (-2036.550) -- 0:02:54
374000 -- (-2036.486) (-2036.904) (-2039.740) [-2034.098] * [-2032.591] (-2034.424) (-2039.405) (-2046.321) -- 0:02:54
374500 -- (-2050.851) (-2042.970) (-2044.159) [-2036.058] * (-2038.574) (-2039.545) (-2031.333) [-2038.369] -- 0:02:53
375000 -- (-2038.101) [-2034.166] (-2039.324) (-2031.524) * (-2037.666) [-2038.771] (-2040.521) (-2052.296) -- 0:02:53
Average standard deviation of split frequencies: 0.002507
375500 -- (-2040.336) (-2041.800) (-2033.140) [-2037.570] * (-2039.965) [-2037.291] (-2037.303) (-2040.875) -- 0:02:54
376000 -- (-2039.091) [-2036.571] (-2039.113) (-2034.697) * (-2035.506) (-2034.635) [-2037.854] (-2038.303) -- 0:02:54
376500 -- (-2041.516) (-2038.042) [-2041.563] (-2034.843) * (-2040.627) (-2032.687) [-2037.647] (-2037.223) -- 0:02:53
377000 -- (-2057.110) (-2036.299) [-2036.712] (-2036.762) * (-2034.834) [-2036.853] (-2036.456) (-2038.153) -- 0:02:53
377500 -- (-2045.826) (-2048.273) (-2035.017) [-2034.320] * [-2034.064] (-2039.355) (-2034.152) (-2034.021) -- 0:02:53
378000 -- (-2044.180) (-2034.548) [-2035.193] (-2036.381) * (-2034.448) (-2037.218) [-2035.431] (-2035.700) -- 0:02:52
378500 -- (-2048.966) (-2039.538) (-2041.641) [-2036.754] * (-2042.810) (-2038.515) [-2036.433] (-2039.264) -- 0:02:52
379000 -- (-2042.040) [-2038.328] (-2045.564) (-2041.373) * (-2038.661) (-2037.625) (-2040.926) [-2034.589] -- 0:02:53
379500 -- (-2045.455) (-2038.689) [-2033.353] (-2040.945) * (-2044.113) [-2038.411] (-2036.277) (-2034.855) -- 0:02:53
380000 -- (-2046.972) (-2039.998) [-2034.665] (-2033.028) * (-2038.998) (-2035.864) [-2034.654] (-2040.786) -- 0:02:52
Average standard deviation of split frequencies: 0.003096
380500 -- [-2039.097] (-2039.515) (-2033.941) (-2039.383) * [-2033.158] (-2036.035) (-2037.120) (-2035.550) -- 0:02:52
381000 -- (-2036.418) (-2035.341) (-2044.762) [-2037.289] * (-2041.403) [-2036.802] (-2036.618) (-2039.871) -- 0:02:52
381500 -- (-2037.466) [-2032.662] (-2039.690) (-2035.065) * (-2040.408) [-2033.201] (-2037.170) (-2032.273) -- 0:02:51
382000 -- [-2031.858] (-2036.301) (-2044.024) (-2035.358) * (-2045.078) (-2036.554) (-2033.222) [-2034.353] -- 0:02:51
382500 -- (-2037.477) (-2041.709) (-2040.418) [-2033.204] * (-2042.358) (-2039.535) (-2036.973) [-2031.537] -- 0:02:51
383000 -- (-2034.835) (-2032.613) (-2043.714) [-2034.373] * (-2040.766) (-2035.876) (-2038.977) [-2037.882] -- 0:02:52
383500 -- (-2036.503) (-2036.795) (-2048.776) [-2033.491] * (-2044.899) (-2034.927) [-2032.297] (-2039.770) -- 0:02:52
384000 -- (-2036.873) (-2039.384) [-2037.208] (-2035.119) * (-2038.988) [-2034.353] (-2035.766) (-2042.503) -- 0:02:51
384500 -- (-2036.372) (-2040.712) (-2037.946) [-2033.323] * (-2041.535) (-2039.476) [-2037.075] (-2037.506) -- 0:02:51
385000 -- (-2038.391) (-2043.052) (-2040.651) [-2034.772] * [-2036.035] (-2040.586) (-2036.536) (-2043.769) -- 0:02:50
Average standard deviation of split frequencies: 0.003053
385500 -- (-2037.262) (-2049.525) (-2044.759) [-2032.404] * (-2044.399) (-2033.413) (-2034.284) [-2033.832] -- 0:02:50
386000 -- [-2039.669] (-2043.952) (-2043.087) (-2036.971) * (-2035.503) (-2036.615) [-2042.033] (-2035.965) -- 0:02:50
386500 -- [-2043.447] (-2040.840) (-2037.948) (-2040.070) * (-2036.665) (-2036.588) (-2038.470) [-2032.782] -- 0:02:51
387000 -- (-2035.294) (-2041.178) (-2042.295) [-2039.166] * [-2037.806] (-2034.561) (-2034.752) (-2034.856) -- 0:02:51
387500 -- [-2033.341] (-2037.555) (-2035.285) (-2037.446) * (-2041.119) (-2037.042) [-2033.443] (-2037.521) -- 0:02:50
388000 -- [-2034.167] (-2035.418) (-2037.475) (-2035.502) * (-2038.231) [-2040.166] (-2035.179) (-2045.512) -- 0:02:50
388500 -- (-2032.812) (-2041.948) [-2030.189] (-2037.351) * (-2034.095) (-2042.996) (-2036.452) [-2033.717] -- 0:02:49
389000 -- (-2040.709) [-2034.357] (-2035.510) (-2036.842) * [-2036.268] (-2040.468) (-2033.581) (-2035.874) -- 0:02:49
389500 -- (-2038.107) (-2038.120) (-2037.970) [-2035.605] * (-2036.704) (-2036.482) (-2033.569) [-2033.367] -- 0:02:49
390000 -- [-2033.228] (-2041.398) (-2035.897) (-2037.505) * [-2035.569] (-2038.854) (-2037.108) (-2041.164) -- 0:02:50
Average standard deviation of split frequencies: 0.003318
390500 -- [-2035.621] (-2046.664) (-2033.847) (-2034.486) * (-2041.335) (-2040.462) [-2033.442] (-2039.574) -- 0:02:50
391000 -- (-2039.740) (-2038.765) [-2032.104] (-2036.851) * (-2034.843) (-2038.013) (-2039.481) [-2035.690] -- 0:02:49
391500 -- (-2033.863) (-2039.861) [-2036.023] (-2031.983) * [-2032.442] (-2036.379) (-2038.054) (-2037.662) -- 0:02:49
392000 -- (-2036.878) [-2037.763] (-2042.932) (-2046.983) * [-2034.222] (-2037.658) (-2039.565) (-2037.938) -- 0:02:49
392500 -- [-2035.247] (-2037.408) (-2044.619) (-2039.348) * (-2036.474) (-2039.241) [-2036.938] (-2043.520) -- 0:02:48
393000 -- [-2038.476] (-2040.649) (-2033.027) (-2043.869) * (-2032.636) [-2033.092] (-2043.505) (-2035.604) -- 0:02:48
393500 -- (-2035.589) [-2034.651] (-2042.983) (-2040.305) * (-2037.366) [-2036.868] (-2037.682) (-2040.217) -- 0:02:49
394000 -- (-2041.779) [-2035.284] (-2035.013) (-2046.702) * (-2033.626) (-2044.765) (-2037.562) [-2038.658] -- 0:02:49
394500 -- (-2036.663) (-2038.648) [-2034.144] (-2035.886) * (-2035.325) (-2049.939) [-2036.286] (-2039.240) -- 0:02:48
395000 -- (-2034.644) (-2040.494) [-2033.287] (-2032.243) * [-2035.586] (-2033.753) (-2041.977) (-2035.621) -- 0:02:48
Average standard deviation of split frequencies: 0.003274
395500 -- (-2041.261) (-2040.344) [-2040.471] (-2035.983) * (-2040.526) (-2035.634) (-2039.259) [-2038.748] -- 0:02:48
396000 -- (-2042.638) (-2034.894) [-2035.990] (-2041.391) * (-2047.312) (-2034.929) [-2039.270] (-2036.174) -- 0:02:47
396500 -- (-2036.982) [-2042.252] (-2040.306) (-2036.464) * [-2047.145] (-2033.731) (-2043.071) (-2037.874) -- 0:02:47
397000 -- (-2038.648) (-2036.199) (-2038.103) [-2032.485] * (-2047.908) (-2034.927) (-2035.946) [-2034.790] -- 0:02:48
397500 -- [-2035.183] (-2036.893) (-2037.050) (-2035.079) * (-2048.508) (-2036.549) (-2037.523) [-2034.916] -- 0:02:48
398000 -- [-2040.866] (-2041.924) (-2035.993) (-2042.206) * (-2043.023) [-2042.312] (-2043.399) (-2043.135) -- 0:02:47
398500 -- (-2036.909) (-2033.948) [-2040.554] (-2036.699) * (-2038.552) (-2038.215) [-2038.285] (-2036.075) -- 0:02:47
399000 -- (-2038.128) [-2036.565] (-2042.008) (-2038.837) * (-2044.720) (-2046.368) (-2043.838) [-2037.497] -- 0:02:47
399500 -- [-2039.044] (-2037.294) (-2048.492) (-2042.191) * (-2040.080) [-2037.901] (-2041.996) (-2035.967) -- 0:02:46
400000 -- (-2034.570) [-2035.046] (-2049.561) (-2037.859) * (-2034.187) [-2034.721] (-2042.303) (-2040.562) -- 0:02:46
Average standard deviation of split frequencies: 0.003530
400500 -- [-2035.708] (-2032.806) (-2040.787) (-2034.993) * (-2043.178) (-2052.291) [-2037.281] (-2036.921) -- 0:02:47
401000 -- (-2034.494) [-2034.431] (-2039.821) (-2037.234) * [-2038.151] (-2037.419) (-2038.358) (-2034.421) -- 0:02:47
401500 -- [-2032.959] (-2036.484) (-2039.851) (-2042.982) * (-2034.907) (-2037.388) (-2035.359) [-2038.033] -- 0:02:46
402000 -- (-2036.877) (-2034.598) (-2042.680) [-2034.658] * [-2041.605] (-2032.166) (-2032.938) (-2044.969) -- 0:02:46
402500 -- (-2040.105) (-2039.577) [-2032.934] (-2038.738) * (-2040.208) [-2032.379] (-2033.021) (-2038.680) -- 0:02:46
403000 -- (-2041.915) (-2034.038) (-2041.980) [-2036.420] * [-2034.389] (-2039.922) (-2042.562) (-2037.390) -- 0:02:45
403500 -- (-2047.560) [-2042.349] (-2035.254) (-2034.998) * (-2035.621) (-2038.208) (-2037.750) [-2031.814] -- 0:02:45
404000 -- (-2042.356) (-2037.552) (-2037.380) [-2035.472] * (-2040.282) (-2037.846) [-2035.139] (-2035.911) -- 0:02:46
404500 -- (-2034.583) (-2037.612) (-2036.908) [-2036.552] * (-2038.580) [-2038.312] (-2036.607) (-2039.851) -- 0:02:46
405000 -- (-2038.576) (-2037.833) (-2036.453) [-2031.452] * [-2039.021] (-2035.053) (-2036.815) (-2050.274) -- 0:02:46
Average standard deviation of split frequencies: 0.003193
405500 -- (-2038.451) (-2034.423) (-2046.669) [-2039.351] * (-2039.203) (-2039.257) [-2030.630] (-2035.001) -- 0:02:45
406000 -- [-2034.824] (-2038.795) (-2042.989) (-2034.096) * (-2036.090) (-2034.388) [-2033.639] (-2032.673) -- 0:02:45
406500 -- (-2034.590) [-2033.456] (-2036.186) (-2034.554) * (-2036.180) (-2033.530) [-2032.478] (-2033.310) -- 0:02:44
407000 -- (-2036.161) (-2037.979) (-2037.311) [-2039.261] * (-2037.308) (-2036.252) [-2032.745] (-2044.135) -- 0:02:44
407500 -- (-2033.503) (-2035.360) [-2033.755] (-2032.644) * (-2039.653) (-2031.478) (-2045.125) [-2040.211] -- 0:02:45
408000 -- [-2033.150] (-2049.866) (-2038.694) (-2040.334) * (-2043.985) [-2040.512] (-2038.648) (-2038.977) -- 0:02:45
408500 -- (-2041.890) (-2041.294) [-2036.490] (-2035.049) * (-2049.484) (-2032.739) [-2033.043] (-2034.298) -- 0:02:45
409000 -- (-2037.596) [-2039.898] (-2038.373) (-2037.919) * (-2037.737) (-2036.434) [-2037.868] (-2044.560) -- 0:02:44
409500 -- [-2037.400] (-2042.914) (-2033.164) (-2039.623) * (-2039.371) (-2037.804) (-2038.002) [-2036.523] -- 0:02:44
410000 -- (-2052.311) (-2037.268) (-2038.959) [-2040.978] * (-2034.395) (-2041.680) [-2032.551] (-2038.551) -- 0:02:44
Average standard deviation of split frequencies: 0.003157
410500 -- (-2037.664) (-2039.885) [-2033.985] (-2033.416) * (-2033.626) (-2037.538) [-2037.696] (-2032.760) -- 0:02:43
411000 -- (-2037.794) [-2040.690] (-2034.002) (-2038.727) * (-2035.505) [-2038.256] (-2040.917) (-2043.658) -- 0:02:43
411500 -- (-2033.701) (-2040.141) [-2043.525] (-2036.583) * (-2034.431) [-2036.213] (-2041.936) (-2038.471) -- 0:02:44
412000 -- (-2039.867) (-2040.603) [-2037.163] (-2034.263) * [-2035.534] (-2037.525) (-2052.431) (-2043.279) -- 0:02:44
412500 -- (-2034.145) (-2043.857) (-2032.220) [-2038.123] * [-2043.299] (-2033.498) (-2044.067) (-2037.739) -- 0:02:43
413000 -- [-2031.505] (-2044.781) (-2039.122) (-2039.760) * (-2035.041) (-2036.601) (-2041.201) [-2035.607] -- 0:02:43
413500 -- (-2035.328) (-2042.323) [-2033.696] (-2036.503) * (-2043.595) (-2032.681) [-2041.270] (-2043.211) -- 0:02:43
414000 -- (-2041.645) (-2041.001) [-2036.542] (-2035.883) * (-2051.421) (-2039.889) [-2037.172] (-2040.857) -- 0:02:42
414500 -- (-2041.359) (-2038.371) (-2028.655) [-2035.727] * (-2034.300) (-2039.223) (-2043.536) [-2037.148] -- 0:02:42
415000 -- [-2038.728] (-2038.907) (-2034.126) (-2035.184) * [-2035.580] (-2038.822) (-2040.479) (-2032.514) -- 0:02:43
Average standard deviation of split frequencies: 0.003116
415500 -- (-2039.079) (-2046.632) [-2038.273] (-2037.757) * (-2035.470) [-2035.776] (-2040.546) (-2040.006) -- 0:02:43
416000 -- [-2040.503] (-2045.424) (-2038.075) (-2044.697) * [-2039.934] (-2040.092) (-2037.671) (-2043.048) -- 0:02:42
416500 -- (-2035.618) (-2048.239) (-2037.102) [-2040.266] * (-2038.720) [-2032.634] (-2038.068) (-2032.462) -- 0:02:42
417000 -- (-2036.222) (-2041.649) [-2039.081] (-2042.381) * (-2037.487) (-2041.574) [-2031.237] (-2031.266) -- 0:02:42
417500 -- (-2035.405) (-2047.886) [-2030.651] (-2035.420) * (-2033.432) (-2035.969) (-2034.948) [-2035.258] -- 0:02:41
418000 -- [-2038.709] (-2038.619) (-2034.059) (-2036.333) * [-2037.164] (-2037.187) (-2035.276) (-2040.704) -- 0:02:41
418500 -- (-2038.322) (-2039.350) [-2037.488] (-2045.610) * (-2039.631) (-2037.682) [-2042.142] (-2036.813) -- 0:02:42
419000 -- (-2037.336) (-2043.796) [-2033.489] (-2037.475) * (-2034.248) [-2034.069] (-2046.566) (-2038.982) -- 0:02:42
419500 -- (-2036.672) (-2048.366) (-2036.332) [-2031.574] * (-2034.974) [-2039.848] (-2034.822) (-2036.398) -- 0:02:41
420000 -- (-2038.990) [-2034.525] (-2036.675) (-2039.230) * [-2036.942] (-2038.145) (-2033.998) (-2037.650) -- 0:02:41
Average standard deviation of split frequencies: 0.003082
420500 -- (-2033.551) [-2035.206] (-2041.184) (-2037.502) * [-2038.751] (-2037.865) (-2036.044) (-2038.035) -- 0:02:41
421000 -- [-2031.987] (-2041.678) (-2037.982) (-2039.686) * (-2035.185) (-2047.081) (-2036.604) [-2043.099] -- 0:02:40
421500 -- [-2033.624] (-2035.764) (-2038.351) (-2039.707) * (-2030.427) (-2035.326) (-2036.886) [-2033.319] -- 0:02:40
422000 -- [-2035.108] (-2037.329) (-2036.131) (-2039.917) * [-2040.860] (-2038.058) (-2040.587) (-2033.808) -- 0:02:41
422500 -- [-2035.750] (-2042.806) (-2036.915) (-2037.902) * [-2038.540] (-2038.037) (-2046.374) (-2032.397) -- 0:02:41
423000 -- (-2052.526) [-2032.407] (-2037.488) (-2035.169) * (-2041.040) (-2043.341) [-2034.643] (-2035.780) -- 0:02:40
423500 -- (-2042.158) (-2036.559) [-2035.942] (-2036.353) * [-2035.432] (-2035.410) (-2034.810) (-2036.724) -- 0:02:40
424000 -- (-2034.027) (-2036.605) (-2045.224) [-2038.446] * (-2039.175) (-2033.393) (-2037.275) [-2038.658] -- 0:02:40
424500 -- (-2037.372) [-2030.712] (-2039.900) (-2037.881) * [-2031.305] (-2039.238) (-2036.065) (-2037.012) -- 0:02:39
425000 -- (-2031.628) (-2033.129) (-2042.172) [-2036.080] * (-2032.080) (-2039.270) (-2047.432) [-2039.230] -- 0:02:39
Average standard deviation of split frequencies: 0.003043
425500 -- (-2033.338) (-2045.848) (-2046.340) [-2037.976] * [-2033.344] (-2048.252) (-2035.893) (-2044.050) -- 0:02:39
426000 -- [-2034.914] (-2041.038) (-2035.218) (-2037.922) * (-2035.763) (-2039.268) (-2033.667) [-2037.680] -- 0:02:40
426500 -- (-2036.031) [-2041.297] (-2035.121) (-2037.949) * (-2037.957) [-2029.889] (-2043.452) (-2038.172) -- 0:02:40
427000 -- [-2040.539] (-2038.471) (-2043.166) (-2043.724) * (-2037.915) (-2041.768) (-2035.652) [-2040.143] -- 0:02:39
427500 -- [-2035.620] (-2035.338) (-2041.468) (-2047.461) * (-2040.460) (-2051.001) [-2030.060] (-2040.154) -- 0:02:39
428000 -- (-2038.245) (-2042.506) [-2037.434] (-2039.200) * (-2036.949) (-2041.066) (-2037.158) [-2039.833] -- 0:02:39
428500 -- [-2035.569] (-2036.631) (-2041.514) (-2047.711) * [-2043.676] (-2038.969) (-2033.326) (-2040.054) -- 0:02:38
429000 -- (-2036.439) [-2035.036] (-2040.458) (-2040.473) * (-2049.720) (-2039.588) (-2034.476) [-2036.737] -- 0:02:38
429500 -- (-2048.533) [-2035.695] (-2039.824) (-2042.367) * (-2040.987) [-2033.096] (-2036.692) (-2043.811) -- 0:02:39
430000 -- (-2037.320) (-2038.609) [-2033.811] (-2049.771) * (-2043.280) [-2032.914] (-2035.160) (-2031.171) -- 0:02:39
Average standard deviation of split frequencies: 0.002736
430500 -- (-2033.077) [-2037.754] (-2035.153) (-2043.742) * [-2032.646] (-2041.368) (-2035.623) (-2039.800) -- 0:02:38
431000 -- [-2034.429] (-2038.723) (-2035.274) (-2051.183) * [-2038.335] (-2036.222) (-2036.048) (-2035.599) -- 0:02:38
431500 -- [-2033.537] (-2041.394) (-2041.377) (-2045.689) * (-2031.575) (-2036.669) (-2038.645) [-2040.240] -- 0:02:38
432000 -- (-2034.829) [-2036.266] (-2035.972) (-2042.555) * (-2031.727) [-2038.963] (-2036.760) (-2040.034) -- 0:02:37
432500 -- (-2038.896) (-2036.496) [-2038.293] (-2038.083) * (-2037.283) [-2037.225] (-2038.471) (-2035.600) -- 0:02:37
433000 -- (-2031.879) [-2035.151] (-2036.428) (-2043.683) * [-2037.186] (-2038.295) (-2037.685) (-2033.846) -- 0:02:38
433500 -- [-2032.315] (-2038.894) (-2035.825) (-2042.012) * (-2040.228) (-2038.214) [-2038.099] (-2035.583) -- 0:02:38
434000 -- (-2038.798) (-2031.427) [-2035.715] (-2039.199) * (-2040.768) [-2035.570] (-2037.792) (-2042.303) -- 0:02:37
434500 -- [-2032.783] (-2037.240) (-2032.432) (-2040.782) * (-2040.119) [-2033.643] (-2042.129) (-2035.785) -- 0:02:37
435000 -- (-2046.579) (-2040.924) [-2037.044] (-2038.483) * [-2037.441] (-2035.429) (-2047.326) (-2042.611) -- 0:02:37
Average standard deviation of split frequencies: 0.002433
435500 -- (-2040.184) [-2034.958] (-2035.150) (-2041.898) * (-2038.559) (-2034.530) (-2041.876) [-2039.709] -- 0:02:36
436000 -- (-2041.320) [-2035.859] (-2036.565) (-2037.442) * (-2039.172) (-2036.409) [-2033.308] (-2037.888) -- 0:02:36
436500 -- (-2040.513) (-2042.672) [-2034.756] (-2042.408) * (-2040.686) [-2034.879] (-2031.809) (-2039.618) -- 0:02:37
437000 -- [-2036.882] (-2037.407) (-2040.526) (-2036.795) * (-2036.181) (-2036.464) [-2028.865] (-2035.224) -- 0:02:37
437500 -- (-2035.647) [-2038.015] (-2039.640) (-2037.975) * (-2036.760) (-2036.895) (-2041.174) [-2036.750] -- 0:02:36
438000 -- (-2036.147) (-2040.487) (-2041.375) [-2037.744] * (-2043.033) [-2030.963] (-2033.312) (-2038.306) -- 0:02:36
438500 -- [-2038.926] (-2033.684) (-2039.991) (-2031.964) * (-2033.958) (-2038.313) [-2039.146] (-2040.557) -- 0:02:36
439000 -- (-2042.015) (-2038.456) (-2041.763) [-2035.434] * (-2035.877) [-2033.332] (-2038.536) (-2043.176) -- 0:02:35
439500 -- (-2036.531) [-2037.562] (-2037.360) (-2038.279) * (-2040.134) [-2035.986] (-2045.680) (-2041.495) -- 0:02:35
440000 -- [-2035.647] (-2036.631) (-2038.575) (-2035.033) * (-2035.855) [-2033.394] (-2037.252) (-2037.454) -- 0:02:36
Average standard deviation of split frequencies: 0.002407
440500 -- (-2035.305) (-2044.455) [-2031.484] (-2039.186) * (-2036.026) [-2031.608] (-2039.953) (-2040.380) -- 0:02:36
441000 -- (-2041.611) (-2032.513) (-2041.040) [-2031.253] * [-2033.663] (-2045.229) (-2039.766) (-2042.199) -- 0:02:35
441500 -- (-2031.592) (-2040.326) (-2035.511) [-2033.385] * [-2036.259] (-2042.693) (-2047.134) (-2039.280) -- 0:02:35
442000 -- (-2034.512) (-2039.185) (-2039.727) [-2030.563] * [-2033.403] (-2040.365) (-2040.069) (-2038.220) -- 0:02:35
442500 -- (-2047.759) [-2033.010] (-2038.698) (-2038.355) * [-2032.619] (-2036.006) (-2035.828) (-2038.477) -- 0:02:34
443000 -- (-2041.027) [-2041.861] (-2035.251) (-2038.230) * (-2038.804) (-2032.995) (-2033.604) [-2039.370] -- 0:02:34
443500 -- (-2033.697) (-2039.450) [-2039.044] (-2036.753) * (-2041.217) (-2036.515) (-2039.271) [-2036.115] -- 0:02:34
444000 -- (-2034.824) (-2033.083) (-2042.805) [-2039.080] * (-2035.567) (-2037.182) (-2039.104) [-2039.481] -- 0:02:35
444500 -- (-2045.009) (-2041.489) (-2041.126) [-2037.484] * (-2039.938) [-2035.549] (-2034.028) (-2032.545) -- 0:02:34
445000 -- (-2034.149) (-2044.702) (-2040.968) [-2037.910] * [-2035.637] (-2039.355) (-2042.859) (-2038.277) -- 0:02:34
Average standard deviation of split frequencies: 0.002642
445500 -- (-2037.526) (-2038.323) [-2034.267] (-2037.639) * [-2038.901] (-2039.895) (-2043.133) (-2035.898) -- 0:02:34
446000 -- (-2034.641) [-2032.686] (-2040.001) (-2037.614) * [-2032.567] (-2038.669) (-2039.530) (-2036.674) -- 0:02:34
446500 -- (-2034.775) (-2035.781) (-2035.161) [-2036.735] * (-2031.750) [-2036.100] (-2034.503) (-2040.222) -- 0:02:33
447000 -- (-2036.429) (-2038.790) [-2035.612] (-2037.918) * (-2039.481) (-2045.672) (-2037.212) [-2039.007] -- 0:02:33
447500 -- (-2031.459) (-2043.280) [-2032.318] (-2040.727) * (-2040.833) (-2039.482) (-2039.613) [-2038.664] -- 0:02:34
448000 -- (-2036.660) [-2037.197] (-2034.769) (-2037.967) * (-2035.166) (-2038.031) (-2033.570) [-2044.480] -- 0:02:34
448500 -- (-2035.269) [-2034.309] (-2036.060) (-2037.289) * (-2046.896) (-2037.911) [-2035.301] (-2037.383) -- 0:02:33
449000 -- (-2037.005) (-2038.610) [-2039.823] (-2041.014) * (-2043.021) (-2037.856) [-2038.497] (-2034.720) -- 0:02:33
449500 -- (-2036.929) [-2035.823] (-2039.277) (-2046.428) * (-2036.421) (-2034.833) [-2033.000] (-2036.182) -- 0:02:33
450000 -- (-2035.617) (-2037.796) (-2038.653) [-2033.676] * (-2037.557) [-2032.917] (-2034.640) (-2039.375) -- 0:02:32
Average standard deviation of split frequencies: 0.002615
450500 -- (-2035.573) (-2036.025) (-2040.010) [-2033.178] * (-2038.355) [-2035.758] (-2038.725) (-2035.970) -- 0:02:32
451000 -- (-2035.553) (-2047.633) [-2037.082] (-2039.239) * (-2037.287) (-2039.479) (-2037.746) [-2033.505] -- 0:02:33
451500 -- (-2039.101) (-2040.058) [-2039.903] (-2039.441) * [-2040.485] (-2032.997) (-2037.604) (-2036.664) -- 0:02:33
452000 -- (-2034.380) [-2042.362] (-2041.018) (-2043.136) * (-2043.180) (-2042.190) [-2036.621] (-2033.920) -- 0:02:32
452500 -- [-2038.548] (-2040.880) (-2041.864) (-2037.141) * (-2035.637) [-2040.829] (-2042.730) (-2034.929) -- 0:02:32
453000 -- (-2039.247) (-2040.661) [-2043.332] (-2043.267) * (-2038.691) (-2038.221) [-2039.847] (-2041.531) -- 0:02:32
453500 -- [-2037.502] (-2037.912) (-2038.699) (-2038.757) * [-2041.174] (-2042.019) (-2037.358) (-2043.098) -- 0:02:31
454000 -- (-2040.486) [-2033.164] (-2039.777) (-2036.566) * (-2036.893) (-2035.445) (-2035.789) [-2043.921] -- 0:02:31
454500 -- [-2040.947] (-2037.126) (-2039.826) (-2034.234) * (-2032.627) (-2043.809) [-2036.960] (-2044.454) -- 0:02:32
455000 -- (-2038.018) (-2032.977) [-2032.939] (-2038.582) * (-2039.404) (-2039.189) [-2041.464] (-2034.155) -- 0:02:32
Average standard deviation of split frequencies: 0.002843
455500 -- (-2046.245) [-2036.144] (-2037.370) (-2044.796) * [-2036.604] (-2043.336) (-2041.581) (-2038.055) -- 0:02:31
456000 -- (-2039.530) (-2033.446) (-2040.962) [-2036.758] * (-2036.439) (-2039.442) (-2040.280) [-2035.692] -- 0:02:31
456500 -- [-2043.466] (-2040.124) (-2050.664) (-2035.846) * (-2044.170) (-2041.392) (-2035.751) [-2036.576] -- 0:02:31
457000 -- [-2034.938] (-2034.238) (-2036.697) (-2036.985) * [-2033.621] (-2040.244) (-2036.902) (-2040.370) -- 0:02:30
457500 -- (-2038.845) [-2037.075] (-2040.163) (-2038.221) * (-2037.952) (-2039.930) [-2041.503] (-2037.303) -- 0:02:30
458000 -- (-2036.512) (-2036.856) [-2038.183] (-2034.905) * (-2041.532) [-2040.105] (-2036.166) (-2038.345) -- 0:02:31
458500 -- [-2038.521] (-2046.092) (-2037.210) (-2036.015) * [-2034.669] (-2046.272) (-2041.985) (-2038.641) -- 0:02:31
459000 -- (-2036.412) (-2035.183) [-2037.206] (-2034.221) * (-2041.885) (-2039.681) (-2038.804) [-2036.855] -- 0:02:30
459500 -- (-2035.412) [-2035.554] (-2038.138) (-2034.415) * (-2040.906) (-2033.674) (-2039.584) [-2032.470] -- 0:02:30
460000 -- (-2039.963) (-2040.469) (-2035.092) [-2033.239] * (-2037.546) [-2037.473] (-2041.333) (-2035.225) -- 0:02:30
Average standard deviation of split frequencies: 0.002558
460500 -- (-2039.945) (-2039.660) (-2043.133) [-2033.524] * (-2040.444) (-2041.528) (-2035.756) [-2037.148] -- 0:02:29
461000 -- (-2033.938) (-2040.763) (-2041.333) [-2042.284] * (-2038.459) (-2040.787) [-2032.731] (-2040.151) -- 0:02:29
461500 -- [-2030.826] (-2044.032) (-2042.503) (-2045.643) * (-2034.204) (-2038.755) [-2051.147] (-2044.514) -- 0:02:29
462000 -- (-2037.137) (-2035.123) [-2036.667] (-2042.761) * (-2035.482) (-2040.481) [-2043.204] (-2036.680) -- 0:02:30
462500 -- (-2032.107) (-2036.552) (-2043.837) [-2037.578] * (-2042.669) (-2039.281) [-2037.294] (-2044.248) -- 0:02:29
463000 -- (-2033.663) (-2039.246) (-2039.634) [-2032.482] * (-2035.174) (-2037.830) [-2041.500] (-2040.691) -- 0:02:29
463500 -- (-2039.075) (-2033.692) [-2039.419] (-2034.011) * (-2039.487) (-2046.774) (-2033.258) [-2041.528] -- 0:02:29
464000 -- (-2042.314) [-2034.710] (-2034.520) (-2035.525) * (-2036.841) (-2040.636) [-2032.429] (-2037.491) -- 0:02:29
464500 -- (-2037.231) [-2037.863] (-2039.255) (-2044.653) * (-2040.942) (-2035.519) [-2033.327] (-2038.025) -- 0:02:28
465000 -- (-2044.976) [-2038.632] (-2044.659) (-2035.710) * (-2047.966) (-2037.264) (-2030.902) [-2038.252] -- 0:02:28
Average standard deviation of split frequencies: 0.002529
465500 -- (-2046.968) (-2034.505) [-2034.052] (-2039.780) * (-2042.853) [-2040.896] (-2038.464) (-2044.839) -- 0:02:29
466000 -- (-2037.476) [-2032.071] (-2037.860) (-2049.397) * (-2036.285) (-2038.292) (-2036.249) [-2036.065] -- 0:02:28
466500 -- (-2044.782) (-2035.015) (-2033.944) [-2034.348] * [-2043.326] (-2036.864) (-2036.333) (-2035.010) -- 0:02:28
467000 -- [-2046.778] (-2041.234) (-2038.721) (-2042.720) * (-2035.308) (-2038.948) (-2034.739) [-2031.166] -- 0:02:28
467500 -- (-2039.206) (-2046.338) (-2039.306) [-2035.544] * (-2040.627) (-2036.930) (-2042.636) [-2038.554] -- 0:02:28
468000 -- [-2042.070] (-2038.586) (-2033.143) (-2038.377) * (-2038.745) [-2035.098] (-2038.439) (-2032.471) -- 0:02:27
468500 -- [-2042.838] (-2044.127) (-2031.184) (-2036.053) * [-2035.834] (-2038.653) (-2037.702) (-2038.095) -- 0:02:27
469000 -- (-2051.075) [-2033.355] (-2037.458) (-2040.919) * (-2042.444) (-2034.705) (-2045.568) [-2035.898] -- 0:02:28
469500 -- (-2037.605) (-2037.040) [-2034.700] (-2042.009) * (-2047.180) (-2037.354) (-2042.659) [-2036.543] -- 0:02:28
470000 -- (-2053.462) (-2043.314) (-2031.636) [-2045.070] * [-2040.650] (-2033.155) (-2034.793) (-2035.554) -- 0:02:27
Average standard deviation of split frequencies: 0.002504
470500 -- (-2044.040) (-2039.387) [-2038.045] (-2037.658) * [-2046.972] (-2035.522) (-2036.485) (-2032.955) -- 0:02:27
471000 -- [-2036.310] (-2033.969) (-2036.562) (-2031.808) * (-2042.458) [-2038.437] (-2038.918) (-2035.242) -- 0:02:27
471500 -- (-2035.966) (-2031.617) (-2045.007) [-2033.630] * (-2033.135) [-2037.641] (-2033.560) (-2036.465) -- 0:02:26
472000 -- (-2035.728) [-2041.780] (-2035.264) (-2034.019) * (-2035.132) (-2043.022) [-2035.836] (-2030.516) -- 0:02:26
472500 -- (-2037.641) (-2047.663) (-2044.315) [-2032.170] * (-2043.356) (-2039.989) [-2030.341] (-2034.408) -- 0:02:27
473000 -- [-2040.299] (-2036.262) (-2039.297) (-2035.894) * (-2035.478) (-2040.249) [-2037.609] (-2040.306) -- 0:02:27
473500 -- (-2042.643) (-2037.768) [-2039.120] (-2036.918) * (-2034.511) (-2041.917) (-2038.382) [-2033.768] -- 0:02:26
474000 -- (-2051.543) (-2039.816) (-2035.110) [-2032.593] * [-2040.498] (-2041.217) (-2037.386) (-2038.549) -- 0:02:26
474500 -- (-2036.056) (-2039.118) (-2037.431) [-2036.253] * (-2037.244) (-2048.684) [-2032.327] (-2041.420) -- 0:02:26
475000 -- (-2033.633) (-2042.821) [-2039.847] (-2044.424) * (-2040.764) [-2043.168] (-2039.102) (-2039.232) -- 0:02:25
Average standard deviation of split frequencies: 0.002476
475500 -- (-2032.897) (-2038.663) [-2036.260] (-2043.105) * (-2037.413) (-2037.550) [-2041.094] (-2033.706) -- 0:02:25
476000 -- [-2033.581] (-2032.528) (-2034.340) (-2033.786) * (-2037.881) [-2036.312] (-2036.954) (-2033.992) -- 0:02:25
476500 -- [-2034.297] (-2045.496) (-2038.885) (-2039.367) * (-2038.159) (-2037.265) (-2039.413) [-2042.025] -- 0:02:26
477000 -- [-2035.254] (-2042.923) (-2035.917) (-2037.065) * [-2035.009] (-2036.454) (-2034.134) (-2040.301) -- 0:02:25
477500 -- (-2033.923) (-2036.899) [-2038.248] (-2037.026) * (-2036.013) [-2034.443] (-2043.154) (-2053.619) -- 0:02:25
478000 -- (-2035.597) (-2036.332) [-2037.330] (-2039.811) * (-2033.651) (-2041.638) [-2038.379] (-2039.466) -- 0:02:25
478500 -- [-2037.633] (-2038.412) (-2042.424) (-2045.079) * (-2038.945) (-2058.231) [-2037.144] (-2048.078) -- 0:02:24
479000 -- (-2034.506) (-2044.343) (-2040.180) [-2033.370] * (-2032.599) (-2051.077) (-2033.219) [-2034.973] -- 0:02:24
479500 -- (-2033.411) (-2036.149) [-2033.736] (-2044.855) * (-2046.348) (-2041.107) (-2034.613) [-2044.116] -- 0:02:24
480000 -- (-2036.273) (-2034.243) [-2038.031] (-2041.376) * [-2040.453] (-2038.958) (-2044.249) (-2038.364) -- 0:02:25
Average standard deviation of split frequencies: 0.002207
480500 -- (-2041.654) [-2034.006] (-2037.879) (-2035.808) * (-2030.814) (-2046.319) (-2049.188) [-2036.639] -- 0:02:24
481000 -- (-2034.435) [-2034.410] (-2044.656) (-2039.827) * (-2035.839) (-2040.392) [-2043.038] (-2035.772) -- 0:02:24
481500 -- (-2044.067) [-2034.768] (-2047.943) (-2037.383) * (-2038.710) (-2043.753) (-2039.057) [-2036.668] -- 0:02:24
482000 -- (-2042.081) (-2038.539) (-2041.801) [-2035.925] * [-2041.571] (-2038.326) (-2034.141) (-2033.664) -- 0:02:24
482500 -- (-2036.558) (-2034.782) (-2041.386) [-2037.573] * (-2036.903) (-2040.644) (-2038.543) [-2030.399] -- 0:02:23
483000 -- (-2034.788) (-2033.886) (-2036.485) [-2030.892] * [-2039.449] (-2035.948) (-2037.374) (-2040.008) -- 0:02:23
483500 -- [-2038.821] (-2038.140) (-2034.410) (-2035.759) * (-2033.566) [-2037.554] (-2039.992) (-2042.756) -- 0:02:24
484000 -- [-2033.926] (-2039.551) (-2037.091) (-2033.030) * [-2034.891] (-2037.858) (-2033.738) (-2037.609) -- 0:02:23
484500 -- (-2033.812) [-2033.321] (-2035.300) (-2036.137) * [-2033.239] (-2036.151) (-2034.573) (-2041.783) -- 0:02:23
485000 -- (-2042.612) [-2037.898] (-2035.123) (-2040.264) * [-2031.060] (-2033.474) (-2041.308) (-2035.809) -- 0:02:23
Average standard deviation of split frequencies: 0.002425
485500 -- (-2039.107) (-2031.636) (-2036.938) [-2035.406] * (-2033.019) (-2040.173) (-2042.657) [-2035.218] -- 0:02:23
486000 -- (-2047.416) (-2032.848) (-2032.831) [-2033.301] * (-2040.819) [-2032.891] (-2037.278) (-2034.067) -- 0:02:22
486500 -- (-2036.660) [-2034.869] (-2037.430) (-2048.240) * (-2035.381) (-2038.361) [-2034.894] (-2044.424) -- 0:02:22
487000 -- (-2039.357) [-2034.940] (-2033.478) (-2036.037) * (-2033.142) (-2035.071) [-2038.247] (-2038.222) -- 0:02:23
487500 -- (-2039.832) (-2035.424) (-2039.411) [-2036.344] * (-2034.689) (-2047.538) (-2034.042) [-2035.384] -- 0:02:22
488000 -- (-2035.086) (-2033.703) [-2034.615] (-2039.668) * (-2032.695) (-2043.377) [-2037.242] (-2051.683) -- 0:02:22
488500 -- [-2038.587] (-2035.180) (-2037.844) (-2040.750) * [-2042.250] (-2036.699) (-2033.178) (-2039.926) -- 0:02:22
489000 -- (-2039.395) (-2031.136) [-2035.770] (-2037.425) * (-2045.299) (-2042.259) [-2032.798] (-2037.722) -- 0:02:22
489500 -- (-2037.351) (-2034.978) [-2036.119] (-2035.001) * (-2040.649) (-2041.653) (-2039.317) [-2039.640] -- 0:02:21
490000 -- (-2034.615) (-2036.209) [-2037.153] (-2038.027) * (-2037.365) (-2034.621) [-2036.723] (-2035.443) -- 0:02:21
Average standard deviation of split frequencies: 0.002162
490500 -- (-2033.100) (-2041.499) [-2034.348] (-2040.498) * (-2040.432) (-2034.189) [-2035.299] (-2044.294) -- 0:02:21
491000 -- [-2037.931] (-2036.590) (-2039.265) (-2042.011) * [-2042.097] (-2042.939) (-2037.315) (-2045.632) -- 0:02:22
491500 -- [-2034.986] (-2041.231) (-2036.505) (-2038.261) * [-2038.533] (-2039.157) (-2038.800) (-2040.727) -- 0:02:21
492000 -- (-2037.389) [-2032.638] (-2040.833) (-2041.897) * (-2033.972) [-2035.559] (-2038.495) (-2036.429) -- 0:02:21
492500 -- (-2033.781) (-2036.193) [-2034.608] (-2035.245) * (-2046.612) (-2035.628) (-2034.360) [-2035.360] -- 0:02:21
493000 -- (-2045.355) [-2045.824] (-2035.079) (-2040.681) * (-2037.833) [-2034.530] (-2039.194) (-2041.438) -- 0:02:20
493500 -- (-2039.086) (-2033.278) (-2036.960) [-2038.370] * (-2033.027) [-2038.257] (-2043.247) (-2045.138) -- 0:02:20
494000 -- (-2038.209) [-2033.716] (-2034.779) (-2039.135) * (-2033.730) (-2036.484) [-2035.894] (-2038.469) -- 0:02:20
494500 -- [-2035.658] (-2034.466) (-2041.316) (-2036.680) * (-2039.376) [-2033.526] (-2033.709) (-2043.648) -- 0:02:21
495000 -- (-2042.795) [-2036.285] (-2039.020) (-2045.392) * (-2036.861) [-2035.200] (-2048.694) (-2039.828) -- 0:02:20
Average standard deviation of split frequencies: 0.002138
495500 -- (-2038.473) (-2039.578) [-2034.305] (-2034.175) * (-2034.829) (-2033.350) (-2044.755) [-2034.247] -- 0:02:20
496000 -- (-2041.059) (-2039.767) [-2037.707] (-2035.250) * (-2040.890) (-2037.413) (-2038.592) [-2044.749] -- 0:02:20
496500 -- (-2045.575) (-2035.351) [-2030.871] (-2035.673) * [-2035.928] (-2037.406) (-2036.328) (-2037.610) -- 0:02:19
497000 -- (-2038.454) (-2039.967) [-2035.118] (-2034.811) * (-2040.988) (-2044.664) (-2042.616) [-2035.593] -- 0:02:19
497500 -- (-2035.279) (-2039.724) (-2033.606) [-2033.701] * [-2037.931] (-2039.711) (-2034.282) (-2046.732) -- 0:02:19
498000 -- (-2032.900) (-2038.297) [-2036.362] (-2032.703) * (-2041.343) [-2039.429] (-2036.019) (-2035.423) -- 0:02:20
498500 -- (-2042.722) [-2031.803] (-2036.476) (-2043.505) * (-2043.022) (-2031.620) (-2044.913) [-2037.910] -- 0:02:19
499000 -- (-2034.736) [-2029.500] (-2033.818) (-2033.976) * (-2040.458) (-2041.477) [-2037.029] (-2044.765) -- 0:02:19
499500 -- (-2037.901) [-2035.298] (-2038.326) (-2037.079) * (-2046.322) (-2034.963) (-2035.207) [-2038.341] -- 0:02:19
500000 -- (-2044.652) [-2037.096] (-2039.045) (-2043.080) * (-2037.992) (-2036.899) (-2039.168) [-2042.804] -- 0:02:19
Average standard deviation of split frequencies: 0.002118
500500 -- (-2045.809) [-2037.090] (-2040.286) (-2039.943) * (-2039.725) (-2035.350) (-2033.911) [-2036.566] -- 0:02:18
501000 -- [-2036.628] (-2033.394) (-2037.855) (-2039.196) * [-2034.049] (-2037.565) (-2038.309) (-2037.700) -- 0:02:18
501500 -- (-2033.989) (-2040.038) (-2040.594) [-2041.712] * [-2035.798] (-2044.931) (-2032.293) (-2036.270) -- 0:02:19
502000 -- (-2046.385) (-2042.988) (-2033.499) [-2037.201] * (-2040.360) (-2038.348) [-2042.194] (-2032.663) -- 0:02:18
502500 -- (-2039.527) (-2044.064) [-2041.088] (-2040.816) * [-2035.046] (-2037.687) (-2046.134) (-2035.768) -- 0:02:18
503000 -- (-2034.678) (-2039.074) [-2036.130] (-2035.102) * (-2034.524) [-2038.896] (-2040.343) (-2034.985) -- 0:02:18
503500 -- (-2037.700) (-2037.178) [-2036.951] (-2040.269) * (-2038.181) [-2038.897] (-2047.309) (-2042.598) -- 0:02:18
504000 -- (-2039.723) (-2040.533) [-2039.159] (-2033.227) * (-2039.888) [-2036.791] (-2036.755) (-2034.263) -- 0:02:17
504500 -- (-2040.267) (-2034.903) [-2033.857] (-2037.958) * (-2036.748) (-2039.425) (-2036.047) [-2034.894] -- 0:02:17
505000 -- (-2040.400) (-2033.857) [-2034.805] (-2039.535) * (-2045.796) (-2040.445) (-2035.014) [-2032.716] -- 0:02:18
Average standard deviation of split frequencies: 0.001863
505500 -- (-2040.197) [-2034.155] (-2036.922) (-2043.392) * (-2042.080) (-2032.580) (-2031.971) [-2035.350] -- 0:02:17
506000 -- (-2035.695) (-2037.281) [-2037.077] (-2045.735) * (-2037.127) [-2036.155] (-2036.499) (-2040.298) -- 0:02:17
506500 -- (-2040.729) (-2041.001) [-2035.189] (-2039.321) * (-2035.787) [-2035.598] (-2037.877) (-2038.771) -- 0:02:17
507000 -- (-2038.754) (-2047.813) [-2032.289] (-2043.545) * (-2036.111) [-2035.875] (-2037.552) (-2041.420) -- 0:02:17
507500 -- (-2036.305) (-2037.722) [-2031.528] (-2042.074) * [-2037.962] (-2045.509) (-2034.558) (-2038.874) -- 0:02:16
508000 -- (-2037.610) (-2039.177) (-2030.793) [-2035.490] * (-2048.675) [-2042.772] (-2033.912) (-2040.909) -- 0:02:16
508500 -- (-2036.289) (-2039.973) [-2034.256] (-2037.591) * [-2037.963] (-2035.813) (-2033.564) (-2038.601) -- 0:02:16
509000 -- [-2035.466] (-2033.366) (-2035.624) (-2037.264) * (-2033.333) [-2039.967] (-2033.995) (-2040.496) -- 0:02:16
509500 -- (-2035.421) (-2039.183) [-2032.307] (-2033.337) * [-2040.882] (-2036.962) (-2043.581) (-2044.189) -- 0:02:16
510000 -- (-2035.581) (-2034.731) (-2044.930) [-2038.484] * (-2041.433) [-2035.973] (-2054.549) (-2041.722) -- 0:02:16
Average standard deviation of split frequencies: 0.003462
510500 -- (-2031.257) (-2034.134) (-2045.485) [-2033.700] * [-2035.481] (-2035.936) (-2047.726) (-2043.532) -- 0:02:16
511000 -- (-2038.028) (-2036.580) [-2035.344] (-2043.359) * [-2037.485] (-2035.442) (-2043.790) (-2036.758) -- 0:02:15
511500 -- [-2036.429] (-2043.057) (-2041.299) (-2039.663) * [-2037.049] (-2034.086) (-2043.895) (-2041.568) -- 0:02:15
512000 -- (-2041.373) [-2032.813] (-2036.470) (-2036.104) * (-2036.421) (-2037.494) [-2037.984] (-2041.774) -- 0:02:15
512500 -- (-2037.245) (-2036.483) [-2041.521] (-2035.081) * (-2034.653) [-2042.027] (-2042.050) (-2042.609) -- 0:02:16
513000 -- (-2034.511) (-2038.515) [-2033.399] (-2034.625) * (-2035.756) [-2034.399] (-2034.814) (-2037.090) -- 0:02:15
513500 -- (-2036.930) [-2039.980] (-2040.040) (-2034.150) * [-2035.182] (-2041.032) (-2035.682) (-2041.416) -- 0:02:15
514000 -- (-2040.268) [-2038.824] (-2037.338) (-2037.216) * (-2037.291) (-2044.684) (-2038.675) [-2041.806] -- 0:02:15
514500 -- [-2034.123] (-2044.098) (-2038.822) (-2036.888) * [-2036.982] (-2051.759) (-2040.969) (-2047.770) -- 0:02:14
515000 -- (-2038.500) [-2037.044] (-2042.978) (-2043.069) * [-2037.450] (-2036.324) (-2036.326) (-2037.166) -- 0:02:14
Average standard deviation of split frequencies: 0.003426
515500 -- (-2035.609) [-2031.360] (-2042.824) (-2031.980) * (-2037.918) (-2040.130) [-2035.767] (-2036.826) -- 0:02:14
516000 -- [-2034.478] (-2037.281) (-2037.936) (-2032.874) * (-2037.359) (-2038.674) (-2039.258) [-2035.001] -- 0:02:15
516500 -- (-2039.109) (-2043.127) [-2030.786] (-2036.348) * (-2032.901) (-2037.794) (-2039.390) [-2032.006] -- 0:02:14
517000 -- (-2042.018) (-2051.985) [-2034.565] (-2040.935) * (-2037.071) (-2038.743) [-2038.497] (-2034.334) -- 0:02:14
517500 -- (-2038.260) (-2039.767) (-2032.764) [-2036.666] * [-2035.801] (-2042.248) (-2041.302) (-2038.408) -- 0:02:14
518000 -- (-2038.788) (-2040.069) [-2034.889] (-2037.926) * [-2036.555] (-2047.334) (-2036.603) (-2039.300) -- 0:02:13
518500 -- (-2034.995) (-2035.560) [-2032.908] (-2036.504) * (-2037.248) (-2043.285) [-2032.830] (-2039.741) -- 0:02:13
519000 -- [-2033.925] (-2034.237) (-2034.844) (-2035.924) * (-2034.561) (-2034.140) (-2038.866) [-2036.667] -- 0:02:13
519500 -- (-2037.698) (-2038.076) [-2039.494] (-2029.584) * (-2033.159) [-2033.969] (-2039.271) (-2045.929) -- 0:02:14
520000 -- (-2035.568) (-2045.795) [-2037.721] (-2033.220) * [-2032.450] (-2041.608) (-2043.224) (-2043.654) -- 0:02:13
Average standard deviation of split frequencies: 0.004527
520500 -- (-2038.476) [-2030.780] (-2038.690) (-2032.461) * [-2042.135] (-2047.767) (-2042.525) (-2040.968) -- 0:02:13
521000 -- [-2035.994] (-2033.608) (-2042.079) (-2034.834) * [-2042.443] (-2040.928) (-2036.550) (-2040.036) -- 0:02:13
521500 -- (-2041.521) [-2033.165] (-2040.838) (-2036.291) * (-2033.233) (-2036.548) (-2032.787) [-2033.141] -- 0:02:13
522000 -- (-2039.812) (-2037.145) [-2037.958] (-2039.256) * (-2044.179) (-2031.996) (-2037.583) [-2031.587] -- 0:02:12
522500 -- (-2043.243) (-2034.650) [-2031.512] (-2039.052) * (-2037.347) (-2038.588) (-2038.944) [-2032.578] -- 0:02:12
523000 -- (-2037.303) (-2042.437) (-2033.865) [-2034.289] * (-2038.191) [-2039.164] (-2037.517) (-2035.251) -- 0:02:12
523500 -- (-2036.608) (-2035.078) (-2037.647) [-2036.447] * (-2033.980) [-2035.302] (-2032.908) (-2039.823) -- 0:02:12
524000 -- (-2036.833) (-2048.210) (-2042.484) [-2032.620] * (-2033.823) (-2032.208) [-2038.585] (-2038.245) -- 0:02:12
524500 -- [-2041.498] (-2045.346) (-2037.813) (-2042.397) * (-2046.641) [-2038.174] (-2036.897) (-2036.519) -- 0:02:12
525000 -- (-2037.759) (-2036.719) [-2038.480] (-2033.550) * (-2042.001) (-2032.853) [-2035.923] (-2037.698) -- 0:02:12
Average standard deviation of split frequencies: 0.005825
525500 -- (-2037.855) (-2042.175) [-2037.398] (-2039.534) * (-2040.511) (-2039.277) [-2034.051] (-2034.087) -- 0:02:11
526000 -- (-2040.635) (-2047.239) (-2032.104) [-2038.216] * (-2037.461) [-2036.791] (-2033.791) (-2035.551) -- 0:02:11
526500 -- (-2035.844) [-2036.098] (-2032.640) (-2035.083) * [-2035.754] (-2038.501) (-2037.830) (-2046.148) -- 0:02:11
527000 -- (-2038.872) [-2036.832] (-2031.956) (-2036.388) * (-2047.124) (-2033.258) (-2037.073) [-2035.466] -- 0:02:11
527500 -- (-2036.369) (-2034.944) [-2036.082] (-2036.856) * (-2047.414) [-2033.766] (-2047.720) (-2040.018) -- 0:02:11
528000 -- (-2035.037) [-2041.443] (-2048.683) (-2040.233) * [-2034.602] (-2038.980) (-2035.163) (-2039.995) -- 0:02:11
528500 -- (-2038.047) [-2034.506] (-2036.722) (-2042.662) * [-2035.570] (-2041.633) (-2041.466) (-2046.472) -- 0:02:11
529000 -- (-2038.733) (-2033.349) (-2043.082) [-2036.736] * [-2038.490] (-2041.746) (-2047.797) (-2044.382) -- 0:02:10
529500 -- (-2041.086) [-2033.528] (-2046.029) (-2034.474) * (-2035.661) [-2037.398] (-2041.250) (-2041.637) -- 0:02:10
530000 -- (-2043.110) [-2036.164] (-2044.892) (-2037.739) * (-2036.549) (-2033.951) [-2037.277] (-2038.159) -- 0:02:11
Average standard deviation of split frequencies: 0.005774
530500 -- (-2039.554) (-2037.263) [-2037.428] (-2038.564) * (-2038.318) (-2041.011) [-2039.376] (-2036.776) -- 0:02:10
531000 -- (-2038.073) (-2037.420) [-2038.924] (-2042.303) * (-2038.282) (-2050.918) [-2037.082] (-2032.583) -- 0:02:10
531500 -- (-2034.269) [-2034.720] (-2039.526) (-2041.621) * [-2038.938] (-2038.583) (-2034.400) (-2038.528) -- 0:02:10
532000 -- (-2047.317) (-2037.598) (-2039.241) [-2036.490] * [-2036.380] (-2041.537) (-2037.948) (-2037.410) -- 0:02:10
532500 -- (-2033.332) (-2037.013) (-2040.247) [-2034.697] * (-2044.000) (-2033.942) (-2039.180) [-2037.145] -- 0:02:09
533000 -- (-2036.217) (-2041.991) (-2041.102) [-2038.164] * [-2038.188] (-2042.562) (-2042.191) (-2034.868) -- 0:02:09
533500 -- (-2034.888) (-2041.993) (-2040.419) [-2037.737] * [-2039.905] (-2039.325) (-2042.259) (-2040.929) -- 0:02:09
534000 -- (-2037.591) (-2036.106) (-2042.896) [-2040.940] * (-2038.504) (-2043.773) (-2042.436) [-2034.058] -- 0:02:10
534500 -- (-2034.028) (-2034.622) [-2036.270] (-2039.577) * (-2037.776) (-2042.045) (-2036.651) [-2034.140] -- 0:02:09
535000 -- (-2042.311) (-2035.901) [-2042.156] (-2039.079) * [-2034.110] (-2040.221) (-2039.287) (-2043.761) -- 0:02:09
Average standard deviation of split frequencies: 0.006376
535500 -- (-2044.512) (-2036.683) [-2037.379] (-2038.940) * (-2038.960) (-2036.245) [-2040.216] (-2038.083) -- 0:02:09
536000 -- (-2038.049) [-2035.332] (-2041.968) (-2039.219) * (-2036.579) (-2037.343) (-2037.343) [-2038.902] -- 0:02:08
536500 -- (-2035.654) (-2043.039) [-2035.948] (-2032.637) * (-2038.322) (-2040.698) (-2043.768) [-2039.004] -- 0:02:08
537000 -- [-2033.624] (-2038.831) (-2041.094) (-2040.683) * [-2038.888] (-2041.307) (-2042.109) (-2037.631) -- 0:02:08
537500 -- (-2037.371) (-2042.364) (-2034.283) [-2036.481] * (-2039.192) [-2034.500] (-2037.431) (-2035.400) -- 0:02:09
538000 -- (-2039.564) (-2043.151) [-2037.570] (-2039.871) * (-2044.766) (-2033.532) [-2044.439] (-2033.454) -- 0:02:08
538500 -- (-2036.579) [-2041.546] (-2041.254) (-2041.816) * (-2037.419) (-2044.285) [-2032.030] (-2039.845) -- 0:02:08
539000 -- (-2040.983) (-2038.704) (-2035.888) [-2039.486] * (-2031.478) (-2040.458) [-2036.920] (-2032.260) -- 0:02:08
539500 -- (-2047.736) (-2039.023) [-2031.749] (-2035.682) * [-2041.973] (-2039.711) (-2041.412) (-2041.741) -- 0:02:08
540000 -- (-2036.682) [-2040.398] (-2039.360) (-2032.691) * [-2033.247] (-2034.161) (-2040.109) (-2037.134) -- 0:02:07
Average standard deviation of split frequencies: 0.005667
540500 -- (-2041.644) (-2036.590) [-2034.248] (-2035.200) * [-2037.902] (-2036.388) (-2038.727) (-2041.403) -- 0:02:07
541000 -- (-2049.326) (-2039.160) [-2036.564] (-2037.592) * (-2036.244) [-2038.662] (-2037.636) (-2040.453) -- 0:02:08
541500 -- (-2044.778) (-2035.353) (-2039.031) [-2035.080] * (-2046.476) (-2037.696) (-2035.337) [-2034.567] -- 0:02:07
542000 -- (-2037.456) [-2039.914] (-2035.554) (-2036.582) * (-2033.912) [-2035.838] (-2042.042) (-2033.438) -- 0:02:07
542500 -- (-2041.351) [-2036.590] (-2035.922) (-2045.423) * [-2031.608] (-2035.217) (-2042.512) (-2042.795) -- 0:02:07
543000 -- (-2043.139) (-2040.041) (-2037.200) [-2039.123] * [-2040.002] (-2040.551) (-2039.399) (-2044.106) -- 0:02:07
543500 -- (-2033.469) (-2045.801) [-2035.193] (-2037.039) * (-2043.592) (-2039.894) [-2036.777] (-2038.780) -- 0:02:06
544000 -- [-2032.220] (-2039.879) (-2036.418) (-2038.356) * (-2035.819) [-2031.851] (-2033.791) (-2041.783) -- 0:02:06
544500 -- (-2037.640) (-2034.111) [-2034.815] (-2040.925) * [-2041.523] (-2037.220) (-2038.749) (-2047.520) -- 0:02:07
545000 -- (-2037.206) (-2041.777) [-2032.215] (-2038.623) * (-2042.341) (-2039.462) (-2033.978) [-2039.603] -- 0:02:06
Average standard deviation of split frequencies: 0.006044
545500 -- (-2039.904) (-2036.763) [-2039.880] (-2038.569) * (-2040.532) (-2037.187) (-2041.773) [-2037.509] -- 0:02:06
546000 -- (-2034.969) (-2046.139) (-2032.019) [-2037.674] * [-2034.726] (-2038.008) (-2031.724) (-2037.424) -- 0:02:06
546500 -- (-2042.075) (-2037.515) (-2037.527) [-2038.647] * (-2038.690) (-2038.982) [-2028.422] (-2036.353) -- 0:02:06
547000 -- (-2037.453) [-2035.561] (-2038.007) (-2035.721) * (-2042.930) (-2036.178) (-2033.352) [-2034.068] -- 0:02:05
547500 -- (-2037.434) [-2035.609] (-2040.162) (-2042.436) * (-2040.261) (-2038.582) (-2044.223) [-2035.599] -- 0:02:05
548000 -- (-2040.053) (-2036.312) [-2039.272] (-2049.560) * (-2033.878) (-2050.960) (-2043.721) [-2038.510] -- 0:02:05
548500 -- (-2038.228) [-2040.222] (-2047.680) (-2040.650) * (-2042.345) (-2035.873) [-2033.776] (-2032.282) -- 0:02:05
549000 -- (-2035.112) [-2040.675] (-2042.907) (-2036.603) * (-2036.022) (-2035.853) (-2035.932) [-2036.554] -- 0:02:05
549500 -- (-2034.328) [-2036.398] (-2042.149) (-2032.297) * [-2032.455] (-2035.627) (-2039.324) (-2040.461) -- 0:02:05
550000 -- (-2036.197) (-2038.425) [-2039.603] (-2035.004) * (-2039.456) (-2039.474) [-2031.290] (-2037.480) -- 0:02:05
Average standard deviation of split frequencies: 0.006420
550500 -- (-2044.223) (-2042.017) [-2030.432] (-2031.910) * (-2043.100) (-2041.020) (-2037.041) [-2038.061] -- 0:02:04
551000 -- (-2054.578) (-2042.852) (-2039.245) [-2035.508] * (-2044.039) (-2037.511) (-2039.560) [-2035.848] -- 0:02:04
551500 -- (-2037.414) [-2040.531] (-2038.214) (-2039.076) * (-2039.520) [-2030.722] (-2034.691) (-2036.830) -- 0:02:04
552000 -- [-2032.480] (-2038.934) (-2045.507) (-2041.061) * (-2034.473) (-2030.520) (-2042.265) [-2033.772] -- 0:02:04
552500 -- (-2031.526) (-2042.582) [-2034.396] (-2042.665) * (-2041.579) (-2040.088) (-2039.779) [-2036.662] -- 0:02:04
553000 -- (-2037.080) [-2034.602] (-2037.295) (-2031.149) * [-2031.271] (-2037.027) (-2037.366) (-2039.107) -- 0:02:04
553500 -- [-2040.152] (-2033.953) (-2038.634) (-2038.665) * [-2039.081] (-2039.149) (-2034.229) (-2037.938) -- 0:02:04
554000 -- (-2037.926) [-2031.732] (-2043.182) (-2036.793) * (-2045.440) (-2037.227) [-2034.176] (-2046.613) -- 0:02:03
554500 -- (-2039.227) (-2036.468) [-2040.022] (-2034.092) * (-2042.345) [-2033.495] (-2036.742) (-2039.163) -- 0:02:03
555000 -- (-2034.915) (-2041.444) [-2038.361] (-2034.925) * (-2039.750) (-2042.092) (-2040.313) [-2036.110] -- 0:02:03
Average standard deviation of split frequencies: 0.006783
555500 -- (-2040.659) (-2038.077) (-2038.018) [-2036.190] * (-2036.649) [-2046.432] (-2035.640) (-2035.251) -- 0:02:04
556000 -- (-2037.412) (-2038.368) (-2040.632) [-2034.898] * (-2038.927) (-2041.752) [-2039.098] (-2033.300) -- 0:02:03
556500 -- (-2040.894) [-2039.578] (-2040.651) (-2032.740) * (-2033.417) [-2036.506] (-2039.928) (-2047.645) -- 0:02:03
557000 -- (-2037.402) (-2043.456) (-2038.936) [-2040.861] * (-2035.437) (-2036.018) [-2034.618] (-2035.664) -- 0:02:03
557500 -- [-2038.894] (-2041.321) (-2032.639) (-2039.341) * (-2042.042) (-2032.236) [-2038.758] (-2044.586) -- 0:02:03
558000 -- [-2034.388] (-2042.779) (-2037.905) (-2038.222) * (-2039.556) (-2037.027) [-2037.382] (-2032.045) -- 0:02:02
558500 -- [-2040.225] (-2040.161) (-2036.467) (-2040.054) * (-2041.046) [-2035.325] (-2034.600) (-2034.356) -- 0:02:02
559000 -- [-2034.460] (-2041.398) (-2036.981) (-2040.978) * [-2037.880] (-2038.123) (-2033.922) (-2042.298) -- 0:02:02
559500 -- (-2039.378) (-2042.179) (-2038.595) [-2034.193] * (-2045.947) (-2039.431) [-2039.073] (-2044.811) -- 0:02:02
560000 -- (-2042.315) (-2044.258) [-2033.547] (-2041.510) * [-2038.664] (-2040.891) (-2037.180) (-2043.803) -- 0:02:02
Average standard deviation of split frequencies: 0.007147
560500 -- (-2031.743) (-2039.386) [-2037.975] (-2040.748) * (-2043.417) [-2038.334] (-2039.397) (-2033.047) -- 0:02:02
561000 -- (-2039.928) [-2038.699] (-2035.334) (-2039.186) * (-2039.744) (-2039.579) (-2045.076) [-2037.097] -- 0:02:02
561500 -- [-2034.583] (-2041.173) (-2038.735) (-2044.490) * (-2032.338) [-2034.331] (-2043.827) (-2036.927) -- 0:02:01
562000 -- (-2031.117) (-2044.637) (-2044.748) [-2034.611] * (-2033.865) (-2038.356) [-2039.364] (-2043.846) -- 0:02:01
562500 -- (-2038.971) (-2032.251) (-2040.749) [-2035.225] * (-2039.524) [-2031.298] (-2034.176) (-2045.108) -- 0:02:01
563000 -- [-2038.660] (-2042.021) (-2038.383) (-2037.510) * [-2034.818] (-2035.999) (-2034.607) (-2037.148) -- 0:02:01
563500 -- [-2035.572] (-2041.487) (-2035.735) (-2041.033) * (-2041.041) (-2033.222) (-2046.761) [-2038.693] -- 0:02:01
564000 -- (-2036.438) (-2039.549) [-2034.522] (-2034.912) * (-2039.565) [-2031.631] (-2037.569) (-2036.884) -- 0:02:01
564500 -- (-2047.776) (-2037.897) [-2041.971] (-2039.330) * [-2034.841] (-2044.943) (-2035.717) (-2035.231) -- 0:02:01
565000 -- (-2036.673) (-2039.245) [-2034.437] (-2038.073) * (-2035.909) (-2032.360) [-2034.213] (-2037.398) -- 0:02:00
Average standard deviation of split frequencies: 0.006663
565500 -- (-2035.795) (-2034.715) [-2036.964] (-2040.748) * (-2034.514) [-2039.608] (-2035.060) (-2041.318) -- 0:02:00
566000 -- (-2035.963) (-2034.077) (-2033.851) [-2032.972] * [-2035.742] (-2039.388) (-2044.516) (-2033.568) -- 0:02:00
566500 -- (-2040.776) [-2039.752] (-2037.595) (-2035.423) * (-2032.461) (-2048.345) (-2042.348) [-2036.143] -- 0:02:00
567000 -- (-2031.957) [-2039.224] (-2033.885) (-2034.552) * (-2035.274) (-2046.485) (-2039.710) [-2033.528] -- 0:02:00
567500 -- (-2034.047) [-2040.157] (-2041.251) (-2044.506) * (-2042.106) [-2037.002] (-2035.721) (-2034.205) -- 0:02:00
568000 -- (-2040.816) (-2038.555) [-2032.441] (-2039.370) * (-2047.951) [-2035.949] (-2040.362) (-2040.141) -- 0:02:00
568500 -- (-2041.724) (-2041.451) [-2038.794] (-2037.546) * (-2036.042) [-2034.470] (-2040.258) (-2032.066) -- 0:01:59
569000 -- [-2040.575] (-2042.500) (-2038.917) (-2040.619) * (-2042.264) [-2033.185] (-2035.426) (-2039.915) -- 0:01:59
569500 -- (-2035.251) (-2046.303) (-2046.165) [-2037.099] * (-2039.585) [-2033.426] (-2039.191) (-2038.390) -- 0:01:59
570000 -- (-2044.152) [-2040.271] (-2042.404) (-2034.388) * [-2042.324] (-2034.179) (-2040.574) (-2035.665) -- 0:01:59
Average standard deviation of split frequencies: 0.007435
570500 -- [-2038.780] (-2036.564) (-2040.908) (-2040.264) * (-2032.994) (-2036.525) [-2038.671] (-2042.695) -- 0:01:59
571000 -- (-2038.996) (-2039.312) (-2037.872) [-2034.851] * [-2037.435] (-2041.246) (-2034.311) (-2050.754) -- 0:01:59
571500 -- (-2038.444) (-2033.763) (-2039.772) [-2032.497] * (-2038.484) (-2043.831) [-2036.947] (-2050.286) -- 0:01:59
572000 -- (-2034.351) (-2031.795) (-2033.403) [-2036.859] * (-2032.725) [-2033.862] (-2037.706) (-2036.558) -- 0:01:58
572500 -- [-2036.023] (-2034.241) (-2041.214) (-2038.502) * (-2039.948) [-2035.582] (-2043.364) (-2034.372) -- 0:01:58
573000 -- [-2040.208] (-2034.474) (-2039.293) (-2043.701) * (-2041.371) (-2033.420) (-2045.471) [-2033.418] -- 0:01:58
573500 -- (-2037.328) [-2035.403] (-2032.818) (-2046.091) * [-2033.332] (-2039.457) (-2045.422) (-2033.400) -- 0:01:58
574000 -- (-2038.348) (-2044.172) [-2032.261] (-2037.800) * (-2035.717) (-2037.210) [-2037.002] (-2044.583) -- 0:01:58
574500 -- (-2038.672) [-2035.299] (-2033.437) (-2037.918) * (-2039.261) [-2043.081] (-2037.061) (-2041.214) -- 0:01:58
575000 -- (-2037.004) (-2035.188) [-2031.872] (-2043.282) * [-2032.602] (-2041.604) (-2043.345) (-2038.688) -- 0:01:58
Average standard deviation of split frequencies: 0.007570
575500 -- (-2037.973) (-2034.748) [-2036.562] (-2033.350) * (-2043.315) [-2033.895] (-2048.921) (-2041.799) -- 0:01:58
576000 -- (-2046.672) [-2039.105] (-2046.548) (-2032.926) * [-2033.064] (-2036.773) (-2041.379) (-2033.922) -- 0:01:57
576500 -- [-2030.948] (-2035.162) (-2041.760) (-2032.329) * (-2039.369) [-2037.763] (-2035.156) (-2031.366) -- 0:01:57
577000 -- [-2037.197] (-2037.454) (-2041.598) (-2038.106) * [-2034.574] (-2037.875) (-2038.469) (-2034.806) -- 0:01:57
577500 -- [-2039.929] (-2036.822) (-2036.155) (-2031.883) * (-2044.429) (-2033.798) (-2039.766) [-2031.203] -- 0:01:57
578000 -- (-2046.773) (-2033.661) (-2043.081) [-2031.966] * (-2041.348) (-2030.938) (-2033.690) [-2033.868] -- 0:01:57
578500 -- (-2034.515) (-2040.410) [-2032.676] (-2038.229) * (-2042.812) (-2034.710) (-2043.920) [-2032.503] -- 0:01:57
579000 -- [-2034.523] (-2038.518) (-2037.666) (-2036.227) * [-2039.820] (-2035.938) (-2040.604) (-2036.886) -- 0:01:57
579500 -- (-2037.097) (-2047.831) (-2036.986) [-2040.697] * (-2039.300) (-2035.843) (-2037.518) [-2034.172] -- 0:01:56
580000 -- (-2039.039) [-2041.217] (-2041.839) (-2045.983) * (-2035.919) (-2039.417) (-2034.617) [-2037.084] -- 0:01:56
Average standard deviation of split frequencies: 0.007104
580500 -- (-2033.959) (-2034.177) (-2042.731) [-2036.557] * (-2040.740) (-2037.739) [-2033.621] (-2039.306) -- 0:01:56
581000 -- (-2032.353) [-2037.249] (-2039.189) (-2038.925) * (-2038.305) [-2042.817] (-2045.063) (-2031.274) -- 0:01:56
581500 -- [-2039.385] (-2040.011) (-2049.451) (-2041.322) * (-2036.271) (-2035.939) [-2034.219] (-2033.401) -- 0:01:56
582000 -- (-2032.676) (-2041.347) (-2045.309) [-2042.967] * (-2034.671) (-2036.387) (-2040.259) [-2035.779] -- 0:01:56
582500 -- [-2035.338] (-2035.897) (-2045.125) (-2036.084) * (-2032.081) [-2036.243] (-2039.663) (-2033.551) -- 0:01:56
583000 -- (-2031.340) (-2048.678) (-2035.235) [-2038.080] * (-2039.042) (-2038.281) [-2032.925] (-2035.345) -- 0:01:55
583500 -- (-2034.030) (-2039.703) [-2033.070] (-2041.767) * (-2031.992) (-2046.941) [-2041.101] (-2038.047) -- 0:01:55
584000 -- (-2040.363) (-2038.590) [-2036.673] (-2034.582) * [-2036.665] (-2043.717) (-2035.985) (-2031.674) -- 0:01:55
584500 -- (-2032.706) [-2035.962] (-2041.756) (-2037.024) * (-2039.732) (-2036.435) [-2031.371] (-2034.826) -- 0:01:55
585000 -- (-2040.898) [-2032.503] (-2044.557) (-2039.032) * (-2044.664) (-2035.004) (-2038.194) [-2033.883] -- 0:01:55
Average standard deviation of split frequencies: 0.007441
585500 -- (-2038.256) (-2043.152) [-2035.038] (-2038.855) * (-2035.562) (-2040.375) (-2030.863) [-2031.544] -- 0:01:55
586000 -- [-2037.311] (-2038.501) (-2033.654) (-2038.323) * (-2038.685) [-2040.705] (-2035.788) (-2037.737) -- 0:01:55
586500 -- (-2045.284) [-2039.265] (-2038.237) (-2041.913) * [-2030.442] (-2050.329) (-2039.903) (-2033.643) -- 0:01:54
587000 -- [-2035.181] (-2033.457) (-2033.719) (-2038.709) * [-2037.441] (-2039.973) (-2035.645) (-2034.569) -- 0:01:54
587500 -- (-2051.534) (-2035.775) (-2037.294) [-2039.804] * (-2039.402) (-2035.970) [-2038.444] (-2036.489) -- 0:01:54
588000 -- (-2039.657) [-2035.711] (-2035.940) (-2032.868) * (-2037.035) [-2032.909] (-2036.905) (-2038.331) -- 0:01:54
588500 -- (-2038.002) (-2037.001) (-2029.716) [-2036.286] * (-2037.417) (-2038.124) [-2042.336] (-2036.352) -- 0:01:54
589000 -- [-2035.855] (-2033.551) (-2041.597) (-2036.017) * (-2034.445) (-2039.702) (-2036.793) [-2036.960] -- 0:01:54
589500 -- (-2032.432) (-2037.269) (-2039.599) [-2038.247] * (-2041.103) [-2031.521] (-2037.593) (-2029.246) -- 0:01:54
590000 -- (-2032.441) [-2034.813] (-2037.120) (-2047.212) * (-2043.286) [-2034.933] (-2042.401) (-2038.955) -- 0:01:53
Average standard deviation of split frequencies: 0.006983
590500 -- (-2035.021) (-2042.794) (-2039.978) [-2034.694] * (-2043.185) (-2038.434) (-2039.296) [-2037.222] -- 0:01:53
591000 -- (-2037.970) (-2034.956) [-2035.748] (-2039.236) * (-2040.637) [-2038.817] (-2042.302) (-2038.408) -- 0:01:53
591500 -- (-2037.383) [-2035.549] (-2034.388) (-2032.745) * (-2039.280) (-2033.634) [-2032.052] (-2039.237) -- 0:01:53
592000 -- (-2037.690) (-2035.553) (-2045.152) [-2033.716] * [-2037.120] (-2037.780) (-2040.641) (-2034.715) -- 0:01:53
592500 -- (-2035.526) (-2037.656) [-2038.871] (-2039.610) * [-2037.885] (-2037.123) (-2035.618) (-2041.768) -- 0:01:53
593000 -- (-2036.434) (-2039.550) (-2037.589) [-2041.192] * (-2041.838) (-2035.952) [-2032.990] (-2034.684) -- 0:01:53
593500 -- [-2036.886] (-2037.611) (-2034.250) (-2037.593) * [-2036.104] (-2030.556) (-2038.107) (-2038.195) -- 0:01:53
594000 -- [-2040.012] (-2034.722) (-2034.666) (-2035.150) * [-2037.223] (-2034.476) (-2038.918) (-2035.637) -- 0:01:52
594500 -- (-2045.491) (-2037.764) [-2039.465] (-2041.424) * (-2040.741) (-2040.911) (-2037.419) [-2043.071] -- 0:01:52
595000 -- (-2037.034) (-2037.689) [-2045.491] (-2035.495) * (-2033.332) [-2034.870] (-2045.130) (-2041.982) -- 0:01:52
Average standard deviation of split frequencies: 0.006525
595500 -- (-2042.609) (-2043.091) (-2033.579) [-2033.303] * (-2030.727) [-2032.122] (-2031.744) (-2037.617) -- 0:01:52
596000 -- (-2033.810) (-2030.708) (-2041.132) [-2035.116] * [-2035.660] (-2035.167) (-2032.864) (-2038.377) -- 0:01:52
596500 -- (-2038.952) (-2035.571) (-2040.155) [-2035.468] * (-2036.901) (-2036.376) [-2036.174] (-2039.854) -- 0:01:52
597000 -- (-2035.228) [-2042.269] (-2031.873) (-2043.326) * (-2038.648) (-2036.580) (-2036.887) [-2037.138] -- 0:01:52
597500 -- (-2035.559) (-2038.781) [-2036.962] (-2042.979) * (-2047.574) [-2031.939] (-2038.350) (-2039.033) -- 0:01:51
598000 -- (-2039.144) (-2040.325) [-2041.631] (-2037.512) * (-2042.094) (-2039.781) [-2042.819] (-2040.071) -- 0:01:51
598500 -- (-2037.177) (-2034.966) (-2046.212) [-2037.529] * (-2039.537) (-2039.237) (-2034.415) [-2036.711] -- 0:01:51
599000 -- (-2037.554) [-2039.732] (-2041.467) (-2041.159) * (-2033.858) (-2035.333) (-2040.449) [-2042.863] -- 0:01:51
599500 -- (-2036.615) [-2037.718] (-2041.961) (-2034.966) * [-2047.668] (-2037.042) (-2039.340) (-2043.544) -- 0:01:51
600000 -- [-2038.634] (-2034.696) (-2034.241) (-2041.714) * (-2038.837) (-2032.995) (-2038.233) [-2039.667] -- 0:01:51
Average standard deviation of split frequencies: 0.005494
600500 -- (-2035.323) (-2036.480) (-2038.325) [-2038.953] * (-2035.488) (-2036.467) (-2038.145) [-2039.107] -- 0:01:51
601000 -- (-2036.462) [-2032.983] (-2034.373) (-2041.486) * (-2037.283) (-2035.814) [-2033.112] (-2035.711) -- 0:01:50
601500 -- (-2034.652) (-2039.095) [-2038.036] (-2040.993) * (-2032.267) (-2037.181) [-2034.826] (-2035.949) -- 0:01:50
602000 -- (-2036.640) [-2034.613] (-2045.322) (-2048.571) * [-2039.153] (-2041.006) (-2040.730) (-2037.291) -- 0:01:50
602500 -- (-2040.891) [-2034.955] (-2042.066) (-2040.963) * [-2037.316] (-2036.606) (-2036.988) (-2040.040) -- 0:01:50
603000 -- (-2035.794) (-2034.484) [-2034.718] (-2035.506) * [-2038.958] (-2040.595) (-2043.591) (-2040.443) -- 0:01:50
603500 -- [-2037.500] (-2041.243) (-2044.481) (-2035.273) * [-2034.447] (-2042.895) (-2038.637) (-2041.684) -- 0:01:50
604000 -- (-2033.861) (-2048.555) (-2036.080) [-2037.383] * (-2044.637) (-2039.765) [-2037.238] (-2035.973) -- 0:01:50
604500 -- (-2034.530) (-2039.817) [-2040.706] (-2051.331) * (-2044.372) (-2038.360) (-2038.096) [-2032.013] -- 0:01:49
605000 -- (-2039.453) [-2035.772] (-2039.251) (-2039.892) * (-2034.928) (-2037.673) [-2046.841] (-2040.452) -- 0:01:49
Average standard deviation of split frequencies: 0.006418
605500 -- (-2034.719) (-2035.781) (-2033.154) [-2036.878] * [-2036.343] (-2033.929) (-2037.535) (-2039.724) -- 0:01:49
606000 -- (-2037.930) (-2034.076) (-2034.028) [-2042.843] * (-2044.637) (-2035.217) (-2043.626) [-2035.774] -- 0:01:49
606500 -- (-2035.288) [-2033.056] (-2038.673) (-2041.515) * [-2037.861] (-2032.182) (-2033.313) (-2034.885) -- 0:01:49
607000 -- (-2042.697) (-2039.475) (-2037.599) [-2034.619] * (-2046.393) (-2042.653) (-2031.811) [-2031.201] -- 0:01:49
607500 -- (-2035.868) (-2037.787) (-2034.683) [-2037.212] * [-2038.722] (-2036.322) (-2032.143) (-2035.469) -- 0:01:49
608000 -- (-2034.538) [-2040.115] (-2034.005) (-2042.758) * [-2031.839] (-2042.558) (-2041.465) (-2037.209) -- 0:01:48
608500 -- (-2034.731) (-2036.608) [-2035.944] (-2044.271) * [-2035.542] (-2031.088) (-2036.680) (-2042.815) -- 0:01:48
609000 -- (-2038.658) [-2040.823] (-2032.933) (-2042.077) * (-2034.618) [-2038.995] (-2036.472) (-2039.924) -- 0:01:48
609500 -- (-2038.458) [-2042.174] (-2034.006) (-2031.831) * (-2034.253) (-2038.134) (-2033.089) [-2034.212] -- 0:01:48
610000 -- (-2049.015) (-2035.168) (-2032.347) [-2040.480] * (-2041.095) (-2035.095) [-2036.151] (-2037.641) -- 0:01:48
Average standard deviation of split frequencies: 0.007334
610500 -- (-2040.274) (-2033.854) [-2039.189] (-2035.751) * (-2040.905) (-2042.961) [-2035.813] (-2035.945) -- 0:01:48
611000 -- (-2045.539) (-2030.811) (-2047.678) [-2037.087] * [-2038.537] (-2035.914) (-2036.441) (-2034.493) -- 0:01:48
611500 -- (-2051.516) [-2033.761] (-2039.229) (-2035.580) * (-2043.250) (-2041.253) (-2033.367) [-2039.579] -- 0:01:48
612000 -- (-2044.512) (-2038.336) (-2040.419) [-2037.314] * (-2042.583) (-2037.646) [-2037.065] (-2036.886) -- 0:01:47
612500 -- [-2036.552] (-2038.374) (-2045.377) (-2032.248) * (-2037.233) [-2038.642] (-2040.100) (-2033.936) -- 0:01:47
613000 -- (-2037.344) (-2032.647) (-2040.919) [-2042.127] * (-2039.060) (-2039.952) (-2034.269) [-2035.259] -- 0:01:47
613500 -- (-2032.397) [-2037.239] (-2044.148) (-2035.266) * (-2041.913) (-2038.420) (-2034.607) [-2037.377] -- 0:01:47
614000 -- (-2041.794) (-2036.389) (-2047.673) [-2040.458] * [-2044.966] (-2040.567) (-2038.129) (-2032.186) -- 0:01:47
614500 -- [-2035.006] (-2034.807) (-2042.695) (-2041.809) * (-2046.657) (-2039.178) (-2034.949) [-2043.501] -- 0:01:47
615000 -- (-2039.633) (-2036.162) (-2038.070) [-2035.711] * (-2040.441) (-2039.060) [-2035.534] (-2033.523) -- 0:01:47
Average standard deviation of split frequencies: 0.006122
615500 -- (-2031.561) [-2038.823] (-2040.457) (-2036.469) * [-2035.409] (-2036.287) (-2037.224) (-2041.712) -- 0:01:46
616000 -- (-2037.145) [-2036.711] (-2038.063) (-2034.106) * (-2032.364) (-2044.002) (-2041.016) [-2033.668] -- 0:01:46
616500 -- (-2042.612) [-2038.639] (-2042.798) (-2033.891) * [-2032.748] (-2040.347) (-2033.221) (-2035.377) -- 0:01:46
617000 -- [-2035.414] (-2041.990) (-2038.375) (-2044.523) * (-2032.713) (-2038.996) [-2037.156] (-2043.718) -- 0:01:46
617500 -- (-2037.333) (-2036.940) (-2038.614) [-2037.316] * [-2037.466] (-2035.789) (-2040.005) (-2036.967) -- 0:01:46
618000 -- (-2041.113) (-2041.064) [-2039.577] (-2037.313) * (-2038.188) (-2034.801) [-2033.197] (-2035.937) -- 0:01:46
618500 -- [-2031.145] (-2033.596) (-2034.599) (-2034.091) * [-2032.339] (-2039.206) (-2037.383) (-2037.308) -- 0:01:46
619000 -- (-2033.460) (-2035.384) (-2041.689) [-2040.540] * (-2039.271) [-2035.728] (-2036.219) (-2040.871) -- 0:01:45
619500 -- (-2032.770) (-2043.579) [-2037.685] (-2032.695) * (-2038.267) [-2036.208] (-2036.538) (-2037.071) -- 0:01:45
620000 -- (-2039.437) (-2052.277) [-2036.341] (-2037.359) * (-2047.002) (-2035.780) (-2041.692) [-2037.824] -- 0:01:45
Average standard deviation of split frequencies: 0.006456
620500 -- (-2034.495) (-2041.871) [-2033.721] (-2041.168) * [-2034.617] (-2035.601) (-2035.817) (-2034.125) -- 0:01:45
621000 -- (-2035.608) (-2039.316) [-2036.443] (-2043.340) * (-2038.281) (-2035.651) (-2034.000) [-2031.097] -- 0:01:45
621500 -- [-2029.747] (-2045.648) (-2034.631) (-2036.871) * (-2044.056) (-2033.870) [-2030.660] (-2039.856) -- 0:01:45
622000 -- (-2035.749) [-2035.049] (-2034.112) (-2041.234) * (-2039.005) (-2035.534) [-2037.782] (-2033.252) -- 0:01:45
622500 -- (-2035.549) [-2039.238] (-2033.404) (-2036.443) * (-2036.260) [-2033.875] (-2035.012) (-2040.420) -- 0:01:44
623000 -- (-2039.535) [-2032.725] (-2037.870) (-2042.349) * (-2038.538) (-2037.515) (-2036.365) [-2035.710] -- 0:01:44
623500 -- (-2035.208) [-2033.146] (-2036.440) (-2042.221) * (-2036.428) (-2041.701) (-2045.009) [-2039.512] -- 0:01:44
624000 -- [-2035.830] (-2041.203) (-2035.156) (-2037.485) * (-2040.648) (-2038.940) (-2038.341) [-2036.498] -- 0:01:44
624500 -- (-2039.991) [-2033.300] (-2035.200) (-2038.113) * (-2042.183) (-2040.062) (-2041.316) [-2034.047] -- 0:01:44
625000 -- (-2034.933) (-2053.647) [-2037.196] (-2036.412) * (-2037.604) (-2045.575) [-2037.957] (-2037.249) -- 0:01:44
Average standard deviation of split frequencies: 0.006024
625500 -- (-2039.587) (-2031.669) [-2037.955] (-2036.722) * (-2035.019) (-2044.397) [-2035.655] (-2040.102) -- 0:01:44
626000 -- [-2032.540] (-2038.022) (-2043.919) (-2034.329) * [-2049.886] (-2032.454) (-2039.710) (-2039.837) -- 0:01:43
626500 -- (-2035.263) [-2033.791] (-2039.327) (-2036.689) * [-2039.793] (-2043.136) (-2037.091) (-2036.531) -- 0:01:43
627000 -- (-2040.790) [-2033.414] (-2039.877) (-2031.080) * [-2037.671] (-2039.492) (-2032.827) (-2040.240) -- 0:01:43
627500 -- [-2039.382] (-2035.299) (-2039.520) (-2038.304) * (-2035.134) (-2035.279) [-2042.270] (-2043.429) -- 0:01:43
628000 -- (-2053.310) (-2037.750) (-2034.810) [-2041.252] * [-2033.452] (-2036.293) (-2046.168) (-2048.839) -- 0:01:43
628500 -- (-2044.244) (-2035.148) (-2038.761) [-2035.605] * (-2035.371) (-2046.356) (-2037.750) [-2039.101] -- 0:01:43
629000 -- (-2039.158) [-2034.670] (-2040.031) (-2038.648) * [-2033.552] (-2036.215) (-2035.522) (-2045.344) -- 0:01:43
629500 -- (-2046.323) (-2031.758) (-2044.982) [-2039.140] * [-2032.943] (-2041.308) (-2038.851) (-2038.440) -- 0:01:42
630000 -- (-2039.620) [-2036.173] (-2040.471) (-2044.449) * [-2045.087] (-2044.415) (-2039.878) (-2041.437) -- 0:01:42
Average standard deviation of split frequencies: 0.005793
630500 -- (-2043.770) [-2032.416] (-2039.295) (-2043.570) * [-2035.822] (-2036.027) (-2039.970) (-2036.888) -- 0:01:42
631000 -- (-2040.445) (-2037.615) [-2033.360] (-2038.894) * (-2038.847) [-2043.431] (-2034.418) (-2042.918) -- 0:01:42
631500 -- (-2037.006) (-2044.812) [-2039.532] (-2037.656) * [-2039.352] (-2036.318) (-2036.489) (-2033.362) -- 0:01:42
632000 -- (-2036.516) (-2040.203) (-2037.624) [-2037.630] * (-2038.223) [-2037.936] (-2036.959) (-2036.841) -- 0:01:42
632500 -- (-2040.084) [-2035.406] (-2035.506) (-2033.351) * (-2033.251) (-2033.138) (-2036.312) [-2042.521] -- 0:01:42
633000 -- [-2033.642] (-2030.759) (-2041.894) (-2036.454) * (-2042.562) (-2036.777) [-2033.901] (-2041.775) -- 0:01:42
633500 -- (-2036.583) (-2035.087) (-2044.727) [-2038.256] * (-2036.616) (-2037.733) [-2036.449] (-2045.119) -- 0:01:41
634000 -- (-2038.220) [-2037.330] (-2049.292) (-2031.131) * (-2036.592) (-2040.896) [-2035.587] (-2038.994) -- 0:01:41
634500 -- (-2037.747) (-2035.681) [-2037.572] (-2038.423) * (-2040.794) (-2037.977) [-2031.865] (-2041.618) -- 0:01:41
635000 -- (-2039.146) (-2031.980) (-2036.720) [-2032.790] * [-2034.509] (-2030.546) (-2038.145) (-2042.347) -- 0:01:41
Average standard deviation of split frequencies: 0.005374
635500 -- (-2039.085) (-2032.479) [-2036.332] (-2035.027) * (-2036.860) (-2036.011) [-2033.795] (-2035.712) -- 0:01:41
636000 -- (-2036.179) [-2034.744] (-2047.087) (-2037.484) * (-2039.138) (-2035.784) [-2032.985] (-2037.212) -- 0:01:41
636500 -- (-2038.668) [-2038.293] (-2034.004) (-2032.086) * (-2041.205) [-2033.898] (-2040.711) (-2030.460) -- 0:01:41
637000 -- (-2042.563) (-2030.863) [-2035.295] (-2035.358) * (-2044.837) (-2035.326) [-2034.561] (-2033.687) -- 0:01:40
637500 -- (-2039.755) (-2036.510) (-2039.732) [-2037.392] * [-2046.524] (-2034.585) (-2036.517) (-2040.351) -- 0:01:40
638000 -- (-2041.384) [-2034.420] (-2035.191) (-2033.362) * [-2036.086] (-2043.928) (-2036.697) (-2039.115) -- 0:01:40
638500 -- (-2033.956) (-2038.520) [-2036.528] (-2033.958) * (-2033.737) (-2040.387) [-2032.816] (-2047.933) -- 0:01:40
639000 -- (-2039.624) (-2036.962) (-2041.857) [-2034.408] * (-2034.019) (-2034.842) [-2031.079] (-2035.293) -- 0:01:39
639500 -- (-2038.185) (-2031.526) (-2041.503) [-2039.041] * (-2036.363) (-2036.372) [-2035.050] (-2037.806) -- 0:01:40
640000 -- [-2037.242] (-2036.939) (-2036.916) (-2047.572) * (-2032.491) (-2047.127) (-2039.637) [-2042.490] -- 0:01:40
Average standard deviation of split frequencies: 0.003863
640500 -- (-2039.794) (-2041.830) [-2037.181] (-2046.015) * [-2032.573] (-2038.457) (-2036.044) (-2032.127) -- 0:01:39
641000 -- (-2036.688) [-2032.756] (-2040.917) (-2030.668) * (-2034.926) (-2039.389) [-2033.714] (-2037.844) -- 0:01:39
641500 -- (-2041.018) (-2031.858) (-2036.210) [-2038.364] * (-2040.276) (-2034.591) [-2037.431] (-2043.366) -- 0:01:39
642000 -- (-2035.571) (-2035.912) [-2036.766] (-2036.232) * (-2036.451) (-2041.593) [-2040.847] (-2036.058) -- 0:01:39
642500 -- [-2032.751] (-2035.217) (-2039.919) (-2042.585) * [-2038.977] (-2045.071) (-2038.102) (-2035.186) -- 0:01:39
643000 -- [-2037.416] (-2039.418) (-2040.223) (-2042.735) * (-2041.591) (-2035.817) (-2038.323) [-2036.870] -- 0:01:39
643500 -- (-2038.921) [-2033.191] (-2044.502) (-2046.836) * (-2043.806) (-2039.001) [-2034.104] (-2031.402) -- 0:01:39
644000 -- (-2039.619) (-2038.023) [-2053.378] (-2038.747) * (-2038.708) (-2039.839) [-2034.237] (-2035.937) -- 0:01:38
644500 -- (-2043.221) (-2037.237) [-2037.288] (-2040.617) * (-2036.248) (-2035.573) (-2043.667) [-2035.550] -- 0:01:38
645000 -- (-2035.797) [-2036.710] (-2038.760) (-2040.649) * (-2041.230) [-2036.660] (-2035.192) (-2034.383) -- 0:01:38
Average standard deviation of split frequencies: 0.003649
645500 -- (-2035.499) (-2039.682) (-2041.180) [-2033.941] * [-2031.362] (-2037.082) (-2034.165) (-2042.255) -- 0:01:38
646000 -- (-2037.790) (-2034.699) (-2033.849) [-2041.022] * (-2038.728) [-2039.114] (-2034.718) (-2041.532) -- 0:01:38
646500 -- (-2046.145) (-2042.862) [-2038.461] (-2044.291) * (-2037.825) (-2032.641) (-2036.626) [-2035.422] -- 0:01:38
647000 -- [-2040.306] (-2040.850) (-2036.372) (-2036.728) * (-2038.233) (-2037.286) (-2037.459) [-2035.212] -- 0:01:38
647500 -- [-2034.747] (-2040.855) (-2044.610) (-2041.494) * (-2038.859) (-2036.864) (-2041.504) [-2038.478] -- 0:01:37
648000 -- (-2037.660) [-2036.224] (-2042.200) (-2040.414) * (-2041.618) [-2035.315] (-2039.807) (-2040.258) -- 0:01:37
648500 -- (-2044.072) [-2038.963] (-2037.264) (-2039.959) * (-2038.265) (-2040.683) (-2056.303) [-2037.339] -- 0:01:37
649000 -- (-2041.642) [-2034.014] (-2036.886) (-2038.371) * (-2040.997) (-2042.282) [-2039.294] (-2034.731) -- 0:01:37
649500 -- (-2042.526) (-2037.865) [-2035.855] (-2034.760) * [-2032.122] (-2036.280) (-2036.701) (-2038.053) -- 0:01:37
650000 -- (-2038.712) [-2032.979] (-2039.285) (-2034.477) * [-2037.325] (-2034.490) (-2035.008) (-2035.570) -- 0:01:37
Average standard deviation of split frequencies: 0.003622
650500 -- (-2035.499) (-2035.955) [-2036.377] (-2032.995) * (-2034.164) [-2039.208] (-2046.124) (-2036.132) -- 0:01:37
651000 -- (-2032.307) (-2038.004) (-2035.359) [-2035.075] * (-2034.597) (-2045.195) [-2043.756] (-2035.939) -- 0:01:37
651500 -- [-2035.271] (-2035.549) (-2042.436) (-2032.041) * (-2033.786) (-2045.332) (-2043.838) [-2039.100] -- 0:01:36
652000 -- (-2040.199) [-2033.742] (-2040.250) (-2038.734) * (-2039.724) [-2034.310] (-2037.009) (-2035.043) -- 0:01:36
652500 -- (-2039.862) [-2034.630] (-2038.580) (-2032.680) * (-2036.645) (-2037.059) (-2036.610) [-2038.330] -- 0:01:36
653000 -- (-2037.372) [-2036.027] (-2048.829) (-2038.486) * (-2038.532) [-2039.670] (-2049.731) (-2046.645) -- 0:01:36
653500 -- (-2043.160) (-2036.133) (-2035.899) [-2035.303] * (-2039.584) [-2038.974] (-2034.607) (-2034.443) -- 0:01:35
654000 -- [-2033.310] (-2036.756) (-2036.437) (-2036.539) * (-2036.189) (-2041.832) (-2033.417) [-2034.559] -- 0:01:36
654500 -- [-2039.836] (-2037.190) (-2031.704) (-2040.916) * (-2038.984) (-2036.658) [-2030.963] (-2035.523) -- 0:01:36
655000 -- (-2043.699) (-2036.490) [-2035.586] (-2036.547) * (-2038.871) (-2039.635) (-2037.141) [-2035.987] -- 0:01:35
Average standard deviation of split frequencies: 0.003773
655500 -- (-2037.608) (-2037.774) [-2036.715] (-2041.243) * (-2040.232) (-2043.408) (-2033.746) [-2044.309] -- 0:01:35
656000 -- (-2037.262) (-2040.234) [-2035.743] (-2031.956) * (-2040.491) (-2032.075) [-2032.815] (-2045.050) -- 0:01:35
656500 -- (-2035.476) (-2037.358) [-2041.075] (-2037.581) * [-2037.453] (-2040.081) (-2033.523) (-2034.987) -- 0:01:35
657000 -- (-2034.546) (-2042.976) [-2040.641] (-2031.238) * [-2037.807] (-2041.393) (-2037.792) (-2041.131) -- 0:01:35
657500 -- (-2037.177) [-2030.620] (-2034.399) (-2034.710) * (-2044.037) [-2044.109] (-2033.563) (-2051.294) -- 0:01:35
658000 -- (-2037.770) (-2035.910) (-2033.697) [-2033.373] * [-2031.921] (-2049.699) (-2034.628) (-2031.378) -- 0:01:35
658500 -- (-2038.679) (-2036.526) (-2034.610) [-2034.730] * (-2032.437) (-2032.773) (-2033.910) [-2034.490] -- 0:01:34
659000 -- (-2036.656) [-2031.919] (-2041.324) (-2038.271) * (-2038.509) (-2035.103) (-2042.193) [-2038.704] -- 0:01:34
659500 -- (-2041.035) [-2034.950] (-2035.197) (-2038.799) * [-2032.541] (-2034.338) (-2036.304) (-2040.551) -- 0:01:34
660000 -- (-2035.239) (-2041.705) [-2035.053] (-2037.870) * (-2034.327) (-2030.520) [-2040.769] (-2039.790) -- 0:01:34
Average standard deviation of split frequencies: 0.003389
660500 -- (-2038.437) (-2039.551) [-2032.603] (-2033.443) * (-2043.394) (-2035.860) (-2046.338) [-2032.129] -- 0:01:34
661000 -- [-2033.385] (-2040.016) (-2040.729) (-2037.066) * [-2033.088] (-2038.318) (-2040.408) (-2035.595) -- 0:01:34
661500 -- (-2036.137) (-2031.915) (-2037.945) [-2031.642] * [-2037.042] (-2036.041) (-2045.087) (-2037.713) -- 0:01:34
662000 -- [-2036.863] (-2046.682) (-2038.976) (-2033.675) * (-2046.487) (-2035.307) (-2046.354) [-2038.881] -- 0:01:33
662500 -- [-2039.624] (-2042.855) (-2033.444) (-2037.439) * [-2038.535] (-2036.705) (-2034.600) (-2035.880) -- 0:01:33
663000 -- (-2039.985) (-2048.985) (-2040.297) [-2036.417] * (-2032.059) (-2038.666) [-2037.275] (-2039.941) -- 0:01:33
663500 -- [-2043.277] (-2044.038) (-2033.742) (-2032.887) * [-2038.546] (-2034.889) (-2043.373) (-2037.030) -- 0:01:33
664000 -- (-2039.851) (-2048.273) (-2033.386) [-2042.648] * (-2033.934) (-2032.522) (-2036.345) [-2036.971] -- 0:01:33
664500 -- (-2040.662) (-2042.151) [-2036.770] (-2037.643) * (-2039.860) (-2041.822) (-2038.271) [-2040.142] -- 0:01:32
665000 -- (-2036.431) (-2036.921) (-2041.751) [-2031.130] * (-2033.493) [-2039.631] (-2036.023) (-2041.812) -- 0:01:33
Average standard deviation of split frequencies: 0.003539
665500 -- [-2032.614] (-2034.846) (-2036.579) (-2033.709) * (-2038.800) [-2043.554] (-2043.267) (-2037.497) -- 0:01:32
666000 -- (-2039.380) (-2037.809) (-2040.955) [-2034.687] * (-2039.264) (-2039.928) (-2033.667) [-2036.132] -- 0:01:32
666500 -- (-2039.706) (-2037.060) [-2037.353] (-2030.640) * [-2034.948] (-2042.327) (-2038.753) (-2037.295) -- 0:01:32
667000 -- (-2039.183) (-2035.906) (-2034.650) [-2040.802] * (-2036.681) (-2045.999) [-2039.070] (-2041.853) -- 0:01:32
667500 -- [-2032.949] (-2032.257) (-2032.092) (-2035.383) * (-2033.023) (-2041.334) (-2040.521) [-2045.956] -- 0:01:32
668000 -- (-2036.136) [-2038.528] (-2038.885) (-2038.099) * (-2033.825) (-2045.227) [-2039.595] (-2032.894) -- 0:01:31
668500 -- (-2036.274) (-2042.933) [-2035.819] (-2034.261) * (-2033.279) (-2036.520) (-2032.375) [-2039.129] -- 0:01:32
669000 -- (-2034.880) (-2032.988) (-2039.039) [-2039.852] * (-2034.183) [-2031.778] (-2036.835) (-2032.901) -- 0:01:32
669500 -- (-2039.769) (-2035.626) (-2038.267) [-2041.881] * (-2034.408) (-2039.168) [-2035.153] (-2035.554) -- 0:01:31
670000 -- (-2034.484) (-2036.355) [-2040.349] (-2039.322) * (-2033.581) (-2038.558) (-2037.627) [-2039.274] -- 0:01:31
Average standard deviation of split frequencies: 0.004217
670500 -- (-2043.140) (-2037.653) [-2046.111] (-2036.106) * (-2034.290) (-2043.022) [-2037.632] (-2032.050) -- 0:01:31
671000 -- (-2037.127) [-2036.275] (-2033.081) (-2040.334) * (-2037.047) (-2033.708) [-2035.143] (-2040.843) -- 0:01:31
671500 -- (-2041.314) (-2041.589) [-2036.365] (-2038.321) * [-2040.119] (-2045.731) (-2038.345) (-2044.700) -- 0:01:30
672000 -- (-2045.290) (-2037.448) [-2035.510] (-2039.733) * [-2035.054] (-2037.760) (-2039.272) (-2038.115) -- 0:01:31
672500 -- [-2037.442] (-2039.269) (-2042.840) (-2037.379) * (-2034.113) (-2043.207) (-2033.815) [-2035.597] -- 0:01:31
673000 -- [-2036.944] (-2041.476) (-2041.322) (-2043.367) * [-2039.218] (-2039.830) (-2033.893) (-2036.894) -- 0:01:30
673500 -- (-2042.883) (-2038.513) [-2039.006] (-2037.434) * (-2035.361) (-2033.210) [-2035.551] (-2039.010) -- 0:01:30
674000 -- [-2032.672] (-2047.157) (-2041.153) (-2035.004) * [-2035.764] (-2041.258) (-2039.002) (-2038.912) -- 0:01:30
674500 -- [-2035.057] (-2037.384) (-2043.090) (-2035.404) * (-2032.493) (-2041.954) [-2033.847] (-2037.433) -- 0:01:30
675000 -- [-2036.454] (-2035.525) (-2036.222) (-2040.304) * (-2039.395) (-2036.987) [-2032.541] (-2039.080) -- 0:01:30
Average standard deviation of split frequencies: 0.003835
675500 -- (-2039.609) [-2036.587] (-2038.199) (-2035.434) * [-2035.978] (-2038.954) (-2034.162) (-2036.144) -- 0:01:30
676000 -- (-2040.498) (-2043.699) [-2034.797] (-2044.034) * (-2039.253) (-2032.663) [-2035.304] (-2036.093) -- 0:01:30
676500 -- (-2039.905) [-2044.355] (-2038.006) (-2037.153) * [-2038.874] (-2034.115) (-2036.518) (-2036.967) -- 0:01:29
677000 -- (-2037.081) (-2038.019) (-2034.893) [-2032.777] * [-2038.981] (-2038.178) (-2031.232) (-2042.903) -- 0:01:29
677500 -- (-2036.383) (-2038.879) [-2032.928] (-2033.089) * (-2040.081) [-2041.448] (-2039.112) (-2036.345) -- 0:01:29
678000 -- (-2034.571) (-2038.403) [-2030.506] (-2038.947) * [-2032.910] (-2044.134) (-2036.718) (-2039.378) -- 0:01:29
678500 -- [-2033.060] (-2034.151) (-2047.102) (-2029.666) * [-2033.211] (-2039.611) (-2045.812) (-2036.604) -- 0:01:29
679000 -- (-2038.646) [-2041.374] (-2030.657) (-2035.770) * (-2034.089) (-2033.532) [-2034.179] (-2038.509) -- 0:01:28
679500 -- (-2029.487) (-2040.323) (-2030.035) [-2036.510] * [-2036.486] (-2033.370) (-2036.190) (-2039.998) -- 0:01:29
680000 -- (-2037.258) (-2033.872) [-2035.088] (-2041.612) * [-2032.190] (-2038.790) (-2038.085) (-2037.381) -- 0:01:28
Average standard deviation of split frequencies: 0.003463
680500 -- (-2045.761) [-2039.619] (-2036.557) (-2034.622) * (-2040.996) (-2042.151) [-2038.185] (-2036.226) -- 0:01:28
681000 -- (-2037.899) (-2043.156) (-2043.572) [-2034.410] * (-2034.589) (-2040.462) [-2036.044] (-2036.995) -- 0:01:28
681500 -- [-2035.470] (-2036.082) (-2039.601) (-2034.619) * (-2036.257) (-2040.185) (-2045.644) [-2035.420] -- 0:01:28
682000 -- (-2036.293) [-2035.348] (-2043.723) (-2039.419) * (-2041.014) (-2055.175) [-2039.267] (-2041.439) -- 0:01:28
682500 -- (-2036.303) (-2038.337) (-2044.384) [-2042.122] * (-2036.792) [-2035.304] (-2034.879) (-2041.825) -- 0:01:27
683000 -- (-2038.519) (-2037.312) [-2035.569] (-2037.708) * (-2036.994) (-2039.125) [-2030.900] (-2045.366) -- 0:01:28
683500 -- [-2031.688] (-2047.200) (-2038.924) (-2039.309) * (-2038.136) (-2035.860) (-2037.687) [-2048.625] -- 0:01:27
684000 -- (-2034.051) (-2037.476) [-2039.938] (-2047.999) * (-2036.833) [-2033.737] (-2037.930) (-2036.955) -- 0:01:27
684500 -- [-2039.512] (-2042.920) (-2039.261) (-2039.123) * (-2040.028) [-2037.076] (-2035.988) (-2036.315) -- 0:01:27
685000 -- [-2032.531] (-2042.804) (-2041.448) (-2033.612) * (-2045.046) (-2033.740) [-2034.839] (-2040.743) -- 0:01:27
Average standard deviation of split frequencies: 0.002749
685500 -- (-2036.532) (-2041.088) (-2041.117) [-2031.347] * [-2038.459] (-2036.860) (-2039.445) (-2041.289) -- 0:01:27
686000 -- (-2036.357) (-2037.790) [-2037.052] (-2040.755) * (-2042.167) (-2036.706) [-2035.749] (-2038.460) -- 0:01:26
686500 -- [-2037.197] (-2034.265) (-2034.132) (-2041.422) * (-2038.781) [-2036.650] (-2045.147) (-2041.372) -- 0:01:27
687000 -- (-2031.863) (-2032.045) [-2036.129] (-2034.710) * (-2040.059) (-2038.290) (-2043.872) [-2042.312] -- 0:01:27
687500 -- [-2038.996] (-2036.969) (-2035.542) (-2031.558) * (-2044.300) [-2037.455] (-2034.289) (-2039.680) -- 0:01:26
688000 -- (-2036.274) [-2033.440] (-2046.445) (-2034.852) * (-2033.868) (-2040.402) [-2034.131] (-2038.344) -- 0:01:26
688500 -- (-2044.876) [-2032.291] (-2040.327) (-2038.506) * (-2038.147) (-2044.653) (-2037.369) [-2038.345] -- 0:01:26
689000 -- [-2037.578] (-2044.209) (-2036.818) (-2033.085) * (-2037.204) (-2036.156) (-2039.053) [-2034.329] -- 0:01:26
689500 -- [-2037.213] (-2037.934) (-2035.915) (-2035.823) * (-2034.986) [-2035.144] (-2040.818) (-2038.174) -- 0:01:26
690000 -- (-2044.770) (-2035.788) [-2035.971] (-2037.907) * [-2036.837] (-2037.920) (-2036.451) (-2037.896) -- 0:01:26
Average standard deviation of split frequencies: 0.003413
690500 -- (-2041.074) [-2035.677] (-2033.104) (-2035.646) * (-2038.353) (-2034.341) (-2034.490) [-2041.168] -- 0:01:26
691000 -- (-2042.808) (-2031.814) (-2033.649) [-2038.192] * [-2031.018] (-2044.372) (-2036.924) (-2035.624) -- 0:01:25
691500 -- (-2037.905) (-2033.964) (-2034.910) [-2036.388] * (-2036.549) (-2039.645) [-2038.494] (-2038.904) -- 0:01:25
692000 -- [-2033.490] (-2036.049) (-2038.873) (-2042.518) * [-2033.909] (-2037.338) (-2035.253) (-2038.488) -- 0:01:25
692500 -- (-2037.452) [-2038.324] (-2035.399) (-2043.203) * (-2035.022) (-2037.118) (-2042.375) [-2036.842] -- 0:01:25
693000 -- (-2043.001) (-2040.984) (-2036.999) [-2033.115] * [-2030.048] (-2042.520) (-2040.244) (-2031.895) -- 0:01:25
693500 -- (-2036.597) [-2034.952] (-2035.740) (-2035.039) * [-2042.379] (-2039.211) (-2038.922) (-2038.834) -- 0:01:24
694000 -- (-2040.803) (-2042.109) [-2035.528] (-2036.552) * (-2036.127) (-2038.589) [-2036.596] (-2038.629) -- 0:01:25
694500 -- [-2036.995] (-2042.099) (-2036.012) (-2040.259) * (-2033.768) (-2043.472) (-2037.575) [-2035.978] -- 0:01:24
695000 -- (-2040.239) (-2036.882) (-2033.919) [-2046.501] * (-2037.799) (-2036.271) (-2041.708) [-2037.321] -- 0:01:24
Average standard deviation of split frequencies: 0.003048
695500 -- [-2032.495] (-2049.535) (-2044.789) (-2037.219) * (-2041.703) [-2036.282] (-2034.348) (-2036.682) -- 0:01:24
696000 -- (-2036.043) (-2042.152) [-2039.441] (-2039.847) * [-2037.294] (-2035.272) (-2051.590) (-2034.944) -- 0:01:24
696500 -- (-2039.603) [-2035.794] (-2034.736) (-2036.769) * [-2033.466] (-2045.030) (-2038.451) (-2035.920) -- 0:01:24
697000 -- (-2037.638) (-2035.070) [-2038.125] (-2037.343) * [-2033.921] (-2037.716) (-2039.055) (-2033.639) -- 0:01:23
697500 -- (-2037.477) [-2033.222] (-2036.904) (-2046.577) * (-2035.389) (-2038.842) (-2048.881) [-2032.700] -- 0:01:24
698000 -- [-2037.177] (-2033.262) (-2039.400) (-2043.973) * [-2035.792] (-2039.012) (-2041.243) (-2033.683) -- 0:01:23
698500 -- [-2035.190] (-2033.970) (-2034.823) (-2042.595) * [-2034.061] (-2033.874) (-2042.457) (-2040.200) -- 0:01:23
699000 -- (-2037.053) (-2044.519) (-2038.626) [-2038.689] * (-2034.685) (-2036.718) (-2042.228) [-2037.071] -- 0:01:23
699500 -- (-2036.632) [-2034.509] (-2035.250) (-2039.310) * (-2037.794) [-2036.987] (-2038.418) (-2036.103) -- 0:01:23
700000 -- (-2038.886) [-2041.150] (-2035.341) (-2041.163) * (-2037.411) (-2037.608) [-2040.374] (-2036.297) -- 0:01:23
Average standard deviation of split frequencies: 0.003364
700500 -- (-2040.442) (-2050.574) [-2038.015] (-2035.364) * (-2033.141) [-2035.641] (-2036.656) (-2041.840) -- 0:01:22
701000 -- (-2038.065) (-2048.412) (-2034.907) [-2039.548] * (-2032.709) (-2040.833) [-2036.156] (-2040.715) -- 0:01:23
701500 -- (-2032.234) (-2039.141) [-2034.798] (-2036.125) * (-2043.934) (-2039.932) [-2032.183] (-2043.599) -- 0:01:22
702000 -- (-2043.246) (-2041.286) (-2039.173) [-2038.070] * (-2038.093) [-2044.871] (-2037.213) (-2036.695) -- 0:01:22
702500 -- (-2041.207) (-2036.761) [-2037.984] (-2038.391) * (-2039.875) [-2039.223] (-2036.056) (-2043.070) -- 0:01:22
703000 -- (-2035.440) (-2036.855) [-2033.363] (-2045.228) * (-2032.899) (-2039.068) (-2041.219) [-2032.713] -- 0:01:22
703500 -- (-2037.745) (-2042.637) (-2035.883) [-2035.097] * (-2042.503) [-2029.967] (-2039.073) (-2033.044) -- 0:01:22
704000 -- [-2037.508] (-2043.035) (-2038.060) (-2037.961) * [-2033.556] (-2038.834) (-2041.593) (-2034.487) -- 0:01:21
704500 -- (-2038.213) [-2036.508] (-2037.409) (-2045.360) * (-2038.786) (-2036.807) (-2035.717) [-2037.294] -- 0:01:22
705000 -- (-2035.572) (-2045.849) (-2032.462) [-2035.765] * [-2037.290] (-2032.844) (-2035.008) (-2041.645) -- 0:01:22
Average standard deviation of split frequencies: 0.003505
705500 -- [-2041.541] (-2039.641) (-2036.768) (-2041.480) * (-2036.863) (-2048.921) (-2035.554) [-2043.506] -- 0:01:21
706000 -- (-2032.824) (-2040.779) [-2036.607] (-2042.181) * [-2040.506] (-2041.556) (-2038.525) (-2048.580) -- 0:01:21
706500 -- [-2038.620] (-2034.503) (-2044.423) (-2049.162) * (-2038.485) (-2036.016) [-2035.182] (-2047.841) -- 0:01:21
707000 -- (-2046.732) (-2041.646) (-2034.268) [-2036.706] * (-2040.449) [-2035.031] (-2042.605) (-2041.546) -- 0:01:21
707500 -- (-2035.781) (-2046.008) [-2032.453] (-2035.489) * [-2033.609] (-2040.939) (-2044.968) (-2045.571) -- 0:01:21
708000 -- (-2041.157) [-2035.882] (-2035.125) (-2035.696) * (-2043.667) (-2037.180) [-2038.912] (-2043.473) -- 0:01:20
708500 -- (-2036.303) [-2042.669] (-2041.284) (-2041.439) * (-2043.427) [-2036.603] (-2042.372) (-2038.302) -- 0:01:21
709000 -- (-2036.608) (-2036.254) [-2037.541] (-2034.874) * (-2039.663) [-2033.353] (-2036.504) (-2041.705) -- 0:01:20
709500 -- (-2041.889) (-2043.315) (-2033.976) [-2033.419] * (-2040.449) (-2033.425) (-2036.958) [-2040.457] -- 0:01:20
710000 -- (-2035.875) [-2035.782] (-2034.534) (-2039.603) * (-2039.937) (-2032.807) [-2032.359] (-2030.677) -- 0:01:20
Average standard deviation of split frequencies: 0.004477
710500 -- (-2040.544) (-2036.420) (-2035.311) [-2038.119] * (-2039.599) [-2030.787] (-2032.723) (-2039.584) -- 0:01:20
711000 -- (-2045.859) (-2036.189) (-2037.371) [-2036.981] * [-2035.679] (-2036.608) (-2036.750) (-2039.819) -- 0:01:20
711500 -- (-2045.684) (-2032.670) (-2040.069) [-2029.722] * (-2038.566) (-2031.631) (-2035.427) [-2039.857] -- 0:01:19
712000 -- (-2042.699) (-2041.587) (-2039.729) [-2037.315] * (-2035.959) (-2038.323) (-2039.848) [-2037.026] -- 0:01:20
712500 -- (-2037.749) (-2033.346) (-2037.911) [-2034.826] * (-2039.812) [-2035.789] (-2036.638) (-2037.096) -- 0:01:19
713000 -- (-2046.006) [-2036.467] (-2043.332) (-2042.431) * [-2038.380] (-2034.824) (-2036.279) (-2037.384) -- 0:01:19
713500 -- (-2040.078) (-2038.985) (-2042.521) [-2039.778] * [-2037.000] (-2037.817) (-2032.887) (-2040.226) -- 0:01:19
714000 -- (-2040.105) (-2038.589) [-2039.856] (-2052.247) * (-2039.021) (-2049.990) (-2040.046) [-2033.335] -- 0:01:19
714500 -- (-2038.583) [-2034.302] (-2044.515) (-2043.589) * (-2038.420) (-2040.500) [-2041.199] (-2030.376) -- 0:01:19
715000 -- (-2037.050) [-2032.325] (-2038.682) (-2034.809) * (-2035.755) (-2039.343) (-2033.798) [-2036.386] -- 0:01:18
Average standard deviation of split frequencies: 0.004115
715500 -- (-2040.545) [-2032.236] (-2036.565) (-2040.180) * (-2036.403) (-2036.754) [-2037.735] (-2036.015) -- 0:01:19
716000 -- (-2032.238) [-2032.676] (-2035.979) (-2036.199) * (-2039.537) (-2037.295) [-2039.205] (-2037.252) -- 0:01:18
716500 -- (-2038.424) (-2040.922) (-2036.168) [-2037.335] * [-2034.030] (-2036.123) (-2040.762) (-2039.072) -- 0:01:18
717000 -- (-2034.739) (-2037.024) [-2031.758] (-2039.776) * [-2035.408] (-2040.522) (-2036.149) (-2044.193) -- 0:01:18
717500 -- (-2037.047) (-2040.657) (-2033.906) [-2042.394] * (-2042.959) [-2033.944] (-2034.041) (-2035.878) -- 0:01:18
718000 -- (-2037.583) [-2040.485] (-2032.813) (-2038.020) * [-2038.722] (-2035.413) (-2035.174) (-2043.898) -- 0:01:18
718500 -- (-2039.287) [-2042.760] (-2037.914) (-2039.539) * (-2035.943) [-2038.752] (-2035.822) (-2041.320) -- 0:01:17
719000 -- (-2038.785) [-2035.120] (-2037.612) (-2042.769) * (-2034.156) (-2039.891) (-2039.818) [-2037.887] -- 0:01:17
719500 -- (-2046.339) (-2039.881) (-2036.790) [-2035.576] * (-2042.038) [-2030.981] (-2039.063) (-2035.922) -- 0:01:17
720000 -- (-2040.934) [-2033.472] (-2037.816) (-2033.501) * (-2041.701) (-2042.674) [-2034.347] (-2038.213) -- 0:01:17
Average standard deviation of split frequencies: 0.004906
720500 -- (-2037.498) (-2035.043) [-2034.417] (-2042.561) * (-2040.560) [-2038.890] (-2033.999) (-2036.411) -- 0:01:17
721000 -- (-2037.920) [-2036.078] (-2040.688) (-2044.254) * (-2042.430) [-2034.432] (-2041.970) (-2045.511) -- 0:01:17
721500 -- (-2034.359) (-2039.468) [-2039.718] (-2039.183) * (-2041.099) [-2036.363] (-2042.950) (-2038.941) -- 0:01:17
722000 -- (-2033.279) (-2041.815) (-2043.494) [-2038.147] * (-2038.846) (-2038.221) (-2045.352) [-2037.537] -- 0:01:17
722500 -- [-2036.248] (-2039.789) (-2047.719) (-2040.329) * (-2036.710) (-2035.792) (-2037.820) [-2037.483] -- 0:01:16
723000 -- (-2041.266) [-2035.399] (-2042.068) (-2036.865) * (-2034.152) (-2035.427) (-2035.827) [-2034.061] -- 0:01:17
723500 -- (-2042.320) [-2039.200] (-2038.278) (-2036.467) * (-2042.949) (-2034.444) (-2042.263) [-2035.102] -- 0:01:16
724000 -- [-2039.911] (-2035.042) (-2035.519) (-2040.305) * (-2036.401) [-2038.874] (-2047.247) (-2032.092) -- 0:01:16
724500 -- (-2047.591) (-2047.402) [-2035.282] (-2040.680) * [-2033.733] (-2037.372) (-2043.252) (-2038.182) -- 0:01:16
725000 -- (-2051.447) (-2044.653) (-2035.641) [-2038.624] * (-2039.414) [-2040.308] (-2045.431) (-2039.461) -- 0:01:16
Average standard deviation of split frequencies: 0.005032
725500 -- (-2037.112) (-2043.248) (-2032.066) [-2034.856] * (-2033.557) (-2033.928) (-2038.279) [-2038.749] -- 0:01:16
726000 -- (-2044.148) [-2037.439] (-2042.280) (-2041.828) * [-2033.078] (-2035.147) (-2049.090) (-2038.629) -- 0:01:15
726500 -- (-2040.381) (-2036.995) (-2039.459) [-2041.149] * [-2040.684] (-2040.922) (-2038.774) (-2030.895) -- 0:01:16
727000 -- [-2035.966] (-2037.619) (-2045.644) (-2034.457) * (-2044.358) [-2038.021] (-2051.043) (-2035.011) -- 0:01:15
727500 -- (-2039.208) [-2034.439] (-2043.850) (-2037.014) * (-2048.300) (-2036.635) (-2036.412) [-2038.390] -- 0:01:15
728000 -- (-2037.772) (-2031.918) (-2033.480) [-2035.742] * (-2042.422) (-2035.344) (-2035.982) [-2033.902] -- 0:01:15
728500 -- (-2038.186) (-2035.811) [-2034.082] (-2037.123) * (-2038.772) (-2036.947) [-2034.872] (-2036.570) -- 0:01:15
729000 -- (-2039.562) (-2040.533) [-2034.425] (-2041.191) * (-2045.699) (-2044.238) (-2039.538) [-2031.942] -- 0:01:15
729500 -- (-2040.155) [-2048.034] (-2034.120) (-2034.975) * (-2041.172) [-2033.398] (-2032.035) (-2041.191) -- 0:01:14
730000 -- (-2039.642) (-2035.287) (-2034.814) [-2040.541] * (-2042.553) (-2032.712) [-2032.771] (-2038.358) -- 0:01:15
Average standard deviation of split frequencies: 0.005000
730500 -- (-2048.209) (-2031.638) (-2034.542) [-2038.000] * (-2041.095) [-2038.590] (-2035.718) (-2037.319) -- 0:01:14
731000 -- (-2041.291) (-2034.879) [-2031.409] (-2036.458) * [-2042.844] (-2034.184) (-2041.580) (-2032.440) -- 0:01:14
731500 -- (-2038.701) (-2039.589) [-2030.630] (-2037.973) * (-2036.031) [-2038.527] (-2036.558) (-2037.839) -- 0:01:14
732000 -- (-2039.901) (-2037.241) (-2034.448) [-2034.018] * (-2037.694) (-2036.677) [-2036.468] (-2038.631) -- 0:01:14
732500 -- (-2035.165) [-2037.034] (-2033.570) (-2040.601) * [-2037.403] (-2037.325) (-2044.880) (-2037.142) -- 0:01:14
733000 -- [-2033.380] (-2039.941) (-2035.705) (-2037.176) * (-2040.676) (-2031.709) (-2038.176) [-2034.606] -- 0:01:13
733500 -- [-2032.659] (-2035.413) (-2035.594) (-2033.430) * (-2040.134) [-2034.972] (-2033.582) (-2036.846) -- 0:01:13
734000 -- (-2040.098) (-2038.979) [-2032.500] (-2034.078) * (-2049.315) [-2033.928] (-2037.554) (-2045.216) -- 0:01:13
734500 -- [-2036.629] (-2032.616) (-2042.219) (-2036.385) * (-2046.591) (-2040.523) (-2035.702) [-2034.198] -- 0:01:13
735000 -- (-2041.827) [-2038.318] (-2045.052) (-2035.542) * (-2038.067) (-2038.660) [-2036.436] (-2041.259) -- 0:01:13
Average standard deviation of split frequencies: 0.005124
735500 -- (-2035.854) (-2038.179) [-2036.473] (-2036.701) * (-2036.396) (-2035.745) (-2033.225) [-2037.804] -- 0:01:13
736000 -- [-2033.414] (-2039.367) (-2037.059) (-2038.409) * [-2031.630] (-2047.446) (-2033.952) (-2045.250) -- 0:01:13
736500 -- (-2035.197) [-2036.088] (-2035.131) (-2043.646) * [-2035.292] (-2039.672) (-2036.485) (-2037.908) -- 0:01:12
737000 -- (-2043.219) (-2036.848) (-2033.191) [-2044.002] * [-2033.276] (-2038.408) (-2043.614) (-2033.905) -- 0:01:12
737500 -- (-2037.633) (-2034.461) (-2036.246) [-2040.998] * (-2041.748) [-2033.544] (-2032.170) (-2044.980) -- 0:01:12
738000 -- (-2038.868) (-2038.097) [-2045.319] (-2034.820) * (-2045.068) [-2038.102] (-2038.571) (-2034.037) -- 0:01:12
738500 -- (-2035.198) (-2041.079) (-2042.037) [-2037.409] * [-2045.726] (-2034.610) (-2032.960) (-2043.282) -- 0:01:12
739000 -- [-2033.940] (-2037.842) (-2051.558) (-2040.814) * (-2038.059) (-2043.758) [-2039.211] (-2036.980) -- 0:01:12
739500 -- [-2034.178] (-2043.375) (-2037.651) (-2035.664) * (-2037.536) [-2034.854] (-2041.094) (-2038.147) -- 0:01:12
740000 -- [-2032.524] (-2044.289) (-2033.975) (-2038.611) * (-2043.486) (-2031.327) [-2036.603] (-2043.026) -- 0:01:12
Average standard deviation of split frequencies: 0.004455
740500 -- (-2039.677) [-2035.235] (-2035.768) (-2034.743) * [-2038.565] (-2037.248) (-2043.372) (-2041.446) -- 0:01:11
741000 -- (-2037.327) [-2039.682] (-2043.954) (-2034.916) * [-2035.251] (-2034.124) (-2040.658) (-2035.682) -- 0:01:12
741500 -- [-2040.387] (-2039.319) (-2039.082) (-2042.281) * (-2037.925) (-2039.137) [-2035.538] (-2039.699) -- 0:01:11
742000 -- (-2046.016) (-2035.224) (-2035.319) [-2037.968] * (-2038.971) (-2037.904) (-2038.375) [-2041.502] -- 0:01:11
742500 -- (-2036.024) (-2039.341) (-2042.215) [-2033.480] * [-2035.699] (-2036.450) (-2042.506) (-2036.535) -- 0:01:11
743000 -- (-2038.914) (-2041.783) [-2039.937] (-2030.689) * (-2038.961) [-2040.085] (-2035.605) (-2036.599) -- 0:01:11
743500 -- (-2044.348) (-2041.621) [-2037.256] (-2038.621) * (-2037.352) (-2035.837) (-2040.671) [-2041.446] -- 0:01:11
744000 -- [-2045.003] (-2038.383) (-2039.310) (-2037.103) * (-2039.681) (-2039.868) (-2033.673) [-2033.786] -- 0:01:10
744500 -- (-2041.248) (-2040.709) [-2041.417] (-2032.819) * (-2039.498) (-2039.032) (-2036.744) [-2035.070] -- 0:01:11
745000 -- (-2041.571) (-2035.937) (-2045.043) [-2030.811] * (-2038.344) (-2044.934) (-2037.835) [-2036.105] -- 0:01:10
Average standard deviation of split frequencies: 0.004107
745500 -- (-2049.014) (-2038.169) (-2041.872) [-2040.706] * (-2033.621) (-2041.110) [-2040.966] (-2039.627) -- 0:01:10
746000 -- (-2046.846) [-2039.886] (-2037.628) (-2036.445) * (-2043.011) (-2036.878) [-2035.538] (-2039.332) -- 0:01:10
746500 -- [-2033.869] (-2038.933) (-2038.334) (-2042.334) * (-2037.279) (-2040.898) (-2035.571) [-2048.757] -- 0:01:10
747000 -- (-2035.335) [-2035.429] (-2038.700) (-2038.205) * (-2035.258) [-2046.632] (-2036.021) (-2035.165) -- 0:01:10
747500 -- (-2037.289) (-2047.147) (-2040.216) [-2032.390] * [-2037.857] (-2038.120) (-2036.006) (-2033.138) -- 0:01:09
748000 -- (-2042.252) (-2035.090) [-2032.843] (-2034.872) * (-2037.004) (-2038.878) (-2030.896) [-2031.174] -- 0:01:09
748500 -- (-2037.435) [-2048.539] (-2042.492) (-2040.873) * (-2035.618) (-2039.631) (-2037.121) [-2039.112] -- 0:01:09
749000 -- [-2037.381] (-2045.993) (-2040.307) (-2038.916) * (-2035.138) (-2039.735) (-2036.037) [-2036.351] -- 0:01:09
749500 -- (-2042.175) [-2037.072] (-2034.899) (-2040.514) * (-2045.007) (-2036.686) [-2035.739] (-2034.932) -- 0:01:09
750000 -- (-2043.250) (-2033.423) (-2030.781) [-2034.183] * (-2043.215) (-2037.119) [-2033.931] (-2038.690) -- 0:01:09
Average standard deviation of split frequencies: 0.003768
750500 -- (-2047.451) (-2041.197) [-2030.336] (-2033.229) * (-2035.673) (-2042.425) [-2038.987] (-2037.403) -- 0:01:09
751000 -- (-2041.963) (-2037.222) [-2034.774] (-2043.967) * (-2040.557) (-2040.912) [-2030.377] (-2035.251) -- 0:01:08
751500 -- [-2032.662] (-2041.252) (-2038.791) (-2036.823) * [-2033.127] (-2038.437) (-2032.730) (-2043.341) -- 0:01:08
752000 -- (-2039.768) (-2037.324) [-2037.673] (-2033.127) * (-2044.639) (-2034.218) (-2036.868) [-2042.643] -- 0:01:08
752500 -- (-2038.854) (-2035.600) (-2034.070) [-2034.140] * (-2031.009) [-2038.597] (-2036.057) (-2034.325) -- 0:01:08
753000 -- (-2037.188) (-2047.645) (-2036.581) [-2034.196] * [-2031.982] (-2037.975) (-2036.840) (-2036.578) -- 0:01:08
753500 -- [-2036.367] (-2043.182) (-2040.475) (-2036.146) * [-2034.320] (-2039.643) (-2044.827) (-2040.774) -- 0:01:08
754000 -- (-2038.830) (-2038.938) [-2037.497] (-2030.998) * (-2038.201) (-2034.685) (-2035.679) [-2041.948] -- 0:01:08
754500 -- (-2034.804) (-2036.556) [-2034.025] (-2036.596) * (-2038.107) (-2040.675) (-2040.552) [-2042.727] -- 0:01:08
755000 -- (-2035.584) [-2036.233] (-2040.627) (-2044.206) * [-2034.610] (-2037.931) (-2043.370) (-2035.099) -- 0:01:07
Average standard deviation of split frequencies: 0.004833
755500 -- (-2034.744) (-2037.571) [-2035.318] (-2035.541) * [-2034.420] (-2033.687) (-2040.939) (-2037.705) -- 0:01:07
756000 -- (-2043.708) (-2038.884) [-2033.270] (-2036.589) * (-2038.398) [-2038.240] (-2037.121) (-2036.304) -- 0:01:07
756500 -- [-2034.932] (-2043.186) (-2032.550) (-2035.105) * (-2038.407) [-2034.884] (-2033.321) (-2041.406) -- 0:01:07
757000 -- (-2037.831) (-2038.866) [-2037.990] (-2045.714) * (-2042.312) (-2039.703) [-2035.029] (-2036.507) -- 0:01:07
757500 -- (-2038.558) (-2039.585) [-2034.852] (-2041.156) * (-2039.489) (-2039.544) (-2040.204) [-2042.521] -- 0:01:07
758000 -- [-2041.001] (-2042.165) (-2033.900) (-2035.655) * (-2042.469) [-2031.897] (-2038.374) (-2040.018) -- 0:01:07
758500 -- [-2038.942] (-2041.579) (-2036.599) (-2037.732) * (-2040.472) [-2038.647] (-2031.062) (-2038.692) -- 0:01:06
759000 -- [-2039.348] (-2038.031) (-2036.627) (-2035.220) * (-2034.660) [-2034.995] (-2036.410) (-2034.555) -- 0:01:06
759500 -- (-2038.904) [-2044.883] (-2042.278) (-2043.044) * (-2034.605) (-2032.856) (-2040.879) [-2030.507] -- 0:01:06
760000 -- (-2041.121) (-2036.523) (-2037.918) [-2037.295] * (-2036.901) [-2038.245] (-2029.986) (-2034.208) -- 0:01:06
Average standard deviation of split frequencies: 0.004803
760500 -- [-2041.438] (-2034.206) (-2043.431) (-2038.154) * (-2036.569) (-2038.785) (-2037.959) [-2036.025] -- 0:01:06
761000 -- [-2037.395] (-2038.928) (-2036.156) (-2039.090) * (-2039.824) [-2033.370] (-2038.517) (-2033.154) -- 0:01:06
761500 -- [-2039.773] (-2033.703) (-2037.468) (-2042.719) * [-2033.940] (-2035.728) (-2042.736) (-2036.639) -- 0:01:06
762000 -- (-2034.219) (-2044.935) (-2035.221) [-2037.218] * (-2042.781) (-2036.545) (-2042.774) [-2033.159] -- 0:01:05
762500 -- [-2033.441] (-2040.591) (-2033.141) (-2037.459) * [-2037.698] (-2034.688) (-2033.405) (-2037.882) -- 0:01:05
763000 -- (-2040.613) (-2033.799) [-2037.932] (-2040.999) * (-2044.432) [-2033.414] (-2035.123) (-2047.861) -- 0:01:05
763500 -- [-2036.619] (-2044.270) (-2035.233) (-2053.626) * [-2040.106] (-2048.226) (-2036.171) (-2034.805) -- 0:01:05
764000 -- (-2039.713) (-2042.627) [-2037.851] (-2040.589) * (-2044.721) (-2051.398) (-2041.605) [-2034.465] -- 0:01:05
764500 -- [-2040.733] (-2037.389) (-2034.212) (-2040.869) * (-2036.673) (-2035.033) [-2034.276] (-2037.410) -- 0:01:05
765000 -- (-2036.848) [-2033.329] (-2040.377) (-2034.696) * [-2030.997] (-2045.419) (-2033.752) (-2041.468) -- 0:01:05
Average standard deviation of split frequencies: 0.004308
765500 -- [-2031.585] (-2038.877) (-2039.901) (-2036.808) * (-2037.966) [-2036.836] (-2036.253) (-2036.232) -- 0:01:04
766000 -- [-2031.951] (-2032.931) (-2038.273) (-2039.909) * [-2042.101] (-2040.328) (-2036.245) (-2045.063) -- 0:01:04
766500 -- (-2038.494) (-2031.252) [-2038.913] (-2037.423) * (-2036.491) [-2039.105] (-2036.319) (-2040.880) -- 0:01:04
767000 -- (-2037.579) [-2032.190] (-2039.160) (-2037.642) * (-2043.721) (-2040.809) [-2035.321] (-2040.860) -- 0:01:04
767500 -- (-2040.372) (-2034.389) [-2032.284] (-2033.078) * (-2038.307) (-2034.145) [-2038.028] (-2037.476) -- 0:01:04
768000 -- (-2038.983) (-2042.501) [-2033.975] (-2045.180) * [-2034.910] (-2049.559) (-2036.121) (-2040.013) -- 0:01:04
768500 -- (-2038.517) (-2038.810) (-2044.002) [-2037.120] * (-2037.402) (-2047.211) (-2036.998) [-2037.586] -- 0:01:04
769000 -- (-2037.617) (-2039.623) (-2038.521) [-2029.991] * (-2040.816) (-2040.076) [-2034.754] (-2044.436) -- 0:01:03
769500 -- (-2038.402) (-2036.486) [-2037.582] (-2036.863) * (-2036.051) (-2037.354) (-2034.352) [-2038.499] -- 0:01:03
770000 -- (-2035.116) (-2041.869) (-2038.759) [-2035.565] * (-2038.354) [-2034.579] (-2034.664) (-2032.352) -- 0:01:03
Average standard deviation of split frequencies: 0.004129
770500 -- [-2036.776] (-2043.680) (-2042.805) (-2037.390) * [-2035.223] (-2044.096) (-2035.353) (-2035.116) -- 0:01:03
771000 -- (-2035.904) [-2035.036] (-2032.917) (-2043.805) * [-2038.802] (-2039.803) (-2037.380) (-2039.861) -- 0:01:03
771500 -- (-2039.078) (-2032.783) [-2038.883] (-2049.899) * [-2037.592] (-2038.390) (-2040.127) (-2041.986) -- 0:01:03
772000 -- (-2033.501) [-2036.070] (-2037.147) (-2046.921) * [-2036.392] (-2033.834) (-2040.893) (-2037.290) -- 0:01:03
772500 -- (-2035.276) (-2047.105) (-2039.795) [-2034.275] * (-2039.802) (-2043.293) [-2033.361] (-2041.216) -- 0:01:03
773000 -- (-2036.460) (-2042.255) (-2034.125) [-2041.679] * (-2042.667) (-2039.666) (-2034.940) [-2035.935] -- 0:01:02
773500 -- (-2039.545) (-2042.752) [-2033.353] (-2043.494) * (-2042.899) (-2051.057) [-2040.412] (-2031.796) -- 0:01:02
774000 -- (-2034.887) (-2036.170) [-2032.272] (-2039.347) * (-2039.696) (-2039.909) (-2038.033) [-2037.497] -- 0:01:02
774500 -- (-2038.890) (-2037.804) [-2033.560] (-2046.764) * (-2037.833) (-2047.106) (-2041.787) [-2032.123] -- 0:01:02
775000 -- (-2034.870) [-2033.193] (-2041.810) (-2033.428) * (-2041.851) (-2037.244) (-2037.325) [-2039.668] -- 0:01:02
Average standard deviation of split frequencies: 0.004100
775500 -- (-2037.229) (-2036.042) (-2035.251) [-2035.815] * [-2034.325] (-2035.900) (-2039.622) (-2039.216) -- 0:01:02
776000 -- (-2041.674) (-2033.493) [-2034.244] (-2046.632) * (-2050.472) (-2036.765) [-2030.035] (-2041.184) -- 0:01:02
776500 -- (-2041.342) (-2038.671) (-2038.243) [-2041.325] * (-2035.802) (-2041.175) [-2032.465] (-2042.878) -- 0:01:01
777000 -- (-2038.570) (-2038.989) [-2039.279] (-2039.403) * (-2044.255) (-2049.901) (-2038.158) [-2036.583] -- 0:01:01
777500 -- (-2037.297) (-2038.397) [-2032.941] (-2040.080) * (-2042.213) (-2041.115) (-2043.763) [-2035.569] -- 0:01:01
778000 -- (-2034.794) (-2042.871) [-2030.872] (-2036.855) * (-2043.208) (-2039.041) (-2043.494) [-2036.544] -- 0:01:01
778500 -- [-2031.765] (-2049.312) (-2035.571) (-2035.284) * [-2037.079] (-2036.642) (-2042.016) (-2045.526) -- 0:01:01
779000 -- [-2034.508] (-2039.830) (-2035.210) (-2038.886) * (-2039.225) (-2049.171) [-2036.307] (-2035.180) -- 0:01:01
779500 -- (-2042.143) (-2036.719) (-2041.374) [-2041.104] * [-2034.664] (-2043.180) (-2036.347) (-2048.713) -- 0:01:01
780000 -- (-2033.675) (-2035.707) (-2045.827) [-2032.585] * (-2042.101) [-2037.617] (-2042.867) (-2041.898) -- 0:01:00
Average standard deviation of split frequencies: 0.003623
780500 -- (-2036.584) [-2035.846] (-2033.601) (-2033.673) * [-2038.151] (-2036.051) (-2046.206) (-2037.572) -- 0:01:00
781000 -- (-2041.027) (-2050.339) [-2040.382] (-2039.498) * (-2037.461) [-2035.932] (-2044.446) (-2040.871) -- 0:01:00
781500 -- (-2037.702) [-2034.734] (-2041.022) (-2041.629) * (-2037.662) (-2048.974) [-2034.955] (-2035.354) -- 0:01:00
782000 -- (-2043.178) [-2035.451] (-2034.358) (-2044.222) * [-2039.856] (-2036.412) (-2044.346) (-2036.340) -- 0:01:00
782500 -- (-2035.558) (-2037.325) (-2036.134) [-2038.180] * [-2036.785] (-2036.400) (-2046.167) (-2037.987) -- 0:01:00
783000 -- (-2045.043) (-2038.047) (-2033.529) [-2040.934] * [-2036.313] (-2040.041) (-2037.239) (-2041.696) -- 0:01:00
783500 -- (-2032.383) [-2042.224] (-2030.426) (-2043.106) * (-2035.216) (-2039.308) [-2032.807] (-2032.960) -- 0:00:59
784000 -- (-2033.613) (-2038.511) [-2034.310] (-2036.774) * (-2032.453) (-2053.046) [-2040.749] (-2041.590) -- 0:00:59
784500 -- (-2042.468) [-2040.062] (-2034.509) (-2032.439) * (-2036.821) (-2038.731) (-2037.117) [-2038.786] -- 0:00:59
785000 -- (-2036.775) (-2049.192) (-2045.934) [-2033.024] * [-2032.896] (-2039.069) (-2044.524) (-2036.744) -- 0:00:59
Average standard deviation of split frequencies: 0.003898
785500 -- (-2042.023) (-2039.333) (-2038.676) [-2033.546] * (-2035.437) [-2035.604] (-2041.625) (-2039.835) -- 0:00:59
786000 -- (-2037.483) (-2039.466) (-2037.476) [-2033.461] * (-2031.648) (-2036.820) (-2043.715) [-2037.588] -- 0:00:59
786500 -- (-2046.133) [-2041.294] (-2041.655) (-2036.977) * (-2039.604) (-2040.646) [-2043.414] (-2041.530) -- 0:00:59
787000 -- (-2035.211) (-2045.308) [-2034.338] (-2038.285) * (-2033.181) [-2034.102] (-2038.683) (-2036.042) -- 0:00:59
787500 -- (-2039.871) [-2037.138] (-2036.257) (-2037.461) * [-2037.321] (-2033.648) (-2035.114) (-2035.112) -- 0:00:58
788000 -- (-2041.918) [-2036.800] (-2037.544) (-2045.351) * (-2039.531) (-2035.744) [-2035.955] (-2038.653) -- 0:00:58
788500 -- (-2037.939) [-2035.448] (-2041.346) (-2038.846) * (-2048.324) [-2037.383] (-2038.309) (-2041.119) -- 0:00:58
789000 -- [-2041.267] (-2032.992) (-2033.826) (-2039.589) * (-2037.782) (-2039.542) (-2038.854) [-2033.568] -- 0:00:58
789500 -- [-2039.198] (-2033.293) (-2043.292) (-2039.317) * (-2031.700) [-2033.042] (-2038.662) (-2031.514) -- 0:00:58
790000 -- [-2033.281] (-2038.966) (-2035.635) (-2037.942) * [-2039.300] (-2032.229) (-2036.162) (-2039.470) -- 0:00:58
Average standard deviation of split frequencies: 0.003577
790500 -- (-2038.158) [-2037.647] (-2036.293) (-2038.391) * (-2036.311) (-2033.773) (-2038.045) [-2033.650] -- 0:00:58
791000 -- (-2041.257) [-2037.297] (-2035.018) (-2040.825) * [-2037.756] (-2036.450) (-2036.430) (-2035.756) -- 0:00:57
791500 -- (-2040.518) (-2040.056) [-2030.322] (-2035.479) * (-2035.943) (-2038.428) [-2034.377] (-2035.690) -- 0:00:57
792000 -- (-2036.601) (-2042.362) (-2038.962) [-2041.154] * (-2037.435) [-2035.904] (-2043.219) (-2035.256) -- 0:00:57
792500 -- (-2038.737) (-2042.364) [-2040.233] (-2035.985) * (-2037.863) [-2031.959] (-2034.415) (-2041.196) -- 0:00:57
793000 -- (-2042.190) [-2037.021] (-2042.759) (-2032.144) * (-2042.108) [-2035.393] (-2038.966) (-2035.129) -- 0:00:57
793500 -- (-2044.840) (-2034.091) (-2037.469) [-2035.777] * [-2032.726] (-2039.263) (-2038.575) (-2034.578) -- 0:00:57
794000 -- (-2036.300) (-2039.138) (-2047.149) [-2034.673] * (-2039.958) [-2038.514] (-2046.602) (-2039.870) -- 0:00:57
794500 -- (-2039.400) (-2035.722) (-2035.714) [-2042.073] * [-2037.614] (-2037.765) (-2039.562) (-2035.683) -- 0:00:56
795000 -- (-2041.738) (-2034.415) [-2036.131] (-2036.976) * (-2032.227) [-2035.450] (-2038.925) (-2043.638) -- 0:00:56
Average standard deviation of split frequencies: 0.002369
795500 -- (-2034.533) (-2040.370) [-2036.917] (-2035.325) * (-2037.040) (-2035.262) [-2039.470] (-2046.032) -- 0:00:56
796000 -- (-2040.060) (-2036.012) (-2037.420) [-2031.594] * [-2030.379] (-2033.943) (-2042.635) (-2036.484) -- 0:00:56
796500 -- [-2035.335] (-2042.300) (-2037.499) (-2037.343) * (-2041.343) (-2048.645) [-2035.304] (-2036.960) -- 0:00:56
797000 -- [-2033.023] (-2039.748) (-2034.893) (-2030.953) * (-2033.070) [-2040.997] (-2043.283) (-2040.293) -- 0:00:56
797500 -- (-2034.863) (-2034.972) [-2035.977] (-2033.577) * (-2035.687) (-2038.142) (-2036.302) [-2031.051] -- 0:00:56
798000 -- (-2037.400) [-2039.389] (-2038.263) (-2037.639) * (-2037.863) (-2037.664) (-2045.008) [-2039.707] -- 0:00:55
798500 -- [-2039.640] (-2037.491) (-2041.395) (-2043.690) * [-2035.775] (-2038.716) (-2032.977) (-2046.940) -- 0:00:55
799000 -- [-2038.671] (-2044.451) (-2034.946) (-2038.222) * [-2036.327] (-2044.945) (-2037.936) (-2034.600) -- 0:00:55
799500 -- (-2035.965) [-2037.212] (-2035.431) (-2049.569) * [-2034.219] (-2039.973) (-2045.294) (-2034.066) -- 0:00:55
800000 -- [-2045.033] (-2031.602) (-2033.542) (-2041.120) * (-2039.639) [-2032.621] (-2032.561) (-2032.815) -- 0:00:55
Average standard deviation of split frequencies: 0.002355
800500 -- (-2035.444) (-2034.008) [-2037.941] (-2039.880) * (-2038.089) [-2034.339] (-2039.109) (-2034.563) -- 0:00:55
801000 -- (-2043.655) (-2041.868) (-2043.536) [-2043.387] * [-2039.259] (-2037.231) (-2037.180) (-2039.900) -- 0:00:55
801500 -- (-2039.570) (-2041.656) [-2043.394] (-2035.202) * [-2040.564] (-2035.939) (-2043.692) (-2039.604) -- 0:00:54
802000 -- (-2030.984) (-2043.658) (-2039.675) [-2034.235] * (-2035.997) [-2043.168] (-2041.739) (-2041.700) -- 0:00:54
802500 -- (-2042.187) (-2047.282) [-2036.574] (-2037.148) * [-2033.848] (-2042.937) (-2039.306) (-2038.737) -- 0:00:54
803000 -- [-2037.668] (-2037.599) (-2032.191) (-2042.178) * [-2035.685] (-2047.980) (-2040.990) (-2032.877) -- 0:00:54
803500 -- (-2043.460) [-2040.888] (-2036.134) (-2043.273) * (-2032.326) (-2040.109) [-2040.703] (-2035.836) -- 0:00:54
804000 -- (-2042.056) [-2036.671] (-2038.834) (-2035.029) * (-2038.967) [-2034.649] (-2037.849) (-2035.893) -- 0:00:54
804500 -- [-2045.950] (-2038.346) (-2035.073) (-2043.746) * [-2039.082] (-2042.023) (-2044.851) (-2036.357) -- 0:00:54
805000 -- (-2040.304) (-2033.684) [-2035.184] (-2041.197) * (-2042.426) [-2038.048] (-2036.609) (-2036.457) -- 0:00:54
Average standard deviation of split frequencies: 0.002778
805500 -- (-2038.348) [-2039.885] (-2034.958) (-2043.032) * (-2037.213) (-2037.195) (-2035.969) [-2039.852] -- 0:00:53
806000 -- (-2035.025) (-2037.192) (-2046.553) [-2043.756] * (-2042.154) [-2037.739] (-2033.689) (-2042.564) -- 0:00:53
806500 -- (-2034.203) [-2034.201] (-2037.643) (-2037.604) * (-2035.630) (-2033.618) [-2037.314] (-2034.635) -- 0:00:53
807000 -- [-2036.218] (-2041.036) (-2037.227) (-2035.163) * (-2037.933) [-2037.395] (-2039.060) (-2038.663) -- 0:00:53
807500 -- (-2036.042) (-2038.442) (-2035.562) [-2032.949] * (-2036.390) (-2039.399) [-2036.655] (-2035.669) -- 0:00:53
808000 -- (-2037.264) [-2033.521] (-2033.893) (-2040.491) * [-2033.719] (-2036.747) (-2039.280) (-2044.304) -- 0:00:53
808500 -- [-2036.464] (-2033.146) (-2039.079) (-2037.734) * [-2038.034] (-2036.069) (-2036.459) (-2033.861) -- 0:00:53
809000 -- (-2038.832) [-2037.510] (-2035.273) (-2038.578) * [-2031.156] (-2044.498) (-2036.275) (-2038.047) -- 0:00:52
809500 -- (-2040.255) (-2036.041) (-2040.659) [-2035.741] * (-2033.704) [-2037.165] (-2035.803) (-2040.510) -- 0:00:52
810000 -- [-2036.962] (-2031.926) (-2044.511) (-2037.599) * (-2034.432) (-2037.269) [-2036.756] (-2040.859) -- 0:00:52
Average standard deviation of split frequencies: 0.002035
810500 -- [-2036.349] (-2038.277) (-2032.811) (-2045.057) * (-2041.668) [-2034.616] (-2033.745) (-2038.756) -- 0:00:52
811000 -- (-2040.002) (-2034.083) [-2032.073] (-2048.710) * [-2037.284] (-2040.112) (-2031.284) (-2036.552) -- 0:00:52
811500 -- [-2035.221] (-2042.000) (-2038.437) (-2045.307) * (-2040.044) (-2036.920) [-2040.898] (-2044.627) -- 0:00:52
812000 -- (-2040.104) (-2037.413) [-2036.710] (-2037.096) * (-2043.351) [-2038.667] (-2036.105) (-2042.087) -- 0:00:52
812500 -- (-2040.218) (-2036.198) [-2036.224] (-2035.692) * (-2031.037) (-2037.213) [-2036.626] (-2042.007) -- 0:00:51
813000 -- (-2041.120) [-2037.880] (-2038.322) (-2034.726) * [-2033.947] (-2034.374) (-2033.560) (-2045.385) -- 0:00:51
813500 -- (-2042.935) (-2043.806) [-2035.693] (-2036.814) * (-2034.562) (-2034.114) [-2031.869] (-2037.504) -- 0:00:51
814000 -- (-2038.157) (-2038.735) (-2036.643) [-2032.756] * (-2036.299) (-2035.381) [-2033.256] (-2034.640) -- 0:00:51
814500 -- [-2042.221] (-2037.985) (-2034.143) (-2038.186) * (-2041.884) (-2040.821) [-2036.899] (-2043.685) -- 0:00:51
815000 -- [-2037.059] (-2034.247) (-2035.270) (-2036.335) * (-2037.685) (-2038.875) (-2043.934) [-2039.805] -- 0:00:51
Average standard deviation of split frequencies: 0.002600
815500 -- [-2030.066] (-2040.608) (-2033.647) (-2034.630) * (-2036.558) (-2035.620) [-2038.256] (-2034.743) -- 0:00:51
816000 -- (-2035.146) (-2040.010) [-2034.809] (-2032.208) * (-2032.895) (-2042.473) [-2035.161] (-2039.887) -- 0:00:50
816500 -- [-2032.504] (-2045.852) (-2042.313) (-2035.165) * [-2032.176] (-2039.634) (-2041.313) (-2035.186) -- 0:00:50
817000 -- [-2039.797] (-2036.381) (-2038.566) (-2039.563) * (-2036.685) (-2051.046) [-2035.353] (-2040.808) -- 0:00:50
817500 -- (-2036.994) [-2037.341] (-2038.680) (-2037.453) * (-2034.912) [-2034.437] (-2036.206) (-2037.093) -- 0:00:50
818000 -- (-2036.503) (-2037.046) [-2037.029] (-2049.686) * [-2045.441] (-2038.445) (-2034.274) (-2041.632) -- 0:00:50
818500 -- (-2039.173) (-2033.999) (-2035.942) [-2035.767] * [-2038.338] (-2039.388) (-2038.101) (-2040.464) -- 0:00:50
819000 -- [-2035.665] (-2036.487) (-2042.445) (-2032.745) * [-2033.452] (-2037.479) (-2034.190) (-2037.323) -- 0:00:50
819500 -- (-2036.194) (-2030.646) [-2033.082] (-2038.145) * (-2036.496) (-2036.507) (-2036.190) [-2033.897] -- 0:00:49
820000 -- (-2040.264) [-2032.532] (-2039.928) (-2043.729) * (-2036.152) [-2037.477] (-2039.741) (-2038.213) -- 0:00:49
Average standard deviation of split frequencies: 0.002441
820500 -- (-2043.908) (-2036.405) (-2040.514) [-2042.836] * [-2036.908] (-2034.637) (-2034.320) (-2037.723) -- 0:00:49
821000 -- (-2045.414) [-2037.474] (-2045.480) (-2040.867) * [-2033.909] (-2042.041) (-2033.701) (-2033.488) -- 0:00:49
821500 -- (-2034.787) (-2043.843) (-2044.796) [-2037.047] * (-2038.420) (-2046.224) [-2031.801] (-2034.685) -- 0:00:49
822000 -- (-2039.116) [-2033.268] (-2036.727) (-2042.221) * [-2033.408] (-2041.028) (-2040.935) (-2042.963) -- 0:00:49
822500 -- (-2045.571) (-2034.998) (-2038.487) [-2042.402] * (-2040.798) (-2044.112) (-2046.271) [-2036.176] -- 0:00:49
823000 -- (-2041.721) [-2035.725] (-2035.989) (-2038.445) * (-2039.945) (-2039.339) [-2039.200] (-2031.480) -- 0:00:49
823500 -- (-2038.437) (-2038.201) [-2034.972] (-2039.285) * [-2038.349] (-2036.405) (-2042.550) (-2042.423) -- 0:00:48
824000 -- [-2037.032] (-2033.472) (-2041.794) (-2037.786) * [-2035.905] (-2038.259) (-2038.222) (-2037.401) -- 0:00:48
824500 -- (-2039.952) (-2039.501) (-2042.500) [-2044.440] * (-2036.874) (-2036.856) [-2037.555] (-2039.260) -- 0:00:48
825000 -- (-2044.249) (-2036.971) (-2040.285) [-2037.384] * (-2035.295) [-2033.873] (-2032.014) (-2037.809) -- 0:00:48
Average standard deviation of split frequencies: 0.002996
825500 -- (-2040.485) (-2033.142) (-2045.052) [-2036.368] * (-2045.867) [-2032.852] (-2034.952) (-2039.986) -- 0:00:48
826000 -- (-2037.281) (-2040.722) (-2040.452) [-2042.100] * (-2039.616) (-2032.572) [-2034.720] (-2035.686) -- 0:00:48
826500 -- [-2042.141] (-2036.180) (-2041.298) (-2042.892) * [-2035.789] (-2031.622) (-2037.962) (-2037.219) -- 0:00:48
827000 -- (-2034.468) (-2033.200) [-2034.495] (-2045.586) * (-2040.585) (-2040.376) (-2033.085) [-2033.639] -- 0:00:47
827500 -- (-2033.557) (-2033.857) (-2049.186) [-2035.757] * (-2040.030) [-2037.472] (-2041.256) (-2041.203) -- 0:00:47
828000 -- [-2037.428] (-2039.217) (-2038.722) (-2038.119) * (-2039.602) (-2036.492) [-2034.974] (-2045.410) -- 0:00:47
828500 -- [-2040.153] (-2038.378) (-2042.607) (-2042.579) * (-2035.738) (-2040.448) (-2035.308) [-2033.636] -- 0:00:47
829000 -- (-2031.735) (-2035.367) (-2040.729) [-2036.728] * (-2049.160) [-2031.187] (-2037.586) (-2033.252) -- 0:00:47
829500 -- [-2037.324] (-2034.019) (-2039.499) (-2034.366) * (-2037.530) (-2038.006) (-2037.466) [-2032.599] -- 0:00:47
830000 -- (-2042.707) [-2033.647] (-2052.222) (-2036.285) * [-2035.403] (-2034.117) (-2045.478) (-2043.230) -- 0:00:47
Average standard deviation of split frequencies: 0.002554
830500 -- [-2035.471] (-2034.462) (-2039.197) (-2035.987) * [-2033.291] (-2039.609) (-2034.157) (-2034.726) -- 0:00:46
831000 -- (-2034.086) [-2034.101] (-2034.759) (-2034.050) * [-2036.200] (-2045.108) (-2037.113) (-2033.048) -- 0:00:46
831500 -- (-2036.575) (-2038.269) (-2032.937) [-2038.510] * (-2036.467) (-2038.558) (-2036.869) [-2034.862] -- 0:00:46
832000 -- (-2039.163) (-2040.362) (-2040.761) [-2032.647] * (-2033.478) (-2041.049) [-2038.332] (-2035.277) -- 0:00:46
832500 -- [-2031.357] (-2039.015) (-2044.322) (-2038.951) * (-2036.184) [-2034.454] (-2042.206) (-2043.021) -- 0:00:46
833000 -- (-2032.247) (-2037.466) [-2039.439] (-2034.154) * (-2039.449) (-2041.568) (-2036.157) [-2038.512] -- 0:00:46
833500 -- [-2035.062] (-2046.638) (-2035.916) (-2037.736) * (-2033.292) (-2043.136) [-2034.126] (-2038.877) -- 0:00:46
834000 -- (-2042.711) (-2041.437) [-2036.457] (-2042.469) * (-2038.288) [-2035.085] (-2037.196) (-2038.562) -- 0:00:45
834500 -- [-2039.317] (-2036.667) (-2034.624) (-2047.484) * (-2041.588) [-2036.118] (-2035.222) (-2039.859) -- 0:00:45
835000 -- [-2042.090] (-2039.378) (-2035.450) (-2036.301) * (-2045.306) [-2031.214] (-2036.607) (-2039.401) -- 0:00:45
Average standard deviation of split frequencies: 0.002537
835500 -- (-2040.433) (-2039.099) [-2035.472] (-2041.026) * (-2036.566) [-2032.958] (-2037.951) (-2040.569) -- 0:00:45
836000 -- (-2036.890) (-2039.610) [-2036.588] (-2047.665) * (-2041.315) (-2035.934) (-2034.354) [-2032.483] -- 0:00:45
836500 -- (-2036.127) (-2047.436) [-2033.421] (-2043.612) * [-2040.835] (-2039.421) (-2037.974) (-2033.759) -- 0:00:45
837000 -- (-2042.016) [-2037.545] (-2045.332) (-2040.039) * (-2036.133) (-2038.335) [-2032.428] (-2049.322) -- 0:00:45
837500 -- [-2041.016] (-2040.157) (-2036.759) (-2047.912) * (-2037.911) (-2035.842) (-2033.937) [-2033.267] -- 0:00:45
838000 -- [-2036.441] (-2035.564) (-2040.557) (-2038.355) * (-2034.291) (-2039.991) [-2037.568] (-2035.801) -- 0:00:44
838500 -- (-2045.386) [-2037.058] (-2033.970) (-2034.535) * [-2037.900] (-2035.293) (-2038.346) (-2036.864) -- 0:00:44
839000 -- (-2041.682) (-2039.031) [-2040.285] (-2034.299) * (-2045.906) [-2033.467] (-2042.857) (-2039.235) -- 0:00:44
839500 -- (-2046.212) [-2034.047] (-2038.250) (-2045.424) * (-2038.971) (-2040.784) (-2035.667) [-2033.804] -- 0:00:44
840000 -- [-2040.801] (-2040.244) (-2037.451) (-2045.419) * [-2037.964] (-2040.095) (-2037.348) (-2046.159) -- 0:00:44
Average standard deviation of split frequencies: 0.001963
840500 -- (-2038.801) [-2037.629] (-2036.352) (-2040.555) * (-2038.685) [-2035.352] (-2041.480) (-2035.932) -- 0:00:44
841000 -- (-2038.149) (-2043.253) [-2036.283] (-2045.701) * [-2031.459] (-2033.203) (-2042.104) (-2039.113) -- 0:00:44
841500 -- (-2035.119) (-2038.257) (-2042.766) [-2036.947] * (-2033.108) [-2035.186] (-2043.430) (-2036.694) -- 0:00:43
842000 -- [-2033.939] (-2038.136) (-2036.749) (-2043.927) * (-2037.839) (-2035.798) (-2038.998) [-2035.834] -- 0:00:43
842500 -- (-2039.238) [-2036.203] (-2032.136) (-2043.803) * [-2042.071] (-2037.668) (-2033.009) (-2040.815) -- 0:00:43
843000 -- (-2039.320) [-2035.313] (-2037.169) (-2040.366) * (-2039.223) [-2035.953] (-2035.389) (-2041.041) -- 0:00:43
843500 -- (-2043.614) (-2038.040) [-2038.442] (-2034.971) * [-2043.016] (-2034.295) (-2035.722) (-2038.370) -- 0:00:43
844000 -- (-2037.684) [-2035.891] (-2031.803) (-2037.454) * (-2043.206) (-2035.285) [-2031.185] (-2038.801) -- 0:00:43
844500 -- [-2040.320] (-2036.815) (-2032.412) (-2042.649) * (-2043.026) [-2030.147] (-2042.260) (-2039.214) -- 0:00:43
845000 -- (-2043.109) (-2038.944) [-2040.576] (-2041.847) * (-2042.266) (-2045.767) [-2038.124] (-2037.671) -- 0:00:42
Average standard deviation of split frequencies: 0.001114
845500 -- [-2041.620] (-2041.127) (-2041.018) (-2047.257) * (-2038.900) (-2040.522) (-2033.613) [-2031.551] -- 0:00:42
846000 -- (-2037.001) (-2035.164) [-2034.851] (-2054.804) * (-2037.713) (-2033.512) [-2039.243] (-2037.004) -- 0:00:42
846500 -- [-2037.662] (-2038.651) (-2033.001) (-2040.324) * (-2032.538) (-2037.722) [-2041.864] (-2041.570) -- 0:00:42
847000 -- [-2035.581] (-2040.137) (-2047.339) (-2043.527) * [-2036.575] (-2041.169) (-2039.874) (-2038.363) -- 0:00:42
847500 -- (-2035.375) (-2040.880) (-2042.315) [-2039.175] * [-2034.862] (-2036.997) (-2034.156) (-2042.227) -- 0:00:42
848000 -- (-2035.295) (-2035.813) [-2031.950] (-2034.086) * [-2036.883] (-2040.406) (-2031.952) (-2035.352) -- 0:00:42
848500 -- (-2036.560) (-2048.473) [-2035.390] (-2039.712) * [-2036.833] (-2041.525) (-2036.805) (-2043.590) -- 0:00:41
849000 -- [-2033.470] (-2040.778) (-2032.739) (-2038.154) * (-2040.590) [-2039.091] (-2036.478) (-2039.230) -- 0:00:41
849500 -- (-2037.263) (-2038.369) (-2032.097) [-2037.862] * (-2034.551) [-2035.493] (-2034.443) (-2033.030) -- 0:00:41
850000 -- (-2035.306) [-2033.864] (-2036.241) (-2038.544) * (-2036.379) (-2039.186) [-2033.791] (-2037.012) -- 0:00:41
Average standard deviation of split frequencies: 0.001385
850500 -- (-2032.968) [-2038.047] (-2041.930) (-2035.671) * (-2036.631) (-2037.368) [-2035.230] (-2040.062) -- 0:00:41
851000 -- (-2036.202) (-2035.202) [-2042.315] (-2036.770) * (-2040.801) (-2039.213) (-2036.339) [-2034.695] -- 0:00:41
851500 -- (-2039.764) (-2037.839) [-2037.014] (-2038.777) * (-2037.674) [-2049.167] (-2033.054) (-2038.377) -- 0:00:41
852000 -- (-2034.966) (-2031.673) (-2040.099) [-2042.362] * (-2040.469) (-2044.415) (-2034.581) [-2032.790] -- 0:00:40
852500 -- [-2034.590] (-2038.842) (-2031.562) (-2044.264) * (-2035.528) (-2034.351) (-2034.737) [-2035.836] -- 0:00:40
853000 -- (-2037.223) (-2039.791) [-2032.866] (-2045.341) * (-2035.423) (-2038.004) [-2036.661] (-2039.956) -- 0:00:40
853500 -- (-2036.597) (-2043.450) [-2034.826] (-2041.746) * (-2040.437) (-2036.741) [-2036.339] (-2038.895) -- 0:00:40
854000 -- (-2034.263) (-2041.533) [-2034.781] (-2032.908) * (-2043.203) [-2032.704] (-2037.962) (-2038.257) -- 0:00:40
854500 -- (-2034.423) [-2035.366] (-2042.116) (-2038.821) * (-2041.637) (-2036.697) [-2038.771] (-2046.425) -- 0:00:40
855000 -- (-2035.620) (-2036.218) (-2043.464) [-2038.088] * (-2039.275) [-2032.869] (-2036.495) (-2036.186) -- 0:00:40
Average standard deviation of split frequencies: 0.001652
855500 -- [-2040.737] (-2037.758) (-2045.749) (-2038.815) * (-2039.696) [-2038.319] (-2042.111) (-2033.284) -- 0:00:40
856000 -- (-2038.670) (-2048.065) [-2034.855] (-2040.868) * (-2034.570) [-2040.455] (-2038.664) (-2037.089) -- 0:00:39
856500 -- [-2036.782] (-2045.307) (-2038.204) (-2036.004) * (-2036.362) [-2034.601] (-2038.343) (-2037.561) -- 0:00:39
857000 -- [-2040.673] (-2035.707) (-2040.002) (-2039.204) * (-2038.471) (-2036.004) [-2037.041] (-2040.708) -- 0:00:39
857500 -- (-2035.255) [-2036.963] (-2039.573) (-2036.205) * (-2036.655) (-2039.386) [-2034.492] (-2042.149) -- 0:00:39
858000 -- (-2033.538) (-2034.763) (-2033.130) [-2034.069] * (-2038.602) [-2038.126] (-2036.257) (-2039.637) -- 0:00:39
858500 -- (-2037.020) [-2032.653] (-2037.185) (-2032.669) * [-2036.209] (-2037.202) (-2043.038) (-2036.345) -- 0:00:39
859000 -- (-2038.768) (-2041.020) (-2039.862) [-2037.755] * (-2032.422) (-2037.716) (-2036.245) [-2037.212] -- 0:00:39
859500 -- (-2038.643) [-2033.376] (-2036.446) (-2041.886) * (-2035.177) (-2044.326) [-2037.169] (-2034.992) -- 0:00:38
860000 -- [-2032.705] (-2032.767) (-2040.857) (-2037.027) * (-2036.979) (-2039.804) [-2038.693] (-2039.233) -- 0:00:38
Average standard deviation of split frequencies: 0.001369
860500 -- [-2039.961] (-2034.514) (-2033.752) (-2041.551) * (-2037.685) [-2037.076] (-2038.580) (-2035.817) -- 0:00:38
861000 -- (-2033.069) [-2035.130] (-2035.579) (-2043.327) * (-2038.335) [-2041.222] (-2040.293) (-2039.783) -- 0:00:38
861500 -- [-2031.379] (-2042.668) (-2041.390) (-2041.872) * (-2042.766) [-2040.682] (-2039.460) (-2037.970) -- 0:00:38
862000 -- [-2035.034] (-2040.836) (-2043.466) (-2043.704) * (-2040.844) [-2038.142] (-2040.861) (-2050.077) -- 0:00:38
862500 -- [-2032.967] (-2034.331) (-2033.766) (-2036.950) * (-2041.222) (-2040.337) (-2037.991) [-2033.703] -- 0:00:38
863000 -- (-2038.037) [-2034.407] (-2044.288) (-2038.202) * (-2034.296) (-2040.396) (-2036.765) [-2041.191] -- 0:00:37
863500 -- (-2035.462) [-2033.742] (-2040.202) (-2043.858) * (-2037.753) (-2039.899) (-2039.896) [-2036.209] -- 0:00:37
864000 -- (-2040.928) [-2035.501] (-2035.289) (-2042.230) * (-2036.559) (-2043.788) [-2032.488] (-2039.695) -- 0:00:37
864500 -- (-2034.012) [-2030.916] (-2038.182) (-2040.614) * (-2036.002) (-2040.421) [-2034.067] (-2045.275) -- 0:00:37
865000 -- [-2036.265] (-2033.589) (-2038.133) (-2040.877) * (-2035.936) (-2042.378) [-2034.333] (-2035.670) -- 0:00:37
Average standard deviation of split frequencies: 0.001361
865500 -- [-2035.057] (-2037.588) (-2032.392) (-2042.845) * (-2036.924) [-2036.164] (-2041.631) (-2036.854) -- 0:00:37
866000 -- (-2036.505) [-2034.589] (-2038.051) (-2035.505) * (-2036.781) [-2040.304] (-2041.728) (-2035.992) -- 0:00:37
866500 -- (-2049.748) (-2045.866) (-2040.630) [-2031.487] * (-2032.395) [-2037.517] (-2039.748) (-2033.489) -- 0:00:36
867000 -- [-2035.369] (-2037.825) (-2035.592) (-2032.330) * (-2032.984) (-2037.128) (-2038.293) [-2036.649] -- 0:00:36
867500 -- (-2039.411) (-2032.380) [-2044.616] (-2032.774) * (-2037.231) (-2039.772) [-2039.667] (-2040.198) -- 0:00:36
868000 -- (-2042.252) [-2034.208] (-2037.584) (-2041.850) * (-2039.823) [-2033.679] (-2036.876) (-2047.395) -- 0:00:36
868500 -- (-2035.527) (-2039.013) (-2035.082) [-2038.656] * (-2042.712) (-2036.081) [-2038.476] (-2040.460) -- 0:00:36
869000 -- (-2035.543) (-2038.144) (-2040.579) [-2040.147] * (-2035.538) (-2035.983) (-2038.264) [-2032.548] -- 0:00:36
869500 -- (-2035.457) (-2040.813) [-2038.584] (-2041.770) * [-2035.783] (-2041.165) (-2040.944) (-2035.830) -- 0:00:36
870000 -- (-2034.985) [-2031.951] (-2033.154) (-2042.273) * (-2033.687) [-2036.624] (-2040.049) (-2041.042) -- 0:00:36
Average standard deviation of split frequencies: 0.002030
870500 -- [-2035.290] (-2037.035) (-2040.766) (-2041.535) * (-2041.744) [-2029.059] (-2040.100) (-2042.800) -- 0:00:35
871000 -- (-2040.609) (-2036.058) (-2043.830) [-2040.775] * (-2041.392) [-2032.566] (-2045.746) (-2046.786) -- 0:00:35
871500 -- [-2035.526] (-2037.578) (-2039.859) (-2038.287) * (-2032.922) (-2035.414) [-2038.634] (-2047.151) -- 0:00:35
872000 -- (-2039.076) (-2046.721) (-2041.406) [-2051.051] * (-2037.138) (-2040.459) (-2043.525) [-2038.867] -- 0:00:35
872500 -- (-2041.806) [-2038.722] (-2040.284) (-2039.056) * (-2032.891) [-2033.100] (-2040.381) (-2041.116) -- 0:00:35
873000 -- [-2041.039] (-2040.883) (-2036.241) (-2038.717) * [-2039.874] (-2035.284) (-2035.617) (-2034.949) -- 0:00:35
873500 -- [-2038.450] (-2044.973) (-2045.541) (-2039.207) * (-2042.044) [-2044.476] (-2041.692) (-2036.897) -- 0:00:35
874000 -- (-2037.448) (-2034.932) [-2038.002] (-2041.567) * (-2044.917) (-2042.178) [-2036.565] (-2037.085) -- 0:00:34
874500 -- (-2036.853) [-2037.153] (-2042.589) (-2032.834) * (-2034.492) (-2035.159) (-2035.873) [-2036.392] -- 0:00:34
875000 -- (-2034.998) (-2041.363) (-2030.806) [-2037.205] * (-2035.414) [-2035.167] (-2040.714) (-2043.885) -- 0:00:34
Average standard deviation of split frequencies: 0.001883
875500 -- [-2037.032] (-2043.929) (-2031.418) (-2043.372) * [-2044.806] (-2036.236) (-2037.266) (-2036.890) -- 0:00:34
876000 -- (-2040.463) (-2034.673) (-2033.813) [-2032.877] * (-2042.348) (-2041.438) (-2035.930) [-2037.797] -- 0:00:34
876500 -- (-2037.954) [-2037.314] (-2032.504) (-2038.117) * (-2039.519) (-2034.468) (-2039.659) [-2035.315] -- 0:00:34
877000 -- (-2041.597) (-2034.482) [-2035.506] (-2038.385) * (-2036.105) (-2041.258) (-2035.821) [-2033.112] -- 0:00:34
877500 -- (-2037.164) (-2038.179) [-2031.292] (-2038.106) * (-2038.047) [-2036.073] (-2036.026) (-2040.258) -- 0:00:33
878000 -- (-2034.466) (-2033.911) (-2042.481) [-2036.760] * (-2038.241) (-2038.106) [-2033.443] (-2041.762) -- 0:00:33
878500 -- (-2034.480) (-2040.413) (-2037.150) [-2031.749] * (-2039.583) [-2033.499] (-2035.656) (-2049.423) -- 0:00:33
879000 -- (-2037.625) [-2041.642] (-2033.987) (-2042.036) * (-2035.064) (-2033.935) (-2035.602) [-2043.259] -- 0:00:33
879500 -- (-2038.140) (-2036.230) (-2043.051) [-2034.642] * (-2046.106) [-2033.247] (-2033.785) (-2041.020) -- 0:00:33
880000 -- [-2036.329] (-2045.747) (-2031.433) (-2033.898) * (-2031.407) (-2038.279) [-2042.134] (-2033.985) -- 0:00:33
Average standard deviation of split frequencies: 0.002409
880500 -- (-2044.905) (-2043.337) [-2036.751] (-2045.461) * (-2038.510) (-2034.333) [-2035.340] (-2034.145) -- 0:00:33
881000 -- (-2033.814) [-2040.807] (-2034.772) (-2035.733) * (-2041.574) [-2035.618] (-2035.298) (-2038.529) -- 0:00:32
881500 -- (-2034.907) [-2036.233] (-2037.497) (-2031.060) * (-2038.615) [-2038.937] (-2037.955) (-2038.741) -- 0:00:32
882000 -- (-2035.615) (-2036.476) (-2038.651) [-2038.131] * (-2036.497) [-2036.341] (-2040.728) (-2032.926) -- 0:00:32
882500 -- (-2046.509) (-2039.727) (-2034.668) [-2033.313] * (-2038.197) (-2040.077) [-2042.155] (-2039.872) -- 0:00:32
883000 -- (-2044.878) [-2042.321] (-2035.683) (-2034.552) * (-2040.638) (-2037.351) (-2036.507) [-2035.371] -- 0:00:32
883500 -- (-2045.470) [-2034.820] (-2037.182) (-2036.613) * (-2038.378) (-2040.689) [-2037.299] (-2038.399) -- 0:00:32
884000 -- (-2037.403) (-2038.299) [-2036.480] (-2032.206) * (-2047.826) [-2039.638] (-2032.197) (-2043.686) -- 0:00:32
884500 -- (-2037.606) [-2037.727] (-2036.042) (-2037.598) * (-2034.537) (-2033.751) [-2036.392] (-2036.454) -- 0:00:31
885000 -- (-2033.431) [-2032.774] (-2032.949) (-2035.588) * (-2034.152) (-2044.654) (-2031.501) [-2042.509] -- 0:00:31
Average standard deviation of split frequencies: 0.002660
885500 -- (-2034.467) (-2035.443) [-2036.123] (-2036.893) * (-2037.303) (-2052.580) (-2035.357) [-2039.695] -- 0:00:31
886000 -- [-2036.663] (-2041.998) (-2038.620) (-2033.497) * [-2038.281] (-2039.918) (-2039.020) (-2038.345) -- 0:00:31
886500 -- [-2037.989] (-2039.026) (-2041.409) (-2042.208) * [-2039.680] (-2039.507) (-2037.709) (-2036.222) -- 0:00:31
887000 -- (-2044.392) [-2036.352] (-2034.007) (-2039.445) * (-2037.882) (-2036.434) [-2036.825] (-2037.147) -- 0:00:31
887500 -- (-2050.341) (-2040.951) [-2036.147] (-2039.301) * (-2038.525) (-2045.328) (-2033.380) [-2031.443] -- 0:00:31
888000 -- (-2040.040) (-2038.018) [-2038.773] (-2038.291) * (-2051.557) [-2035.864] (-2036.375) (-2042.087) -- 0:00:31
888500 -- (-2035.560) [-2036.017] (-2033.328) (-2033.623) * (-2049.176) [-2038.345] (-2043.451) (-2036.966) -- 0:00:30
889000 -- (-2035.119) (-2040.818) (-2040.972) [-2034.830] * (-2036.996) [-2038.777] (-2031.669) (-2035.614) -- 0:00:30
889500 -- (-2042.705) (-2034.729) (-2035.307) [-2035.810] * (-2036.639) (-2035.725) [-2030.923] (-2041.621) -- 0:00:30
890000 -- [-2039.375] (-2034.710) (-2031.500) (-2036.505) * (-2042.575) (-2039.356) [-2033.248] (-2040.979) -- 0:00:30
Average standard deviation of split frequencies: 0.003043
890500 -- [-2040.408] (-2036.803) (-2033.884) (-2038.461) * [-2040.969] (-2036.460) (-2039.619) (-2038.648) -- 0:00:30
891000 -- (-2041.743) (-2046.021) (-2031.747) [-2038.565] * [-2039.320] (-2049.884) (-2037.704) (-2033.301) -- 0:00:30
891500 -- (-2037.629) (-2036.647) (-2038.027) [-2037.168] * [-2037.079] (-2039.301) (-2033.722) (-2038.947) -- 0:00:30
892000 -- (-2035.498) (-2042.026) [-2033.984] (-2034.287) * (-2031.689) [-2039.035] (-2038.500) (-2039.436) -- 0:00:29
892500 -- [-2033.997] (-2040.683) (-2033.570) (-2037.914) * (-2036.781) [-2036.297] (-2038.397) (-2031.514) -- 0:00:29
893000 -- (-2039.883) (-2040.660) [-2035.084] (-2037.254) * (-2033.222) (-2035.576) [-2031.405] (-2036.245) -- 0:00:29
893500 -- [-2035.701] (-2032.900) (-2036.221) (-2037.832) * (-2039.620) (-2040.916) [-2036.264] (-2051.613) -- 0:00:29
894000 -- (-2031.879) (-2029.645) (-2032.881) [-2039.154] * [-2042.906] (-2038.757) (-2040.079) (-2034.802) -- 0:00:29
894500 -- (-2043.630) (-2037.360) [-2041.016] (-2040.814) * (-2041.798) [-2031.967] (-2036.724) (-2040.981) -- 0:00:29
895000 -- (-2033.360) (-2038.645) (-2037.287) [-2040.245] * [-2047.366] (-2039.533) (-2039.660) (-2036.168) -- 0:00:29
Average standard deviation of split frequencies: 0.002894
895500 -- (-2032.398) (-2047.555) [-2037.706] (-2041.094) * (-2039.724) [-2040.887] (-2030.916) (-2037.847) -- 0:00:28
896000 -- [-2036.391] (-2046.091) (-2034.509) (-2034.402) * (-2043.316) [-2038.625] (-2040.249) (-2040.148) -- 0:00:28
896500 -- (-2036.270) (-2037.933) (-2037.606) [-2030.008] * (-2041.328) [-2039.276] (-2040.918) (-2035.735) -- 0:00:28
897000 -- [-2040.301] (-2044.456) (-2039.396) (-2036.298) * (-2040.107) (-2043.808) [-2042.526] (-2034.595) -- 0:00:28
897500 -- [-2033.147] (-2041.078) (-2039.332) (-2037.802) * [-2033.889] (-2042.429) (-2041.871) (-2036.350) -- 0:00:28
898000 -- (-2041.828) (-2041.105) [-2039.509] (-2039.522) * (-2034.714) [-2044.116] (-2035.854) (-2040.346) -- 0:00:28
898500 -- (-2046.442) (-2038.507) [-2040.108] (-2035.928) * [-2035.350] (-2039.711) (-2041.357) (-2044.704) -- 0:00:28
899000 -- (-2050.494) (-2037.486) [-2032.760] (-2033.067) * (-2035.649) (-2031.541) (-2043.287) [-2034.933] -- 0:00:27
899500 -- (-2038.169) (-2047.740) [-2033.474] (-2046.537) * (-2042.159) (-2032.643) (-2037.347) [-2035.210] -- 0:00:27
900000 -- (-2033.399) [-2040.041] (-2031.615) (-2038.660) * (-2039.404) (-2041.184) [-2035.744] (-2040.559) -- 0:00:27
Average standard deviation of split frequencies: 0.002748
900500 -- (-2041.073) (-2044.306) [-2039.706] (-2041.781) * (-2031.810) [-2032.436] (-2037.996) (-2038.346) -- 0:00:27
901000 -- (-2038.804) (-2035.772) (-2042.284) [-2034.421] * (-2038.809) (-2034.428) [-2032.969] (-2035.820) -- 0:00:27
901500 -- (-2042.356) [-2031.697] (-2037.356) (-2035.677) * (-2044.004) (-2040.962) (-2033.562) [-2035.479] -- 0:00:27
902000 -- (-2037.737) (-2036.763) (-2042.846) [-2038.376] * (-2036.365) [-2036.538] (-2039.708) (-2032.887) -- 0:00:27
902500 -- (-2043.430) (-2037.292) (-2029.605) [-2030.780] * [-2038.831] (-2032.908) (-2033.408) (-2035.566) -- 0:00:27
903000 -- (-2042.887) (-2035.803) [-2032.570] (-2035.466) * (-2036.656) (-2037.871) (-2032.362) [-2034.065] -- 0:00:26
903500 -- (-2040.817) [-2035.398] (-2032.045) (-2040.024) * (-2033.363) [-2037.300] (-2046.203) (-2042.846) -- 0:00:26
904000 -- [-2036.479] (-2034.716) (-2044.730) (-2037.045) * (-2031.677) [-2036.877] (-2050.526) (-2033.744) -- 0:00:26
904500 -- (-2040.389) [-2029.926] (-2036.976) (-2036.685) * (-2036.209) (-2038.493) [-2035.134] (-2038.608) -- 0:00:26
905000 -- [-2030.143] (-2034.733) (-2045.548) (-2042.082) * (-2037.063) (-2037.291) (-2038.667) [-2034.353] -- 0:00:26
Average standard deviation of split frequencies: 0.002992
905500 -- (-2036.849) (-2039.855) (-2035.952) [-2033.661] * (-2031.974) [-2032.854] (-2033.977) (-2041.578) -- 0:00:26
906000 -- [-2037.836] (-2037.679) (-2038.832) (-2036.810) * [-2036.699] (-2032.841) (-2036.408) (-2041.238) -- 0:00:26
906500 -- (-2039.415) [-2034.539] (-2033.236) (-2035.862) * (-2035.341) (-2032.632) [-2043.928] (-2034.280) -- 0:00:25
907000 -- (-2037.095) (-2037.316) [-2034.524] (-2045.222) * (-2030.312) (-2036.309) (-2042.333) [-2033.564] -- 0:00:25
907500 -- (-2038.160) (-2034.918) [-2040.451] (-2038.873) * (-2037.745) (-2038.259) [-2030.605] (-2037.160) -- 0:00:25
908000 -- (-2034.625) (-2038.005) [-2036.667] (-2039.371) * (-2038.909) (-2035.724) (-2038.782) [-2039.262] -- 0:00:25
908500 -- (-2049.215) (-2040.212) [-2034.010] (-2036.528) * (-2043.464) (-2032.510) [-2036.484] (-2040.774) -- 0:00:25
909000 -- (-2039.698) (-2049.226) [-2034.950] (-2034.520) * (-2038.616) (-2041.931) [-2034.837] (-2034.910) -- 0:00:25
909500 -- (-2046.995) (-2043.593) (-2039.204) [-2034.057] * (-2036.969) (-2036.225) [-2038.040] (-2038.454) -- 0:00:25
910000 -- (-2035.383) [-2041.437] (-2039.408) (-2035.577) * (-2042.656) (-2038.005) [-2039.698] (-2044.622) -- 0:00:24
Average standard deviation of split frequencies: 0.004012
910500 -- (-2037.281) (-2047.787) (-2040.779) [-2032.240] * (-2038.682) (-2051.160) [-2036.209] (-2035.175) -- 0:00:24
911000 -- [-2033.051] (-2040.208) (-2046.715) (-2044.149) * (-2035.437) (-2047.599) [-2034.184] (-2037.786) -- 0:00:24
911500 -- (-2043.979) (-2037.452) (-2042.316) [-2035.279] * (-2035.425) [-2043.311] (-2037.617) (-2042.040) -- 0:00:24
912000 -- [-2036.970] (-2042.603) (-2043.520) (-2042.430) * [-2031.270] (-2031.633) (-2037.938) (-2039.388) -- 0:00:24
912500 -- [-2030.357] (-2037.973) (-2043.579) (-2041.654) * (-2039.120) (-2036.743) (-2036.364) [-2038.487] -- 0:00:24
913000 -- [-2038.204] (-2036.047) (-2036.481) (-2034.587) * [-2033.992] (-2035.113) (-2040.795) (-2034.316) -- 0:00:24
913500 -- (-2036.868) (-2037.843) (-2037.171) [-2035.564] * (-2035.804) (-2035.742) [-2034.908] (-2035.695) -- 0:00:23
914000 -- (-2035.920) (-2038.793) [-2034.101] (-2039.939) * (-2035.878) [-2044.028] (-2039.852) (-2033.830) -- 0:00:23
914500 -- (-2036.861) (-2035.251) [-2035.023] (-2035.515) * [-2038.234] (-2048.557) (-2041.455) (-2038.445) -- 0:00:23
915000 -- [-2033.948] (-2037.421) (-2037.309) (-2036.869) * (-2036.633) (-2039.892) [-2032.122] (-2036.072) -- 0:00:23
Average standard deviation of split frequencies: 0.004503
915500 -- (-2037.753) (-2036.473) [-2036.212] (-2038.396) * [-2043.565] (-2036.395) (-2035.654) (-2041.626) -- 0:00:23
916000 -- [-2034.081] (-2033.236) (-2038.014) (-2039.903) * (-2040.094) [-2033.251] (-2038.721) (-2033.477) -- 0:00:23
916500 -- (-2041.796) (-2035.139) (-2039.216) [-2036.182] * [-2038.159] (-2037.446) (-2037.550) (-2033.190) -- 0:00:23
917000 -- (-2045.662) (-2036.843) (-2031.762) [-2043.163] * (-2039.959) (-2036.460) (-2034.597) [-2036.164] -- 0:00:22
917500 -- (-2039.087) (-2037.801) [-2036.357] (-2031.878) * (-2039.473) [-2040.468] (-2036.820) (-2041.078) -- 0:00:22
918000 -- (-2033.087) (-2037.571) (-2035.064) [-2032.989] * (-2041.996) [-2034.472] (-2036.801) (-2045.221) -- 0:00:22
918500 -- (-2041.768) (-2037.710) [-2032.311] (-2035.605) * (-2044.350) (-2043.274) (-2034.180) [-2033.444] -- 0:00:22
919000 -- (-2033.354) [-2043.254] (-2034.655) (-2038.977) * [-2036.200] (-2050.763) (-2039.366) (-2040.967) -- 0:00:22
919500 -- (-2032.812) (-2039.061) (-2038.805) [-2038.448] * (-2036.023) (-2046.235) (-2036.834) [-2036.247] -- 0:00:22
920000 -- (-2038.168) [-2037.542] (-2034.480) (-2032.570) * [-2038.030] (-2042.025) (-2031.741) (-2046.068) -- 0:00:22
Average standard deviation of split frequencies: 0.004096
920500 -- (-2038.715) (-2040.507) [-2037.177] (-2032.629) * (-2038.417) [-2035.516] (-2036.462) (-2034.559) -- 0:00:22
921000 -- (-2036.844) (-2036.261) [-2035.500] (-2038.852) * [-2036.965] (-2041.661) (-2035.123) (-2039.467) -- 0:00:21
921500 -- (-2042.392) [-2037.194] (-2038.980) (-2043.589) * (-2036.578) (-2035.647) [-2040.996] (-2037.774) -- 0:00:21
922000 -- (-2039.352) [-2033.053] (-2040.356) (-2037.967) * (-2041.063) (-2042.986) (-2034.590) [-2036.692] -- 0:00:21
922500 -- (-2032.524) (-2039.253) (-2041.191) [-2036.315] * [-2039.893] (-2034.539) (-2033.566) (-2038.126) -- 0:00:21
923000 -- [-2039.929] (-2040.786) (-2035.793) (-2038.422) * (-2036.439) [-2034.523] (-2040.355) (-2033.983) -- 0:00:21
923500 -- (-2036.578) (-2035.690) [-2034.604] (-2043.940) * (-2035.840) (-2033.956) [-2041.763] (-2040.090) -- 0:00:21
924000 -- (-2044.789) (-2036.461) [-2036.876] (-2040.533) * [-2032.983] (-2036.517) (-2037.517) (-2035.697) -- 0:00:21
924500 -- (-2040.657) [-2035.603] (-2034.500) (-2040.596) * [-2036.052] (-2039.583) (-2037.450) (-2047.199) -- 0:00:20
925000 -- (-2038.669) [-2033.789] (-2034.491) (-2045.400) * (-2033.441) [-2034.853] (-2035.168) (-2035.486) -- 0:00:20
Average standard deviation of split frequencies: 0.003436
925500 -- [-2037.190] (-2041.270) (-2036.502) (-2034.271) * [-2034.531] (-2045.647) (-2033.578) (-2033.487) -- 0:00:20
926000 -- (-2042.231) (-2039.073) [-2032.777] (-2043.660) * (-2034.631) (-2035.030) (-2033.936) [-2032.424] -- 0:00:20
926500 -- (-2042.731) (-2037.556) (-2043.447) [-2030.984] * (-2045.739) (-2036.366) [-2036.757] (-2041.482) -- 0:00:20
927000 -- (-2054.107) (-2035.300) [-2033.373] (-2035.223) * (-2039.516) (-2033.275) [-2036.056] (-2035.928) -- 0:00:20
927500 -- [-2037.277] (-2036.270) (-2033.783) (-2040.715) * (-2040.903) [-2036.047] (-2036.704) (-2044.107) -- 0:00:20
928000 -- [-2034.410] (-2033.119) (-2042.845) (-2039.967) * (-2040.951) (-2039.859) [-2041.147] (-2031.560) -- 0:00:19
928500 -- [-2036.281] (-2032.521) (-2036.078) (-2037.648) * (-2035.819) [-2032.038] (-2042.100) (-2039.470) -- 0:00:19
929000 -- (-2042.230) (-2037.920) [-2032.846] (-2038.825) * (-2044.516) (-2035.926) (-2044.034) [-2040.239] -- 0:00:19
929500 -- [-2036.642] (-2034.016) (-2044.055) (-2040.105) * (-2035.969) (-2037.765) (-2056.543) [-2040.975] -- 0:00:19
930000 -- (-2034.551) (-2037.875) (-2041.565) [-2033.287] * (-2043.545) (-2034.229) [-2038.139] (-2043.439) -- 0:00:19
Average standard deviation of split frequencies: 0.003672
930500 -- [-2032.425] (-2041.142) (-2038.569) (-2038.811) * (-2032.087) (-2036.945) [-2035.526] (-2045.049) -- 0:00:19
931000 -- [-2033.762] (-2036.301) (-2045.248) (-2048.616) * (-2037.715) (-2039.840) [-2034.294] (-2045.863) -- 0:00:19
931500 -- (-2036.800) [-2034.613] (-2032.573) (-2032.963) * (-2034.489) (-2033.181) (-2035.354) [-2039.450] -- 0:00:18
932000 -- (-2036.198) [-2035.942] (-2040.210) (-2040.830) * [-2034.631] (-2033.367) (-2033.314) (-2032.859) -- 0:00:18
932500 -- (-2038.967) (-2037.646) [-2036.044] (-2032.849) * (-2037.179) (-2033.229) (-2033.916) [-2044.356] -- 0:00:18
933000 -- [-2033.433] (-2037.685) (-2036.299) (-2035.398) * (-2033.184) (-2041.218) [-2035.949] (-2037.506) -- 0:00:18
933500 -- [-2034.318] (-2035.651) (-2039.837) (-2033.054) * [-2046.131] (-2042.438) (-2036.742) (-2043.795) -- 0:00:18
934000 -- [-2038.418] (-2038.871) (-2034.209) (-2043.329) * [-2039.635] (-2032.440) (-2039.829) (-2035.923) -- 0:00:18
934500 -- (-2043.037) (-2036.799) [-2032.697] (-2040.245) * (-2038.226) (-2032.955) [-2034.898] (-2034.184) -- 0:00:18
935000 -- [-2035.298] (-2039.366) (-2036.430) (-2043.929) * (-2043.869) (-2030.653) [-2038.796] (-2035.128) -- 0:00:18
Average standard deviation of split frequencies: 0.004155
935500 -- (-2035.998) [-2036.626] (-2032.648) (-2041.734) * (-2041.093) (-2039.175) (-2033.917) [-2039.270] -- 0:00:17
936000 -- [-2030.662] (-2031.202) (-2039.842) (-2045.686) * (-2042.431) [-2043.318] (-2044.605) (-2044.595) -- 0:00:17
936500 -- [-2034.162] (-2032.705) (-2036.929) (-2043.053) * (-2054.143) (-2042.464) [-2032.867] (-2037.777) -- 0:00:17
937000 -- (-2042.169) [-2035.702] (-2050.342) (-2040.829) * (-2037.923) (-2042.490) [-2031.386] (-2039.313) -- 0:00:17
937500 -- (-2033.982) (-2041.019) [-2033.646] (-2036.850) * [-2040.487] (-2045.395) (-2040.142) (-2040.212) -- 0:00:17
938000 -- (-2040.356) (-2035.154) (-2036.720) [-2038.192] * [-2038.685] (-2035.717) (-2039.889) (-2045.027) -- 0:00:17
938500 -- (-2044.551) (-2037.863) (-2037.725) [-2037.923] * (-2038.748) (-2038.777) (-2036.568) [-2038.222] -- 0:00:17
939000 -- (-2044.237) (-2039.688) [-2038.674] (-2040.253) * (-2036.432) (-2034.415) (-2042.010) [-2034.185] -- 0:00:16
939500 -- [-2035.812] (-2036.394) (-2036.624) (-2044.867) * (-2045.393) [-2037.419] (-2043.598) (-2039.912) -- 0:00:16
940000 -- [-2032.846] (-2037.037) (-2042.288) (-2040.744) * (-2041.394) (-2044.655) [-2033.931] (-2033.072) -- 0:00:16
Average standard deviation of split frequencies: 0.004134
940500 -- (-2036.026) [-2036.299] (-2045.897) (-2038.032) * (-2041.795) (-2036.450) (-2036.298) [-2035.936] -- 0:00:16
941000 -- (-2036.004) (-2038.270) [-2032.157] (-2039.524) * (-2043.485) (-2042.132) (-2034.993) [-2035.756] -- 0:00:16
941500 -- (-2038.684) [-2041.722] (-2038.779) (-2036.760) * (-2039.417) (-2043.438) (-2037.424) [-2038.340] -- 0:00:16
942000 -- (-2040.350) (-2034.168) (-2040.124) [-2037.421] * (-2039.319) (-2043.314) [-2034.482] (-2035.771) -- 0:00:16
942500 -- (-2045.354) [-2037.978] (-2042.477) (-2045.514) * (-2038.135) (-2041.454) [-2035.358] (-2045.299) -- 0:00:15
943000 -- (-2038.517) [-2038.323] (-2051.622) (-2036.050) * (-2042.070) (-2037.152) [-2034.989] (-2035.099) -- 0:00:15
943500 -- [-2036.012] (-2035.477) (-2040.624) (-2034.582) * (-2037.021) (-2042.005) [-2033.854] (-2039.212) -- 0:00:15
944000 -- [-2032.719] (-2036.268) (-2030.322) (-2048.893) * (-2043.849) (-2039.688) (-2034.245) [-2041.577] -- 0:00:15
944500 -- [-2037.535] (-2041.996) (-2038.966) (-2040.101) * (-2033.023) [-2035.872] (-2043.354) (-2039.688) -- 0:00:15
945000 -- (-2041.326) (-2035.952) [-2034.683] (-2032.712) * (-2042.954) (-2040.834) [-2034.741] (-2038.761) -- 0:00:15
Average standard deviation of split frequencies: 0.004236
945500 -- (-2030.453) (-2041.762) [-2036.462] (-2037.001) * (-2040.502) [-2031.102] (-2036.390) (-2033.559) -- 0:00:15
946000 -- (-2032.615) [-2043.351] (-2039.005) (-2040.344) * (-2035.732) (-2035.829) [-2033.062] (-2033.809) -- 0:00:14
946500 -- (-2040.644) [-2037.366] (-2044.760) (-2041.000) * (-2033.166) [-2033.390] (-2039.969) (-2037.914) -- 0:00:14
947000 -- (-2037.055) [-2033.488] (-2037.466) (-2036.673) * (-2043.573) (-2037.244) (-2047.487) [-2038.094] -- 0:00:14
947500 -- (-2041.031) (-2035.556) [-2035.146] (-2040.404) * (-2033.640) [-2033.417] (-2045.334) (-2039.275) -- 0:00:14
948000 -- [-2036.223] (-2042.131) (-2043.845) (-2035.864) * (-2034.692) (-2043.713) (-2043.411) [-2033.053] -- 0:00:14
948500 -- [-2036.790] (-2040.210) (-2047.825) (-2037.303) * [-2040.352] (-2035.966) (-2034.920) (-2038.725) -- 0:00:14
949000 -- (-2033.780) (-2037.713) (-2041.621) [-2036.176] * (-2036.721) (-2031.717) (-2035.384) [-2037.963] -- 0:00:14
949500 -- (-2036.208) [-2032.073] (-2044.047) (-2033.685) * (-2034.242) [-2034.416] (-2035.052) (-2039.415) -- 0:00:13
950000 -- (-2037.926) [-2036.708] (-2040.138) (-2037.553) * (-2036.222) (-2039.174) [-2035.639] (-2037.812) -- 0:00:13
Average standard deviation of split frequencies: 0.003595
950500 -- (-2038.636) (-2039.756) (-2042.178) [-2036.605] * (-2041.289) (-2036.575) [-2036.081] (-2035.153) -- 0:00:13
951000 -- (-2033.781) (-2036.590) (-2041.620) [-2029.480] * (-2034.144) [-2040.191] (-2040.552) (-2034.612) -- 0:00:13
951500 -- (-2033.095) [-2032.122] (-2044.551) (-2034.578) * (-2037.617) (-2038.354) (-2034.726) [-2038.111] -- 0:00:13
952000 -- [-2032.142] (-2041.324) (-2037.908) (-2038.543) * [-2036.531] (-2035.688) (-2031.983) (-2035.506) -- 0:00:13
952500 -- (-2040.179) (-2050.092) [-2040.549] (-2038.707) * (-2035.861) (-2037.384) (-2034.924) [-2038.019] -- 0:00:13
953000 -- (-2035.833) (-2044.298) [-2038.551] (-2036.236) * (-2032.802) (-2032.973) (-2040.795) [-2038.384] -- 0:00:13
953500 -- (-2032.654) (-2044.915) [-2034.796] (-2036.499) * (-2034.707) (-2038.829) (-2042.506) [-2034.909] -- 0:00:12
954000 -- (-2035.579) (-2040.115) [-2035.082] (-2038.149) * (-2034.960) (-2038.869) (-2042.108) [-2040.873] -- 0:00:12
954500 -- (-2039.432) (-2046.030) (-2041.396) [-2045.914] * (-2043.725) (-2036.701) (-2038.190) [-2039.348] -- 0:00:12
955000 -- (-2041.233) [-2036.219] (-2040.244) (-2045.848) * (-2043.483) (-2036.862) [-2037.135] (-2041.616) -- 0:00:12
Average standard deviation of split frequencies: 0.003698
955500 -- (-2035.317) [-2034.619] (-2043.532) (-2040.062) * (-2046.515) (-2035.727) (-2033.842) [-2039.566] -- 0:00:12
956000 -- (-2036.197) [-2035.424] (-2035.702) (-2037.085) * (-2032.388) (-2034.249) [-2033.913] (-2040.457) -- 0:00:12
956500 -- (-2043.022) (-2035.244) (-2038.560) [-2033.490] * (-2035.358) (-2035.624) [-2033.998] (-2036.757) -- 0:00:12
957000 -- (-2040.644) (-2038.271) (-2040.349) [-2039.813] * (-2041.673) (-2045.472) [-2040.105] (-2038.407) -- 0:00:11
957500 -- [-2036.780] (-2039.747) (-2036.028) (-2040.834) * (-2036.695) (-2043.134) (-2035.113) [-2042.542] -- 0:00:11
958000 -- (-2041.081) (-2041.680) (-2045.550) [-2040.425] * (-2044.808) (-2037.195) [-2044.668] (-2036.961) -- 0:00:11
958500 -- [-2034.334] (-2038.008) (-2042.863) (-2050.677) * (-2044.205) (-2044.484) [-2038.929] (-2034.324) -- 0:00:11
959000 -- (-2032.176) (-2043.876) (-2041.248) [-2035.869] * (-2034.082) (-2035.481) [-2033.441] (-2037.100) -- 0:00:11
959500 -- [-2036.463] (-2034.780) (-2033.863) (-2043.588) * (-2037.607) (-2037.344) [-2034.627] (-2040.862) -- 0:00:11
960000 -- (-2034.446) (-2041.095) [-2036.245] (-2036.483) * (-2042.626) (-2044.275) (-2035.071) [-2034.246] -- 0:00:11
Average standard deviation of split frequencies: 0.004171
960500 -- (-2041.922) (-2033.216) [-2037.698] (-2039.342) * (-2037.573) (-2039.481) (-2031.999) [-2033.424] -- 0:00:10
961000 -- (-2043.620) (-2036.262) (-2039.176) [-2038.088] * [-2035.731] (-2043.579) (-2039.799) (-2033.514) -- 0:00:10
961500 -- [-2038.256] (-2037.199) (-2038.572) (-2040.194) * (-2038.538) (-2041.170) [-2031.519] (-2031.494) -- 0:00:10
962000 -- (-2037.544) (-2042.900) [-2038.425] (-2036.509) * (-2035.194) [-2041.149] (-2035.452) (-2035.286) -- 0:00:10
962500 -- (-2042.566) [-2039.253] (-2033.056) (-2032.841) * (-2036.779) (-2034.263) [-2034.607] (-2038.511) -- 0:00:10
963000 -- (-2034.561) [-2041.114] (-2036.105) (-2039.096) * (-2037.054) (-2034.265) (-2043.056) [-2035.098] -- 0:00:10
963500 -- [-2035.842] (-2043.092) (-2042.528) (-2036.844) * (-2041.085) (-2036.863) [-2031.316] (-2035.072) -- 0:00:10
964000 -- (-2042.670) (-2039.947) [-2035.610] (-2036.616) * (-2043.121) (-2041.819) (-2036.338) [-2042.042] -- 0:00:09
964500 -- (-2038.863) (-2037.314) (-2038.006) [-2036.083] * (-2038.152) (-2039.474) (-2039.117) [-2036.453] -- 0:00:09
965000 -- [-2038.879] (-2031.272) (-2038.139) (-2045.574) * [-2042.743] (-2048.358) (-2051.617) (-2037.839) -- 0:00:09
Average standard deviation of split frequencies: 0.003904
965500 -- (-2050.197) (-2034.441) (-2037.301) [-2037.097] * (-2037.673) (-2031.733) (-2037.130) [-2031.468] -- 0:00:09
966000 -- [-2037.666] (-2039.191) (-2036.468) (-2041.475) * (-2042.234) [-2035.784] (-2035.834) (-2039.682) -- 0:00:09
966500 -- [-2042.072] (-2032.938) (-2035.095) (-2035.615) * [-2038.791] (-2036.395) (-2033.649) (-2040.642) -- 0:00:09
967000 -- (-2045.634) (-2043.214) [-2040.652] (-2036.031) * [-2034.002] (-2037.171) (-2034.472) (-2043.572) -- 0:00:09
967500 -- (-2043.478) [-2034.059] (-2036.069) (-2035.676) * (-2034.573) (-2034.026) (-2035.216) [-2036.018] -- 0:00:09
968000 -- (-2040.422) (-2036.512) (-2035.962) [-2040.581] * (-2039.569) [-2037.756] (-2039.818) (-2042.126) -- 0:00:08
968500 -- (-2041.713) [-2040.025] (-2035.616) (-2043.716) * (-2037.129) (-2037.704) (-2036.162) [-2039.564] -- 0:00:08
969000 -- [-2037.026] (-2040.057) (-2034.649) (-2039.759) * (-2036.149) [-2037.229] (-2030.852) (-2035.597) -- 0:00:08
969500 -- [-2045.918] (-2034.907) (-2035.646) (-2037.988) * (-2038.079) (-2039.468) [-2037.442] (-2037.119) -- 0:00:08
970000 -- [-2041.579] (-2033.414) (-2044.162) (-2042.244) * (-2036.484) [-2035.252] (-2037.644) (-2038.962) -- 0:00:08
Average standard deviation of split frequencies: 0.003278
970500 -- (-2042.118) [-2034.902] (-2040.727) (-2036.330) * (-2034.446) (-2041.945) (-2032.431) [-2040.116] -- 0:00:08
971000 -- (-2036.600) [-2040.109] (-2038.084) (-2036.094) * (-2037.574) (-2038.908) [-2035.999] (-2033.321) -- 0:00:08
971500 -- [-2041.338] (-2048.401) (-2033.706) (-2037.076) * (-2035.813) [-2041.708] (-2035.793) (-2037.009) -- 0:00:07
972000 -- (-2043.303) (-2033.691) (-2037.879) [-2041.677] * (-2034.166) [-2039.095] (-2047.234) (-2036.312) -- 0:00:07
972500 -- (-2032.801) [-2041.517] (-2037.862) (-2038.159) * (-2038.192) (-2045.277) (-2034.702) [-2030.246] -- 0:00:07
973000 -- (-2038.844) (-2038.453) (-2045.570) [-2037.115] * [-2036.184] (-2037.302) (-2035.509) (-2036.497) -- 0:00:07
973500 -- (-2035.438) (-2040.422) [-2033.199] (-2038.632) * (-2042.152) (-2037.228) (-2037.919) [-2039.517] -- 0:00:07
974000 -- [-2039.729] (-2041.404) (-2036.834) (-2037.533) * (-2050.125) (-2036.683) [-2034.730] (-2034.156) -- 0:00:07
974500 -- (-2035.470) [-2038.373] (-2040.013) (-2033.836) * (-2033.639) (-2034.869) (-2039.743) [-2040.110] -- 0:00:07
975000 -- (-2036.884) (-2042.358) (-2040.576) [-2035.568] * (-2038.034) [-2034.323] (-2038.436) (-2037.556) -- 0:00:06
Average standard deviation of split frequencies: 0.002415
975500 -- (-2034.673) (-2036.291) [-2034.078] (-2035.908) * (-2034.927) (-2037.683) [-2039.282] (-2038.741) -- 0:00:06
976000 -- [-2032.946] (-2041.510) (-2035.415) (-2040.926) * (-2036.775) [-2036.380] (-2034.416) (-2033.904) -- 0:00:06
976500 -- (-2042.597) (-2039.082) (-2034.415) [-2037.271] * (-2033.796) (-2040.041) [-2033.983] (-2030.781) -- 0:00:06
977000 -- [-2037.877] (-2043.250) (-2033.894) (-2035.865) * (-2031.424) (-2038.931) (-2045.640) [-2033.173] -- 0:00:06
977500 -- (-2041.106) (-2038.234) (-2037.862) [-2034.694] * (-2036.037) [-2035.990] (-2040.460) (-2040.575) -- 0:00:06
978000 -- (-2034.997) [-2035.817] (-2035.119) (-2042.548) * (-2040.050) (-2047.957) (-2034.118) [-2038.329] -- 0:00:06
978500 -- (-2032.061) [-2038.920] (-2045.237) (-2040.742) * [-2031.437] (-2042.748) (-2035.353) (-2038.479) -- 0:00:05
979000 -- (-2037.627) (-2041.954) [-2036.399] (-2038.880) * [-2033.295] (-2046.333) (-2033.732) (-2041.952) -- 0:00:05
979500 -- (-2037.565) (-2037.627) [-2033.957] (-2031.592) * (-2032.391) (-2040.200) [-2039.776] (-2041.574) -- 0:00:05
980000 -- [-2034.773] (-2038.978) (-2036.991) (-2035.013) * (-2036.022) (-2039.155) (-2036.281) [-2039.543] -- 0:00:05
Average standard deviation of split frequencies: 0.002644
980500 -- (-2043.342) [-2035.493] (-2041.730) (-2033.651) * (-2032.574) [-2035.826] (-2046.701) (-2038.944) -- 0:00:05
981000 -- (-2039.837) [-2033.392] (-2056.439) (-2032.410) * (-2036.987) (-2040.277) (-2040.160) [-2033.397] -- 0:00:05
981500 -- (-2033.597) (-2040.550) [-2038.305] (-2056.147) * [-2038.587] (-2039.497) (-2044.612) (-2037.298) -- 0:00:05
982000 -- (-2031.689) (-2044.835) (-2046.510) [-2043.132] * [-2034.913] (-2043.288) (-2051.491) (-2032.285) -- 0:00:04
982500 -- (-2042.349) [-2041.342] (-2038.717) (-2043.283) * [-2037.069] (-2051.083) (-2049.731) (-2034.249) -- 0:00:04
983000 -- [-2035.648] (-2038.409) (-2041.933) (-2041.283) * (-2035.128) (-2048.226) (-2048.286) [-2033.742] -- 0:00:04
983500 -- [-2031.870] (-2046.812) (-2041.114) (-2033.787) * [-2041.438] (-2042.426) (-2039.463) (-2035.359) -- 0:00:04
984000 -- [-2031.689] (-2041.333) (-2037.436) (-2039.856) * [-2034.001] (-2035.947) (-2039.684) (-2037.000) -- 0:00:04
984500 -- [-2032.054] (-2040.776) (-2036.269) (-2039.275) * (-2038.217) [-2035.093] (-2043.152) (-2030.691) -- 0:00:04
985000 -- [-2035.627] (-2045.039) (-2032.846) (-2036.302) * (-2040.779) [-2041.854] (-2035.790) (-2035.022) -- 0:00:04
Average standard deviation of split frequencies: 0.002271
985500 -- (-2035.339) [-2047.552] (-2035.269) (-2037.494) * (-2038.561) (-2038.556) [-2042.292] (-2030.153) -- 0:00:04
986000 -- (-2034.562) [-2037.784] (-2039.016) (-2038.982) * (-2030.488) [-2041.065] (-2041.394) (-2037.919) -- 0:00:03
986500 -- (-2036.019) (-2040.717) [-2035.683] (-2037.425) * (-2037.816) [-2034.423] (-2047.071) (-2036.110) -- 0:00:03
987000 -- [-2036.571] (-2035.561) (-2038.447) (-2039.390) * [-2032.416] (-2035.956) (-2044.641) (-2035.559) -- 0:00:03
987500 -- (-2036.695) (-2040.600) (-2032.986) [-2030.421] * (-2036.987) (-2042.282) (-2042.595) [-2034.911] -- 0:00:03
988000 -- [-2038.022] (-2039.945) (-2043.000) (-2038.353) * (-2037.254) (-2034.087) [-2039.449] (-2042.156) -- 0:00:03
988500 -- (-2043.899) (-2036.369) (-2045.038) [-2039.668] * (-2042.607) [-2039.043] (-2035.109) (-2044.041) -- 0:00:03
989000 -- (-2042.075) [-2036.739] (-2040.793) (-2030.864) * (-2035.939) [-2036.291] (-2040.460) (-2034.948) -- 0:00:03
989500 -- (-2034.353) (-2040.689) [-2035.905] (-2034.519) * [-2036.734] (-2038.022) (-2044.071) (-2034.622) -- 0:00:02
990000 -- [-2035.056] (-2036.341) (-2044.418) (-2037.462) * (-2036.090) [-2032.851] (-2044.217) (-2035.909) -- 0:00:02
Average standard deviation of split frequencies: 0.001665
990500 -- (-2036.882) (-2034.348) (-2038.688) [-2032.046] * (-2046.887) (-2042.570) [-2037.423] (-2037.413) -- 0:00:02
991000 -- (-2032.901) (-2039.871) [-2036.681] (-2036.300) * (-2037.041) (-2042.338) (-2040.712) [-2035.519] -- 0:00:02
991500 -- (-2033.219) [-2039.552] (-2037.412) (-2040.661) * (-2037.215) (-2040.148) [-2042.044] (-2048.221) -- 0:00:02
992000 -- (-2036.165) (-2038.097) [-2031.599] (-2045.105) * [-2032.803] (-2034.998) (-2042.856) (-2033.432) -- 0:00:02
992500 -- [-2036.492] (-2037.403) (-2047.189) (-2040.575) * (-2035.094) (-2035.044) (-2042.607) [-2031.118] -- 0:00:02
993000 -- [-2043.135] (-2033.854) (-2041.024) (-2038.272) * (-2037.107) [-2033.173] (-2037.928) (-2039.503) -- 0:00:01
993500 -- [-2039.372] (-2038.396) (-2041.382) (-2038.346) * (-2045.683) [-2045.859] (-2044.793) (-2038.094) -- 0:00:01
994000 -- (-2032.172) [-2035.836] (-2034.385) (-2037.401) * [-2036.744] (-2034.103) (-2039.290) (-2039.776) -- 0:00:01
994500 -- (-2037.035) (-2036.877) [-2035.016] (-2033.899) * (-2033.033) (-2039.717) (-2043.576) [-2046.556] -- 0:00:01
995000 -- (-2050.271) (-2037.054) [-2035.398] (-2032.434) * (-2038.432) (-2040.701) (-2043.227) [-2033.200] -- 0:00:01
Average standard deviation of split frequencies: 0.001775
995500 -- [-2039.320] (-2039.793) (-2032.146) (-2042.408) * (-2035.596) (-2033.947) (-2036.883) [-2032.123] -- 0:00:01
996000 -- (-2035.300) (-2040.705) [-2030.926] (-2033.905) * (-2044.754) [-2037.926] (-2043.845) (-2035.588) -- 0:00:01
996500 -- (-2037.269) [-2036.779] (-2034.008) (-2040.127) * [-2036.886] (-2033.001) (-2040.753) (-2034.372) -- 0:00:00
997000 -- (-2035.525) (-2043.067) (-2048.378) [-2036.512] * (-2043.056) (-2041.659) (-2042.435) [-2035.332] -- 0:00:00
997500 -- [-2036.066] (-2043.892) (-2040.885) (-2036.267) * (-2037.118) [-2033.780] (-2049.805) (-2039.330) -- 0:00:00
998000 -- (-2041.481) (-2039.334) [-2037.218] (-2038.711) * (-2032.288) [-2035.513] (-2045.276) (-2035.643) -- 0:00:00
998500 -- (-2038.871) [-2038.211] (-2037.711) (-2038.768) * (-2038.953) (-2047.226) [-2042.870] (-2042.634) -- 0:00:00
999000 -- [-2032.408] (-2038.536) (-2035.811) (-2039.505) * (-2040.155) (-2036.336) (-2037.730) [-2035.928] -- 0:00:00
999500 -- [-2035.600] (-2037.030) (-2035.285) (-2034.916) * (-2037.177) [-2042.585] (-2033.375) (-2037.546) -- 0:00:00
1000000 -- [-2040.398] (-2036.213) (-2038.353) (-2042.471) * (-2037.311) (-2041.515) (-2037.302) [-2037.416] -- 0:00:00
Average standard deviation of split frequencies: 0.002002
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -2040.397889 -- 18.351229
Chain 1 -- -2040.397889 -- 18.351229
Chain 2 -- -2036.213384 -- 14.968024
Chain 2 -- -2036.213377 -- 14.968024
Chain 3 -- -2038.353484 -- 14.076968
Chain 3 -- -2038.353494 -- 14.076968
Chain 4 -- -2042.470796 -- 17.024635
Chain 4 -- -2042.470796 -- 17.024635
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -2037.311492 -- 15.577675
Chain 1 -- -2037.311492 -- 15.577675
Chain 2 -- -2041.515052 -- 15.974832
Chain 2 -- -2041.515046 -- 15.974832
Chain 3 -- -2037.302309 -- 14.946334
Chain 3 -- -2037.302309 -- 14.946334
Chain 4 -- -2037.415662 -- 12.931520
Chain 4 -- -2037.415669 -- 12.931520
Analysis completed in 4 mins 37 seconds
Analysis used 276.97 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -2027.87
Likelihood of best state for "cold" chain of run 2 was -2027.82
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
51.6 % ( 37 %) Dirichlet(Revmat{all})
67.4 % ( 58 %) Slider(Revmat{all})
26.0 % ( 29 %) Dirichlet(Pi{all})
28.1 % ( 28 %) Slider(Pi{all})
50.1 % ( 30 %) Multiplier(Alpha{1,2})
48.1 % ( 34 %) Multiplier(Alpha{3})
69.0 % ( 45 %) Slider(Pinvar{all})
2.8 % ( 2 %) ExtSPR(Tau{all},V{all})
1.4 % ( 0 %) ExtTBR(Tau{all},V{all})
5.7 % ( 3 %) NNI(Tau{all},V{all})
8.6 % ( 7 %) ParsSPR(Tau{all},V{all})
26.2 % ( 35 %) Multiplier(V{all})
33.6 % ( 35 %) Nodeslider(V{all})
25.5 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
52.2 % ( 35 %) Dirichlet(Revmat{all})
67.0 % ( 60 %) Slider(Revmat{all})
25.8 % ( 22 %) Dirichlet(Pi{all})
27.3 % ( 21 %) Slider(Pi{all})
50.1 % ( 30 %) Multiplier(Alpha{1,2})
48.3 % ( 34 %) Multiplier(Alpha{3})
70.1 % ( 47 %) Slider(Pinvar{all})
2.9 % ( 6 %) ExtSPR(Tau{all},V{all})
1.5 % ( 1 %) ExtTBR(Tau{all},V{all})
5.7 % ( 8 %) NNI(Tau{all},V{all})
8.6 % ( 9 %) ParsSPR(Tau{all},V{all})
26.2 % ( 24 %) Multiplier(V{all})
33.5 % ( 29 %) Nodeslider(V{all})
25.4 % ( 28 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.82 0.66 0.53
2 | 166502 0.83 0.68
3 | 166942 166268 0.85
4 | 167112 166759 166417
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.82 0.66 0.52
2 | 165682 0.83 0.68
3 | 166927 166834 0.84
4 | 166890 166702 166965
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -2034.52
| 2 1 |
| |
| 2 1 1 1 |
| 1 11 1 |
|22 212 1 1 2 2 2 2 |
| 1* 1 *2 2 21 1 2 2 1 2 21 21 |
| 1 1 2 * 1 1 2 1221 22 21 1 *1|
| 2 2 2 2* 2 2 2 1 1 1 1 1 |
| 1 1 *1 1 2 1 1 1 1 2 2 2|
|11 2 21 2 *222 212 2 12 2 2 |
| 11 1 22 |
| 2 1 1 |
| 1 1 2 2 |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2038.86
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2033.31 -2046.73
2 -2033.25 -2044.44
--------------------------------------
TOTAL -2033.28 -2046.14
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.429569 0.003279 0.325417 0.541663 0.423086 1388.67 1395.10 1.000
r(A<->C){all} 0.171477 0.001170 0.109790 0.240236 0.168847 776.49 1050.29 1.000
r(A<->G){all} 0.207973 0.001728 0.128421 0.288264 0.206254 641.06 882.34 1.000
r(A<->T){all} 0.132867 0.001639 0.055534 0.208155 0.130260 594.80 629.49 1.000
r(C<->G){all} 0.094964 0.000504 0.053544 0.141198 0.093294 770.33 941.45 1.000
r(C<->T){all} 0.287521 0.002089 0.203535 0.381699 0.286065 927.65 1013.66 1.000
r(G<->T){all} 0.105198 0.000923 0.049269 0.163644 0.103085 944.19 1014.89 1.000
pi(A){all} 0.214895 0.000187 0.188397 0.241696 0.214912 1291.03 1329.28 1.000
pi(C){all} 0.333231 0.000244 0.302095 0.362482 0.333285 1132.69 1185.57 1.001
pi(G){all} 0.275918 0.000229 0.244622 0.303762 0.275400 1070.95 1136.05 1.000
pi(T){all} 0.175956 0.000160 0.152789 0.201718 0.175528 1248.39 1297.34 1.000
alpha{1,2} 0.126714 0.004481 0.000208 0.231717 0.128822 1043.93 1068.19 1.000
alpha{3} 1.886459 0.579474 0.681053 3.407272 1.748901 1128.70 1251.37 1.001
pinvar{all} 0.191412 0.012988 0.000006 0.390345 0.184523 1055.21 1135.54 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- ...***
9 -- ...**.
10 -- ....**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 3002 1.000000 0.000000 1.000000 1.000000 2
8 2995 0.997668 0.000471 0.997335 0.998001 2
9 2579 0.859094 0.004240 0.856096 0.862092 2
10 339 0.112925 0.003298 0.110593 0.115256 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.021241 0.000052 0.008082 0.035869 0.020605 1.000 2
length{all}[2] 0.015931 0.000031 0.005711 0.026385 0.015365 1.000 2
length{all}[3] 0.013976 0.000028 0.004381 0.024067 0.013383 1.000 2
length{all}[4] 0.050184 0.000136 0.029036 0.073800 0.049429 1.000 2
length{all}[5] 0.052373 0.000152 0.029974 0.076163 0.051046 1.000 2
length{all}[6] 0.211987 0.001789 0.142467 0.297298 0.206401 1.000 2
length{all}[7] 0.018006 0.000046 0.005676 0.030614 0.017108 1.000 2
length{all}[8] 0.030174 0.000126 0.009586 0.051472 0.028918 1.000 2
length{all}[9] 0.016725 0.000084 0.000666 0.034015 0.015482 1.000 2
length{all}[10] 0.010378 0.000058 0.000039 0.024902 0.008897 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.002002
Maximum standard deviation of split frequencies = 0.004240
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.000
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------ C2 (2)
|----------------------100----------------------+
| \------------------------ C3 (3)
+
| /------------------------ C4 (4)
| /-----------86----------+
| | \------------------------ C5 (5)
\----------100----------+
\------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------ C1 (1)
|
| /----- C2 (2)
|----+
| \---- C3 (3)
+
| /--------------- C4 (4)
| /----+
| | \--------------- C5 (5)
\--------+
\--------------------------------------------------------------- C6 (6)
|--------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (5 trees sampled):
90 % credible set contains 2 trees
95 % credible set contains 2 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 6 ls = 816
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
51 ambiguity characters in seq. 1
51 ambiguity characters in seq. 2
51 ambiguity characters in seq. 3
48 ambiguity characters in seq. 4
63 ambiguity characters in seq. 5
36 ambiguity characters in seq. 6
23 sites are removed. 48 49 50 51 225 226 227 244 245 246 255 256 257 258 264 265 266 267 268 269 270 271 272
Sequences read..
Counting site patterns.. 0:00
158 patterns at 249 / 249 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
154208 bytes for conP
21488 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (2, 3), ((4, 5), 6)); MP score: 165
308416 bytes for conP, adjusted
0.048156 0.035758 0.027149 0.039449 0.054080 0.020425 0.102391 0.109677 0.380473 0.300000 1.300000
ntime & nrate & np: 9 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 11
lnL0 = -2054.344656
Iterating by ming2
Initial: fx= 2054.344656
x= 0.04816 0.03576 0.02715 0.03945 0.05408 0.02042 0.10239 0.10968 0.38047 0.30000 1.30000
1 h-m-p 0.0000 0.0010 228.0094 +++YYC 2043.556209 2 0.0005 21 | 0/11
2 h-m-p 0.0003 0.0029 399.4513 +CCCC 2019.530474 3 0.0012 42 | 0/11
3 h-m-p 0.0002 0.0010 437.7017 +CYCCC 1984.547042 4 0.0008 64 | 0/11
4 h-m-p 0.0000 0.0001 718.9553 YCCCC 1983.266420 4 0.0000 85 | 0/11
5 h-m-p 0.0001 0.0008 181.5239 +CYCC 1979.477404 3 0.0004 105 | 0/11
6 h-m-p 0.0002 0.0008 368.1556 ++ 1953.277397 m 0.0008 119 | 0/11
7 h-m-p -0.0000 -0.0000 1786.6734
h-m-p: -1.28357035e-21 -6.41785174e-21 1.78667337e+03 1953.277397
.. | 0/11
8 h-m-p 0.0000 0.0006 897.0978 +YYCCC 1942.796369 4 0.0001 151 | 0/11
9 h-m-p 0.0001 0.0005 204.5229 +YYCYCCC 1933.940856 6 0.0004 175 | 0/11
10 h-m-p 0.0004 0.0021 175.9913 +YYYYCC 1910.579954 5 0.0017 196 | 0/11
11 h-m-p 0.0000 0.0001 2122.7966 CYCCCC 1905.162655 5 0.0000 219 | 0/11
12 h-m-p 0.0006 0.0030 40.7348 YCC 1904.926299 2 0.0003 236 | 0/11
13 h-m-p 0.0007 0.0054 18.4491 YYC 1904.837963 2 0.0006 252 | 0/11
14 h-m-p 0.0003 0.0183 30.7748 +YCC 1904.648560 2 0.0009 270 | 0/11
15 h-m-p 0.0009 0.0061 33.9017 YYC 1904.509402 2 0.0007 286 | 0/11
16 h-m-p 0.0008 0.0170 28.1387 +YCC 1904.145018 2 0.0025 304 | 0/11
17 h-m-p 0.0006 0.0117 112.0253 YCCC 1903.382094 3 0.0014 323 | 0/11
18 h-m-p 0.0012 0.0066 133.5874 YYCC 1902.669603 3 0.0011 341 | 0/11
19 h-m-p 0.2913 1.4567 0.4770 CCCCC 1898.541037 4 0.5161 363 | 0/11
20 h-m-p 1.6000 8.0000 0.0614 YCCC 1897.180295 3 1.1451 393 | 0/11
21 h-m-p 1.2408 8.0000 0.0567 YCCC 1896.384615 3 2.0021 423 | 0/11
22 h-m-p 1.6000 8.0000 0.0463 CCC 1896.273012 2 1.3706 452 | 0/11
23 h-m-p 1.6000 8.0000 0.0063 YC 1896.259263 1 0.9149 478 | 0/11
24 h-m-p 0.8371 8.0000 0.0069 CC 1896.254453 1 1.2081 505 | 0/11
25 h-m-p 1.6000 8.0000 0.0021 CC 1896.252243 1 2.0497 532 | 0/11
26 h-m-p 1.6000 8.0000 0.0013 YC 1896.251801 1 1.0231 558 | 0/11
27 h-m-p 1.6000 8.0000 0.0004 Y 1896.251770 0 0.9952 583 | 0/11
28 h-m-p 1.6000 8.0000 0.0000 Y 1896.251769 0 1.0407 608 | 0/11
29 h-m-p 1.6000 8.0000 0.0000 Y 1896.251769 0 0.9737 633 | 0/11
30 h-m-p 1.6000 8.0000 0.0000 C 1896.251769 0 1.4235 658 | 0/11
31 h-m-p 1.6000 8.0000 0.0000 ------C 1896.251769 0 0.0001 689
Out..
lnL = -1896.251769
690 lfun, 690 eigenQcodon, 6210 P(t)
Time used: 0:02
Model 1: NearlyNeutral
TREE # 1
(1, (2, 3), ((4, 5), 6)); MP score: 165
0.048156 0.035758 0.027149 0.039449 0.054080 0.020425 0.102391 0.109677 0.380473 1.378611 0.747245 0.296991
ntime & nrate & np: 9 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.040538
np = 12
lnL0 = -1919.446142
Iterating by ming2
Initial: fx= 1919.446142
x= 0.04816 0.03576 0.02715 0.03945 0.05408 0.02042 0.10239 0.10968 0.38047 1.37861 0.74724 0.29699
1 h-m-p 0.0000 0.0016 199.3121 +++YCCCCC 1907.818504 5 0.0009 29 | 0/12
2 h-m-p 0.0001 0.0004 561.7141 +YCYCCC 1893.842822 5 0.0002 53 | 0/12
3 h-m-p 0.0001 0.0005 191.0079 CCCCC 1892.483874 4 0.0001 76 | 0/12
4 h-m-p 0.0007 0.0055 31.2623 CCCC 1892.068218 3 0.0009 97 | 0/12
5 h-m-p 0.0021 0.0181 13.2245 YC 1891.967935 1 0.0012 113 | 0/12
6 h-m-p 0.0010 0.0087 16.0101 YCC 1891.904872 2 0.0008 131 | 0/12
7 h-m-p 0.0022 0.0591 5.6922 CCC 1891.828356 2 0.0033 150 | 0/12
8 h-m-p 0.0019 0.0994 9.7703 +CCCC 1891.353879 3 0.0108 172 | 0/12
9 h-m-p 0.0035 0.0268 30.4481 CCCC 1890.406860 3 0.0059 193 | 0/12
10 h-m-p 0.0020 0.0099 76.3395 CCCCC 1889.272059 4 0.0027 216 | 0/12
11 h-m-p 0.0041 0.0204 5.7937 YCC 1889.209696 2 0.0017 234 | 0/12
12 h-m-p 0.0024 0.1099 4.1140 +YCCC 1887.970678 3 0.0244 255 | 0/12
13 h-m-p 0.0010 0.0061 100.3412 +YYCCC 1883.522673 4 0.0032 277 | 0/12
14 h-m-p 0.0464 0.2320 0.6117 +CYC 1879.218858 2 0.1729 296 | 0/12
15 h-m-p 0.1293 0.6465 0.1950 CCCCC 1877.946097 4 0.2138 331 | 0/12
16 h-m-p 0.3799 3.0942 0.1097 CCC 1876.943815 2 0.5853 362 | 0/12
17 h-m-p 0.8773 5.5070 0.0732 CYC 1876.507013 2 0.8352 392 | 0/12
18 h-m-p 0.5509 8.0000 0.1110 CC 1876.333231 1 0.8108 421 | 0/12
19 h-m-p 1.6000 8.0000 0.0227 YC 1876.259068 1 0.9526 449 | 0/12
20 h-m-p 1.5376 8.0000 0.0141 YC 1876.241375 1 0.8160 477 | 0/12
21 h-m-p 1.6000 8.0000 0.0026 YC 1876.238495 1 0.8784 505 | 0/12
22 h-m-p 0.6383 8.0000 0.0036 C 1876.238343 0 0.6633 532 | 0/12
23 h-m-p 1.6000 8.0000 0.0001 Y 1876.238336 0 0.9142 559 | 0/12
24 h-m-p 1.6000 8.0000 0.0000 C 1876.238336 0 0.6030 586 | 0/12
25 h-m-p 1.6000 8.0000 0.0000 Y 1876.238336 0 0.8968 613 | 0/12
26 h-m-p 1.6000 8.0000 0.0000 C 1876.238336 0 1.6000 640 | 0/12
27 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/12
28 h-m-p 0.0160 8.0000 0.0007 ------------- | 0/12
29 h-m-p 0.0160 8.0000 0.0007 -------------
Out..
lnL = -1876.238336
758 lfun, 2274 eigenQcodon, 13644 P(t)
Time used: 0:08
Model 2: PositiveSelection
TREE # 1
(1, (2, 3), ((4, 5), 6)); MP score: 165
initial w for M2:NSpselection reset.
0.048156 0.035758 0.027149 0.039449 0.054080 0.020425 0.102391 0.109677 0.380473 1.400384 0.896732 0.199894 0.157918 2.073080
ntime & nrate & np: 9 3 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 6.298197
np = 14
lnL0 = -1936.377812
Iterating by ming2
Initial: fx= 1936.377812
x= 0.04816 0.03576 0.02715 0.03945 0.05408 0.02042 0.10239 0.10968 0.38047 1.40038 0.89673 0.19989 0.15792 2.07308
1 h-m-p 0.0000 0.0019 230.3415 +++YCYCCC 1929.767317 5 0.0004 44 | 0/14
2 h-m-p 0.0002 0.0010 156.7508 ++ 1914.839198 m 0.0010 75 | 1/14
3 h-m-p 0.0009 0.0061 106.8382 YCCC 1910.684644 3 0.0018 111 | 1/14
4 h-m-p 0.0006 0.0031 116.8888 YCCCC 1907.081281 4 0.0014 148 | 0/14
5 h-m-p 0.0002 0.0012 504.1462 CCC 1903.610546 2 0.0003 182 | 0/14
6 h-m-p 0.0005 0.0025 167.7532 CCY 1902.508186 2 0.0004 217 | 0/14
7 h-m-p 0.0009 0.0066 80.3142 +YYYCC 1897.629622 4 0.0036 254 | 0/14
8 h-m-p 0.0003 0.0016 351.6749 YCCC 1894.333066 3 0.0007 290 | 0/14
9 h-m-p 0.0006 0.0035 399.0525 YCCC 1889.119661 3 0.0010 326 | 0/14
10 h-m-p 0.0297 0.1487 2.9182 YCYCCC 1884.164125 5 0.0776 365 | 0/14
11 h-m-p 0.0005 0.0027 112.4737 CCCCC 1882.832995 4 0.0006 404 | 0/14
12 h-m-p 0.0058 0.0290 5.2300 YC 1882.811472 1 0.0010 436 | 0/14
13 h-m-p 0.0011 0.1574 4.7277 +++CYCCC 1880.131177 4 0.0957 477 | 0/14
14 h-m-p 0.2999 1.8390 1.5080 CYC 1878.575371 2 0.2623 511 | 0/14
15 h-m-p 0.0928 0.9704 4.2629 CCCC 1877.436870 3 0.0844 548 | 0/14
16 h-m-p 0.3562 1.7811 0.8077 CYC 1876.598301 2 0.3867 582 | 0/14
17 h-m-p 0.7755 3.8775 0.3756 YCY 1875.651749 2 1.2302 616 | 0/14
18 h-m-p 1.6000 8.0000 0.0597 YCY 1875.462967 2 0.9862 650 | 0/14
19 h-m-p 0.7544 7.7053 0.0781 YC 1875.413843 1 0.5669 682 | 0/14
20 h-m-p 0.6142 8.0000 0.0721 CC 1875.400984 1 0.8768 715 | 0/14
21 h-m-p 0.8627 8.0000 0.0733 YC 1875.390511 1 2.0766 747 | 0/14
22 h-m-p 1.0581 8.0000 0.1438 YCC 1875.378388 2 1.9316 781 | 0/14
23 h-m-p 1.3904 8.0000 0.1998 CCC 1875.358790 2 2.4643 816 | 0/14
24 h-m-p 1.6000 8.0000 0.0654 CC 1875.349985 1 1.4702 849 | 0/14
25 h-m-p 0.2885 8.0000 0.3335 +YYC 1875.343778 2 0.9613 883 | 0/14
26 h-m-p 1.6000 8.0000 0.1282 CC 1875.338063 1 2.1475 916 | 0/14
27 h-m-p 1.6000 8.0000 0.1587 CC 1875.332818 1 1.9103 949 | 0/14
28 h-m-p 1.2132 8.0000 0.2499 CCC 1875.329662 2 1.4434 984 | 0/14
29 h-m-p 1.6000 8.0000 0.1269 YC 1875.328172 1 0.6497 1016 | 0/14
30 h-m-p 0.2425 8.0000 0.3401 +CCC 1875.325499 2 1.6424 1052 | 0/14
31 h-m-p 1.6000 8.0000 0.1726 YC 1875.323789 1 3.1967 1084 | 0/14
32 h-m-p 1.3360 8.0000 0.4130 YY 1875.322985 1 0.9893 1116 | 0/14
33 h-m-p 1.6000 8.0000 0.1636 YC 1875.322506 1 0.9197 1148 | 0/14
34 h-m-p 0.5494 8.0000 0.2740 +CC 1875.321976 1 2.7635 1182 | 0/14
35 h-m-p 1.6000 8.0000 0.2155 C 1875.321652 0 2.0593 1213 | 0/14
36 h-m-p 0.9436 8.0000 0.4704 CC 1875.321462 1 1.4447 1246 | 0/14
37 h-m-p 1.6000 8.0000 0.2926 Y 1875.321359 0 2.9455 1277 | 0/14
38 h-m-p 1.6000 8.0000 0.3571 C 1875.321298 0 1.8218 1308 | 0/14
39 h-m-p 1.6000 8.0000 0.3034 Y 1875.321272 0 3.5434 1339 | 0/14
40 h-m-p 1.6000 8.0000 0.3974 C 1875.321262 0 1.6878 1370 | 0/14
41 h-m-p 1.6000 8.0000 0.3221 Y 1875.321258 0 2.6074 1401 | 0/14
42 h-m-p 1.6000 8.0000 0.4006 C 1875.321256 0 1.9676 1432 | 0/14
43 h-m-p 1.6000 8.0000 0.3451 Y 1875.321255 0 2.7467 1463 | 0/14
44 h-m-p 1.6000 8.0000 0.3338 C 1875.321254 0 1.9566 1494 | 0/14
45 h-m-p 1.6000 8.0000 0.4003 Y 1875.321254 0 2.9031 1525 | 0/14
46 h-m-p 1.6000 8.0000 0.2898 C 1875.321254 0 1.4129 1556 | 0/14
47 h-m-p 1.6000 8.0000 0.2346 Y 1875.321254 0 3.6989 1587 | 0/14
48 h-m-p 1.6000 8.0000 0.3777 Y 1875.321254 0 2.6521 1618 | 0/14
49 h-m-p 1.6000 8.0000 0.1246 C 1875.321254 0 0.5625 1649 | 0/14
50 h-m-p 0.2061 8.0000 0.3400 Y 1875.321254 0 0.1343 1680 | 0/14
51 h-m-p 0.8877 8.0000 0.0514 ++ 1875.321254 m 8.0000 1711 | 0/14
52 h-m-p 1.6000 8.0000 0.1443 Y 1875.321254 0 3.6254 1742 | 0/14
53 h-m-p 0.1989 8.0000 2.6309 -C 1875.321254 0 0.0155 1774 | 0/14
54 h-m-p 0.4191 8.0000 0.0972 --------------Y 1875.321254 0 0.0000 1819 | 0/14
55 h-m-p 0.0025 1.2741 64.5644 ------------.. | 0/14
56 h-m-p 0.0160 8.0000 0.0026 --Y 1875.321254 0 0.0003 1893 | 0/14
57 h-m-p 0.0160 8.0000 0.0005 ------Y 1875.321254 0 0.0000 1930
Out..
lnL = -1875.321254
1931 lfun, 7724 eigenQcodon, 52137 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1884.967721 S = -1773.795326 -103.403537
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 158 patterns 0:29
did 20 / 158 patterns 0:29
did 30 / 158 patterns 0:29
did 40 / 158 patterns 0:29
did 50 / 158 patterns 0:29
did 60 / 158 patterns 0:29
did 70 / 158 patterns 0:29
did 80 / 158 patterns 0:29
did 90 / 158 patterns 0:29
did 100 / 158 patterns 0:29
did 110 / 158 patterns 0:29
did 120 / 158 patterns 0:29
did 130 / 158 patterns 0:29
did 140 / 158 patterns 0:29
did 150 / 158 patterns 0:29
did 158 / 158 patterns 0:29
Time used: 0:29
Model 3: discrete
TREE # 1
(1, (2, 3), ((4, 5), 6)); MP score: 165
0.048156 0.035758 0.027149 0.039449 0.054080 0.020425 0.102391 0.109677 0.380473 1.432747 0.215184 0.509770 0.067570 0.169256 0.245281
ntime & nrate & np: 9 4 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 15.681303
np = 15
lnL0 = -1893.722983
Iterating by ming2
Initial: fx= 1893.722983
x= 0.04816 0.03576 0.02715 0.03945 0.05408 0.02042 0.10239 0.10968 0.38047 1.43275 0.21518 0.50977 0.06757 0.16926 0.24528
1 h-m-p 0.0000 0.0011 123.3842 ++YCCC 1891.821064 3 0.0003 42 | 0/15
2 h-m-p 0.0001 0.0005 110.5811 ++ 1887.762470 m 0.0005 75 | 1/15
3 h-m-p 0.0001 0.0006 336.7005 +YYYCC 1884.920873 4 0.0004 114 | 1/15
4 h-m-p 0.0001 0.0004 240.5235 YCCCC 1884.296726 4 0.0001 153 | 1/15
5 h-m-p 0.0011 0.0089 30.9022 CCC 1883.923184 2 0.0012 189 | 0/15
6 h-m-p 0.0005 0.0024 28.2603 CCC 1883.769120 2 0.0004 225 | 0/15
7 h-m-p 0.0012 0.0221 9.1461 YC 1883.746372 1 0.0008 259 | 0/15
8 h-m-p 0.0009 0.0225 7.5088 YC 1883.735726 1 0.0005 293 | 0/15
9 h-m-p 0.0007 0.0397 5.1600 YC 1883.707791 1 0.0017 327 | 0/15
10 h-m-p 0.0010 0.0165 8.9050 +YCC 1883.618183 2 0.0026 364 | 0/15
11 h-m-p 0.0035 0.0816 6.6796 +CCCCC 1882.880512 4 0.0190 406 | 0/15
12 h-m-p 0.0010 0.0052 23.4894 CYC 1882.769941 2 0.0010 442 | 0/15
13 h-m-p 0.0170 0.1677 1.4077 YC 1882.762438 1 0.0029 476 | 0/15
14 h-m-p 0.0018 0.4435 2.2673 +++YYYC 1881.989675 3 0.1079 515 | 0/15
15 h-m-p 0.0612 0.3059 1.6039 +CCC 1880.782065 2 0.2297 553 | 0/15
16 h-m-p 0.0298 0.1490 2.2773 +CC 1880.417956 1 0.1025 589 | 0/15
17 h-m-p 0.1247 8.0000 1.8705 +CCCCCC 1879.108709 5 0.7440 633 | 0/15
18 h-m-p 0.4005 2.0027 0.8020 CCC 1878.695038 2 0.4136 670 | 0/15
19 h-m-p 0.8159 4.0795 0.2887 YC 1877.566752 1 1.3557 704 | 0/15
20 h-m-p 0.7525 8.0000 0.5201 YCCC 1876.405315 3 1.5580 742 | 0/15
21 h-m-p 1.6000 8.0000 0.1418 CYC 1875.736181 2 1.8410 778 | 0/15
22 h-m-p 1.0679 8.0000 0.2444 CCC 1875.438582 2 1.2424 815 | 0/15
23 h-m-p 1.6000 8.0000 0.1179 YC 1875.351759 1 1.0733 849 | 0/15
24 h-m-p 0.8009 8.0000 0.1580 CC 1875.317226 1 0.8441 884 | 0/15
25 h-m-p 1.6000 8.0000 0.0295 CC 1875.311541 1 1.3597 919 | 0/15
26 h-m-p 1.6000 8.0000 0.0086 C 1875.311095 0 1.5565 952 | 0/15
27 h-m-p 1.6000 8.0000 0.0025 ++ 1875.308597 m 8.0000 985 | 0/15
28 h-m-p 0.2897 1.4487 0.0456 ++ 1875.300714 m 1.4487 1018 | 1/15
29 h-m-p 0.4686 5.9413 0.1282 YC 1875.298796 1 0.0774 1052 | 1/15
30 h-m-p 0.5012 8.0000 0.0198 +YC 1875.291871 1 1.5637 1086 | 1/15
31 h-m-p 1.6000 8.0000 0.0111 YC 1875.291464 1 1.1683 1119 | 1/15
32 h-m-p 1.6000 8.0000 0.0024 +Y 1875.291354 0 4.5747 1152 | 1/15
33 h-m-p 0.9047 8.0000 0.0121 ++ 1875.290365 m 8.0000 1184 | 1/15
34 h-m-p 1.0403 8.0000 0.0929 CCC 1875.289581 2 1.2224 1220 | 0/15
35 h-m-p 0.0373 8.0000 3.0457 Y 1875.289553 0 0.0058 1252 | 0/15
36 h-m-p 0.1445 0.7223 0.0105 ++ 1875.289005 m 0.7223 1285 | 1/15
37 h-m-p 1.1559 8.0000 0.0065 YC 1875.288806 1 0.4853 1319 | 1/15
38 h-m-p 0.0303 8.0000 0.1048 ++Y 1875.288663 0 0.4842 1353 | 1/15
39 h-m-p 1.6000 8.0000 0.0016 C 1875.288649 0 1.6897 1385 | 1/15
40 h-m-p 0.6096 8.0000 0.0045 Y 1875.288647 0 1.4195 1417 | 1/15
41 h-m-p 1.6000 8.0000 0.0006 Y 1875.288647 0 1.0769 1449 | 1/15
42 h-m-p 1.6000 8.0000 0.0001 Y 1875.288646 0 1.0710 1481 | 1/15
43 h-m-p 1.6000 8.0000 0.0000 C 1875.288646 0 1.6000 1513 | 1/15
44 h-m-p 1.5713 8.0000 0.0000 -Y 1875.288646 0 0.0982 1546 | 1/15
45 h-m-p 0.1528 8.0000 0.0000 -------------Y 1875.288646 0 0.0000 1591
Out..
lnL = -1875.288646
1592 lfun, 6368 eigenQcodon, 42984 P(t)
Time used: 0:46
Model 7: beta
TREE # 1
(1, (2, 3), ((4, 5), 6)); MP score: 165
0.048156 0.035758 0.027149 0.039449 0.054080 0.020425 0.102391 0.109677 0.380473 1.428967 0.603915 1.022819
ntime & nrate & np: 9 1 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 10.376301
np = 12
lnL0 = -1904.332994
Iterating by ming2
Initial: fx= 1904.332994
x= 0.04816 0.03576 0.02715 0.03945 0.05408 0.02042 0.10239 0.10968 0.38047 1.42897 0.60392 1.02282
1 h-m-p 0.0000 0.0021 156.7164 ++YYCCC 1901.876452 4 0.0002 37 | 0/12
2 h-m-p 0.0004 0.0039 89.3067 +YCYCCCC 1894.592888 6 0.0022 75 | 0/12
3 h-m-p 0.0001 0.0004 796.7195 +YCYCCC 1887.604660 5 0.0002 111 | 0/12
4 h-m-p 0.0002 0.0011 189.1393 CYCCC 1885.461811 4 0.0004 145 | 0/12
5 h-m-p 0.0004 0.0022 55.1851 YCY 1885.213508 2 0.0003 175 | 0/12
6 h-m-p 0.0006 0.0043 22.3850 CC 1885.082107 1 0.0007 204 | 0/12
7 h-m-p 0.0004 0.0058 36.5004 CCC 1884.928290 2 0.0006 235 | 0/12
8 h-m-p 0.0006 0.0345 38.4767 ++YYC 1883.092313 2 0.0077 266 | 0/12
9 h-m-p 0.0011 0.0055 80.6075 CYCCC 1882.196747 4 0.0018 300 | 0/12
10 h-m-p 0.0080 0.0401 16.4467 CCCC 1881.969792 3 0.0032 333 | 0/12
11 h-m-p 0.0135 0.0673 3.5981 -YC 1881.958606 1 0.0014 362 | 0/12
12 h-m-p 0.0022 0.6388 2.3279 ++YCCC 1881.462105 3 0.0878 396 | 0/12
13 h-m-p 0.2273 1.1367 0.4431 CCCCC 1879.757696 4 0.3081 431 | 0/12
14 h-m-p 0.5817 2.9084 0.2214 CCCC 1879.437907 3 0.8841 464 | 0/12
15 h-m-p 1.1260 8.0000 0.1738 YCCCC 1878.962554 4 2.7593 498 | 0/12
16 h-m-p 0.6455 3.2277 0.3232 YYCCCCC 1878.651757 6 0.7619 535 | 0/12
17 h-m-p 1.6000 8.0000 0.1225 YC 1878.601527 1 0.6840 563 | 0/12
18 h-m-p 1.6000 8.0000 0.0378 YC 1878.591752 1 0.8017 591 | 0/12
19 h-m-p 1.6000 8.0000 0.0010 YC 1878.591190 1 0.7823 619 | 0/12
20 h-m-p 0.9369 8.0000 0.0008 C 1878.591088 0 0.9779 646 | 0/12
21 h-m-p 0.8998 8.0000 0.0009 C 1878.591074 0 0.8382 673 | 0/12
22 h-m-p 1.6000 8.0000 0.0003 C 1878.591073 0 0.6257 700 | 0/12
23 h-m-p 1.6000 8.0000 0.0001 Y 1878.591073 0 0.8685 727 | 0/12
24 h-m-p 1.6000 8.0000 0.0000 Y 1878.591073 0 1.0024 754 | 0/12
25 h-m-p 1.6000 8.0000 0.0000 Y 1878.591073 0 0.4000 781 | 0/12
26 h-m-p 0.9283 8.0000 0.0000 ---C 1878.591073 0 0.0036 811
Out..
lnL = -1878.591073
812 lfun, 8932 eigenQcodon, 73080 P(t)
Time used: 1:15
Model 8: beta&w>1
TREE # 1
(1, (2, 3), ((4, 5), 6)); MP score: 165
initial w for M8:NSbetaw>1 reset.
0.048156 0.035758 0.027149 0.039449 0.054080 0.020425 0.102391 0.109677 0.380473 1.394155 0.900000 0.523761 1.873198 2.941449
ntime & nrate & np: 9 2 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 8.834310
np = 14
lnL0 = -1899.817206
Iterating by ming2
Initial: fx= 1899.817206
x= 0.04816 0.03576 0.02715 0.03945 0.05408 0.02042 0.10239 0.10968 0.38047 1.39415 0.90000 0.52376 1.87320 2.94145
1 h-m-p 0.0000 0.0004 317.1753 ++YCCCC 1885.754695 4 0.0003 42 | 0/14
2 h-m-p 0.0001 0.0004 120.6235 +YCCC 1883.837234 3 0.0003 79 | 0/14
3 h-m-p 0.0006 0.0082 49.7684 +CYCCC 1879.657619 4 0.0039 118 | 0/14
4 h-m-p 0.0004 0.0020 177.0054 CCCCC 1878.126632 4 0.0004 157 | 0/14
5 h-m-p 0.0006 0.0028 35.0320 YYC 1877.942886 2 0.0005 190 | 0/14
6 h-m-p 0.0009 0.0056 18.5548 YCC 1877.877897 2 0.0005 224 | 0/14
7 h-m-p 0.0007 0.0126 13.4274 YC 1877.859483 1 0.0003 256 | 0/14
8 h-m-p 0.0009 0.1008 5.1189 +CC 1877.816272 1 0.0037 290 | 0/14
9 h-m-p 0.0016 0.0366 11.6009 YC 1877.795277 1 0.0009 322 | 0/14
10 h-m-p 0.0019 0.0882 5.7389 +YCC 1877.739706 2 0.0057 357 | 0/14
11 h-m-p 0.0013 0.1242 24.9318 ++YYYC 1876.900242 3 0.0196 393 | 0/14
12 h-m-p 0.0085 0.0425 6.0202 YC 1876.887579 1 0.0015 425 | 0/14
13 h-m-p 0.0013 0.4113 7.0192 ++YCCC 1876.392688 3 0.0536 463 | 0/14
14 h-m-p 0.3072 1.5361 0.6526 CCCC 1876.077554 3 0.4054 500 | 0/14
15 h-m-p 0.9968 8.0000 0.2654 YCC 1875.953346 2 0.6679 534 | 0/14
16 h-m-p 1.0051 8.0000 0.1764 +YC 1875.864353 1 2.5640 567 | 0/14
17 h-m-p 1.3783 8.0000 0.3281 +YC 1875.679332 1 3.6430 600 | 0/14
18 h-m-p 1.5661 7.8307 0.7048 YC 1875.582368 1 0.9947 632 | 0/14
19 h-m-p 1.2126 8.0000 0.5782 CYC 1875.508067 2 1.4669 666 | 0/14
20 h-m-p 1.2284 8.0000 0.6905 +YC 1875.411272 1 3.3647 699 | 0/14
21 h-m-p 1.6000 8.0000 0.8774 CYC 1875.367830 2 1.7411 733 | 0/14
22 h-m-p 1.4541 8.0000 1.0506 YCC 1875.338851 2 2.4026 767 | 0/14
23 h-m-p 1.6000 8.0000 1.4002 CC 1875.321472 1 1.9384 800 | 0/14
24 h-m-p 1.6000 8.0000 1.3089 CYC 1875.313057 2 1.9144 834 | 0/14
25 h-m-p 1.5315 8.0000 1.6360 CC 1875.307102 1 1.9062 867 | 0/14
26 h-m-p 1.6000 8.0000 1.5362 C 1875.304488 0 1.6000 898 | 0/14
27 h-m-p 1.4020 8.0000 1.7531 CC 1875.303058 1 1.6213 931 | 0/14
28 h-m-p 1.6000 8.0000 1.1742 CY 1875.302209 1 2.0852 964 | 0/14
29 h-m-p 1.6000 8.0000 1.0671 CC 1875.301754 1 2.2495 997 | 0/14
30 h-m-p 1.6000 8.0000 0.5996 +YC 1875.301132 1 4.2063 1030 | 0/14
31 h-m-p 1.6000 8.0000 0.6000 +YC 1875.299847 1 4.2582 1063 | 0/14
32 h-m-p 1.6000 8.0000 0.5520 YC 1875.297889 1 3.4013 1095 | 0/14
33 h-m-p 0.8180 8.0000 2.2955 CC 1875.297326 1 1.3456 1128 | 0/14
34 h-m-p 1.6000 8.0000 1.3774 YY 1875.297197 1 1.1150 1160 | 0/14
35 h-m-p 1.6000 8.0000 0.2559 Y 1875.297186 0 0.9838 1191 | 0/14
36 h-m-p 1.6000 8.0000 0.0558 Y 1875.297185 0 0.8108 1222 | 0/14
37 h-m-p 1.6000 8.0000 0.0194 Y 1875.297185 0 0.7834 1253 | 0/14
38 h-m-p 1.6000 8.0000 0.0013 Y 1875.297185 0 1.0652 1284 | 0/14
39 h-m-p 1.6000 8.0000 0.0008 Y 1875.297185 0 1.6000 1315 | 0/14
40 h-m-p 1.2667 8.0000 0.0010 --Y 1875.297185 0 0.0198 1348 | 0/14
41 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/14
42 h-m-p 0.0160 8.0000 0.0001 -------------
Out..
lnL = -1875.297185
1436 lfun, 17232 eigenQcodon, 142164 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1882.651286 S = -1773.807866 -101.952109
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 158 patterns 2:10
did 20 / 158 patterns 2:11
did 30 / 158 patterns 2:11
did 40 / 158 patterns 2:11
did 50 / 158 patterns 2:11
did 60 / 158 patterns 2:11
did 70 / 158 patterns 2:12
did 80 / 158 patterns 2:12
did 90 / 158 patterns 2:12
did 100 / 158 patterns 2:12
did 110 / 158 patterns 2:12
did 120 / 158 patterns 2:13
did 130 / 158 patterns 2:13
did 140 / 158 patterns 2:13
did 150 / 158 patterns 2:13
did 158 / 158 patterns 2:13
Time used: 2:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=272
D_melanogaster_PGRP-LB-PD MGDKVSGSVSTSGPTSLAILMDSEQLEQQQLATSCGYSQHMQQANLGDGV
D_sechellia_PGRP-LB-PD MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
D_simulans_PGRP-LB-PD MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV
D_yakuba_PGRP-LB-PD MGDKVSGSVSTSSLTSPAILMDSEHWEQQQLATSCGYSQHMQQANLGDGV
D_erecta_PGRP-LB-PD MGDKVSGSVSTSGTTSPAILMNTEHLQQQQLATSWGYSQHMQQANLG---
D_elegans_PGRP-LB-PD MGDKASGSVSIPSTKPPAILTDSEHFEQQQLATTCGYSQHMQHANLGDGA
****.***** .. .. ** ::*: :******: *******:****
D_melanogaster_PGRP-LB-PD ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
D_sechellia_PGRP-LB-PD ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
D_simulans_PGRP-LB-PD ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPECMKSM
D_yakuba_PGRP-LB-PD ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVCYSTPECMKSM
D_erecta_PGRP-LB-PD -TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM
D_elegans_PGRP-LB-PD ATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVCYTTPDCMKSM
******************:**:**************.***:**:*****
D_melanogaster_PGRP-LB-PD RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
D_sechellia_PGRP-LB-PD RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
D_simulans_PGRP-LB-PD RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
D_yakuba_PGRP-LB-PD RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAHAPKYNDKSVG
D_erecta_PGRP-LB-PD RDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAHAPKYNDRSVG
D_elegans_PGRP-LB-PD RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG
*****************************:******:*********:***
D_melanogaster_PGRP-LB-PD IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
D_sechellia_PGRP-LB-PD IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
D_simulans_PGRP-LB-PD IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
D_yakuba_PGRP-LB-PD IVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLLGHRQVRDTEC
D_erecta_PGRP-LB-PD IVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLLGHRQVRDTEC
D_elegans_PGRP-LB-PD IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC
********************::**:*************************
D_melanogaster_PGRP-LB-PD PGGRLFAEISSWPHFTHINDTEGV-SSTTAPVVPHVHPQAAAP---QKPH
D_sechellia_PGRP-LB-PD PGGRLFAEISSWPHFTHLNASDGE-SSTAAPVVPHVHAQAAAP---QTPH
D_simulans_PGRP-LB-PD PGGRLFAEISSWPHFTHLNATEGV-SSTAAPVVPHVHAQAAAP---QTPH
D_yakuba_PGRP-LB-PD PGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKAATQ---TPLA
D_erecta_PGRP-LB-PD PGGRLFAEISSWPHFTHINDTEGV-SSTKAPVEPHVHPQAATQ---QTPP
D_elegans_PGRP-LB-PD PGGRLFAEISGWPHFTHLNATEGS---TPVPIEPHAHPQAASQTPPQSPP
**********.******:. ::* * .*: **.*.:**:
D_melanogaster_PGRP-LB-PD QSPP----AAPKVooooo----
D_sechellia_PGRP-LB-PD QSPP----AAPKVooooo----
D_simulans_PGRP-LB-PD QSPP----AAPKVooooo----
D_yakuba_PGRP-LB-PD QSPP----AAPKVoooo-----
D_erecta_PGRP-LB-PD KSPP----AAPKVooooooooo
D_elegans_PGRP-LB-PD QSPPHAPAAAPKV---------
:*** *****
>D_melanogaster_PGRP-LB-PD ATGGGCGACAAGGTGTCTGGATCCGTCTCCACTTCTGGCCCAACTTCCTT GGCAATCCTCATGGACTCGGAGCAATTGGAGCAGCAACAGCTGGCCACAA GTTGTGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGCGACGGTGTG GCCACCGCCCGCCTGCTGTCCCGATCCGACTGGGGTGCCCGGCTGCCCAA GTCCGTGGAGCACTTCCAGGGTCCCGCGCCCTACGTCATCATCCATCACT CGTACATGCCGGCCGTGTGCTACTCCACTCCGGACTGCATGAAGAGCATG CGGGACATGCAGGACTTCCATCAGCTGGAGCGCGGATGGAACGATATTGG TTATAGCTTTGGCATCGGCGGCGATGGCATGATTTACACCGGCAGGGGAT TCAATGTCATCGGAGCTCATGCACCCAAGTACAATGACAAGAGCGTGGGC ATTGTGCTGATCGGAGATTGGAGAACCGAACTGCCGCCCAAGCAGATGCT GGATGCGGCCAAGAACCTGATCGCCTTTGGCGTTTTCAAGGGCTACATTG ACCCTGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT CCTGGCGGCCGCCTGTTCGCCGAGATCTCCAGCTGGCCGCACTTTACCCA CATAAACGACACCGAAGGCGTC---AGCAGCACCACGGCGCCCGTCGTGC CCCACGTCCATCCACAGGCGGCAGCACCA---------CAAAAGCCGCAC CAATCCCCGCCA------------GCTGCGCCCAAGGTC----------- ---------------- >D_sechellia_PGRP-LB-PD ATGGGCGACAAGGTGTCTGGATCCGTCTCCACTTCTAGCACAACTTCCTC GGCAATCCCCATGGACTCGGAGCAATTGGAGCAGCAACAGCTGGCCACAA GTTGTGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGCGACGGTGTG GCCACCGCCCGCCTGCTTTCCCGATCCGACTGGGGTGCCCGGCTGCCCAA GTCTGTGGACCACTTCCAGGGACCCGCGCCCTACGTCATCATCCACCACT CGTACATGCCGGCCGTGTGCTACTCCACTCCGGAATGCATGAAGAGCATG CGGGACATGCAGGACTTCCATCAGCTGGAGCGCGGATGGAACGATATTGG TTATAGCTTTGGCATCGGCGGCGATGGCATGATCTACACCGGCAGGGGAT TCAATGTCATCGGAGCTCATGCACCCAAGTACAATGACAAGAGCGTGGGC ATCGTGCTGATCGGAGATTGGAGAACCGAACTGCCGCCCAAGCAGATGCT GGATGCGGCCAAGAACCTGATCGCCTTCGGAGTTTTCAAGGGCTACATTG ACCCCGCCTACAAACTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT CCTGGAGGCCGCCTCTTCGCCGAGATCTCCAGCTGGCCGCACTTTACCCA CCTAAACGCCAGCGACGGCGAG---AGCAGCACTGCGGCGCCCGTCGTGC CCCATGTCCATGCACAGGCGGCAGCACCA---------CAAACGCCGCAC CAATCCCCGCCA------------GCTGCGCCCAAGGTC----------- ---------------- >D_simulans_PGRP-LB-PD ATGGGCGACAAGGTGTCTGGATCCGTCTCCACTTCTAGCACAACTTCCTC GGCAATCCCCATGGACTCGGAGCAATTGGAGCAGCAACAGCTGGCCACAA GTTGTGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGCGACGGTGTG GCCACCGCCCGCCTGCTTTCCCGATCCGACTGGGGTGCACGGCTGCCCAA GTCCGTGGAGCACTTCCAGGGACCAGCGCCTTACGTCATCATCCACCACT CGTATATGCCGGCCGTGTGCTACTCAACTCCGGAATGCATGAAGAGCATG CGGGACATGCAGGACTTTCATCAGCTGGAGCGCGGATGGAACGATATTGG TTATAGCTTTGGCATCGGCGGCGATGGCATGATCTACACCGGCAGGGGAT TCAATGTCATCGGAGCTCATGCACCGAAGTACAATGACAAGAGCGTGGGC ATTGTGCTGATCGGAGATTGGAGAACCGAACTGCCGCCCAAGCAGATGCT GGATGCGGCCAAGAACCTGATCGCCTTCGGCGTTTTCAAGGGCTACATTG ACCCCGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT CCTGGCGGCCGCCTCTTCGCCGAGATCTCCAGCTGGCCGCACTTTACCCA CCTAAACGCCACCGAAGGCGTG---AGCAGCACTGCGGCGCCCGTCGTGC CCCATGTCCATGCACAGGCGGCAGCACCA---------CAAACGCCGCAC CAATCCCCGCCA------------GCTGCGCCCAAGGTC----------- ---------------- >D_yakuba_PGRP-LB-PD ATGGGCGACAAGGTGTCTGGATCCGTATCCACTTCTAGCTTAACTTCCCC GGCAATCCTCATGGACTCGGAGCATTGGGAGCAGCAACAGCTGGCCACAA GTTGTGGCTATAGTCAGCACATGCAGCAGGCAAATCTGGGCGATGGTGTG GCCACCGCCCGACTGCTGTCCAGATCCGACTGGGGTGCCCGGCTGCCCAA GTCCGTGGACCACTTTCAGGGACCCGCGCCCTACGTCATCATCCACCACT CGTACATGCCAGGCGTGTGCTACTCCACTCCGGAGTGCATGAAGAGCATG CGGGACATGCAGGACTTCCACCAGCTGGAGCGCGGATGGAACGATATCGG ATATAGCTTTGGCATCGGCGGCGATGGCATGATCTACACCGGCAGGGGAT TCAATGTCGTCGGAGCTCATGCGCCGAAGTACAATGACAAGAGCGTGGGC ATCGTGCTGATCGGAGATTGGAGAACTGAACTGCCGCCCAAGCAGATGCT GGATGCGGCCAGGAACCTGATCTCCTTCGGGGTGTTCAAGGGCTACATTG ACCCCGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT CCTGGAGGCCGCCTGTTTGCCGAGATCTCCAGCTGGCCGCACTTTACCCA CCTAAGCGAAACCGAAGGCGTAGTTAGCAGCACTGCTGCGCCCGTCGAGC CCCACGTCCATCCAAAGGCGGCAACACAA---------ACGCCACTCGCC CAATCCCCGCCA------------GCTGCGCCCAAGGTC----------- ---------------- >D_erecta_PGRP-LB-PD ATGGGCGACAAGGTGTCTGGATCCGTATCCACTTCTGGCACAACTTCCCC GGCAATTCTTATGAACACAGAGCATTTGCAGCAGCAACAGCTGGCCACAA GTTGGGGCTATAGTCAGCACATGCAGCAGGCGAATCTGGGC--------- ---ACCGCCCGGCTTCTGTCCCGATCCGACTGGGGTGCCCGCCTGCCCAA GTCCGTGGAGCACTTTCAAGGACCCGCGCCCTACGTGATCATCCACCACT CGTACATGCCAGCCGTGTGCTACTCCACTCCGGACTGCATGAAGAGCATG CGGGACATGCAGGACTTCCACCAGCTGGAGCGCGGTTGGAACGATATCGG ATATAGCTTTGGCATCGGCGGCGATGGCATGATCTACGCAGGCAGGGGAT TCAATGTCATCGGAGCTCATGCGCCGAAGTACAATGACAGGAGCGTGGGC ATCGTGCTGATCGGAGATTGGAGAACTGAACTTCCGCCCAAGCAGATGCT GGATGCGGCCAAGGACCTGATCGCCTTCGGGGTGTTCAAGGGCTACATTG ACCCCGCCTACAAGCTGCTGGGCCACCGACAGGTGCGGGATACCGAGTGT CCTGGGGGCCGCCTGTTTGCCGAGATCTCCAGCTGGCCGCACTTTACCCA CATAAACGACACCGAAGGCGTT---AGCAGTACGAAGGCGCCGGTCGAGC CCCACGTCCATCCACAGGCGGCAACACAA---------CAAACGCCGCCC AAATCCCCGCCA------------GCTGCGCCCAAGGTC----------- ---------------- >D_elegans_PGRP-LB-PD ATGGGCGACAAAGCGTCTGGATCCGTCTCCATTCCCTCGACAAAACCCCC AGCAATCCTCACGGACTCGGAGCATTTCGAGCAACAACAGCTGGCCACAA CTTGTGGCTATAGCCAGCACATGCAGCATGCGAATTTGGGCGATGGAGCG GCCACCGCTCGACTTCTGTCCCGCTCCGACTGGGGCGCCCGTCTGCCCAA GTCCGTGGAGCACTTCGAGGGTCCCGCCCCCTACGTGATCATCCACCACT CTTACATGCCGGCGGTGTGCTATACCACTCCCGACTGCATGAAGAGCATG CGCGACATGCAGGACTTCCACCAGCTGGAGCGCGGTTGGAACGACATCGG CTATAGCTTCGGCATCGGCGGCGATGGCATGATCTACACCGGAAGGGGAT TCAACGTTATCGGAGCTCATGCACCCAAGTACAATGACAAGAGCGTGGGC ATCGTGCTGATCGGAGATTGGAGAACTGAACTGCCGCCCAAACAGATGCT GGACGCGGCCAAAAACCTGATCGCCTTCGGCGTGTTCAAGGGCTACATTG ACCCCGCATACAAGCTGCTGGGCCACCGACAGGTTCGTGACACCGAGTGT CCCGGAGGCAGGCTGTTCGCGGAGATCTCCGGCTGGCCGCACTTTACCCA CCTAAACGCCACCGAAGGCAGC---------ACCCCCGTCCCCATTGAAC CGCACGCACATCCCCAGGCGGCGTCCCAAACGCCACCCCAATCACCACCC CAATCGCCACCCCATGCCCCGGCAGCTGCGCCCAAGGTC----------- ----------------
>D_melanogaster_PGRP-LB-PD MGDKVSGSVSTSGPTSLAILMDSEQLEQQQLATSCGYSQHMQQANLGDGV ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC PGGRLFAEISSWPHFTHINDTEGV-SSTTAPVVPHVHPQAAAP---QKPH QSPP----AAPKV >D_sechellia_PGRP-LB-PD MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVCYSTPECMKSM RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC PGGRLFAEISSWPHFTHLNASDGE-SSTAAPVVPHVHAQAAAP---QTPH QSPP----AAPKV >D_simulans_PGRP-LB-PD MGDKVSGSVSTSSTTSSAIPMDSEQLEQQQLATSCGYSQHMQQANLGDGV ATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPECMKSM RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC PGGRLFAEISSWPHFTHLNATEGV-SSTAAPVVPHVHAQAAAP---QTPH QSPP----AAPKV >D_yakuba_PGRP-LB-PD MGDKVSGSVSTSSLTSPAILMDSEHWEQQQLATSCGYSQHMQQANLGDGV ATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVCYSTPECMKSM RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAHAPKYNDKSVG IVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLLGHRQVRDTEC PGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKAATQ---TPLA QSPP----AAPKV >D_erecta_PGRP-LB-PD MGDKVSGSVSTSGTTSPAILMNTEHLQQQQLATSWGYSQHMQQANLG--- -TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSM RDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAHAPKYNDRSVG IVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLLGHRQVRDTEC PGGRLFAEISSWPHFTHINDTEGV-SSTKAPVEPHVHPQAATQ---QTPP KSPP----AAPKV >D_elegans_PGRP-LB-PD MGDKASGSVSIPSTKPPAILTDSEHFEQQQLATTCGYSQHMQHANLGDGA ATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVCYTTPDCMKSM RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVG IVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTEC PGGRLFAEISGWPHFTHLNATEGS---TPVPIEPHAHPQAASQTPPQSPP QSPPHAPAAAPKV
#NEXUS
[ID: 6872989632]
begin taxa;
dimensions ntax=6;
taxlabels
D_melanogaster_PGRP-LB-PD
D_sechellia_PGRP-LB-PD
D_simulans_PGRP-LB-PD
D_yakuba_PGRP-LB-PD
D_erecta_PGRP-LB-PD
D_elegans_PGRP-LB-PD
;
end;
begin trees;
translate
1 D_melanogaster_PGRP-LB-PD,
2 D_sechellia_PGRP-LB-PD,
3 D_simulans_PGRP-LB-PD,
4 D_yakuba_PGRP-LB-PD,
5 D_erecta_PGRP-LB-PD,
6 D_elegans_PGRP-LB-PD
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02060544,(2:0.01536452,3:0.01338276)1.000:0.01710754,((4:0.04942888,5:0.05104585)0.859:0.01548197,6:0.2064013)0.998:0.028918);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02060544,(2:0.01536452,3:0.01338276):0.01710754,((4:0.04942888,5:0.05104585):0.01548197,6:0.2064013):0.028918);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2033.31 -2046.73
2 -2033.25 -2044.44
--------------------------------------
TOTAL -2033.28 -2046.14
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.429569 0.003279 0.325417 0.541663 0.423086 1388.67 1395.10 1.000
r(A<->C){all} 0.171477 0.001170 0.109790 0.240236 0.168847 776.49 1050.29 1.000
r(A<->G){all} 0.207973 0.001728 0.128421 0.288264 0.206254 641.06 882.34 1.000
r(A<->T){all} 0.132867 0.001639 0.055534 0.208155 0.130260 594.80 629.49 1.000
r(C<->G){all} 0.094964 0.000504 0.053544 0.141198 0.093294 770.33 941.45 1.000
r(C<->T){all} 0.287521 0.002089 0.203535 0.381699 0.286065 927.65 1013.66 1.000
r(G<->T){all} 0.105198 0.000923 0.049269 0.163644 0.103085 944.19 1014.89 1.000
pi(A){all} 0.214895 0.000187 0.188397 0.241696 0.214912 1291.03 1329.28 1.000
pi(C){all} 0.333231 0.000244 0.302095 0.362482 0.333285 1132.69 1185.57 1.001
pi(G){all} 0.275918 0.000229 0.244622 0.303762 0.275400 1070.95 1136.05 1.000
pi(T){all} 0.175956 0.000160 0.152789 0.201718 0.175528 1248.39 1297.34 1.000
alpha{1,2} 0.126714 0.004481 0.000208 0.231717 0.128822 1043.93 1068.19 1.000
alpha{3} 1.886459 0.579474 0.681053 3.407272 1.748901 1128.70 1251.37 1.001
pinvar{all} 0.191412 0.012988 0.000006 0.390345 0.184523 1055.21 1135.54 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/346/PGRP-LB-PD/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 249
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 2 3 4 4 1 | Ser TCT 2 3 2 2 2 2 | Tyr TAT 2 2 3 2 2 3 | Cys TGT 2 2 2 2 1 2
TTC 5 6 5 4 4 8 | TCC 9 8 8 10 9 7 | TAC 7 7 6 7 7 6 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 1 0 0 | TCA 0 0 1 0 0 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 1 1 0 1 1 | TCG 2 3 3 2 1 3 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 5 5 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 1 1 0 3 1 | Pro CCT 2 1 2 1 1 0 | His CAT 4 4 4 3 3 4 | Arg CGT 0 0 0 0 0 2
CTC 1 1 1 2 0 1 | CCC 8 10 7 8 8 16 | CAC 8 8 8 9 9 9 | CGC 3 3 3 2 3 3
CTA 0 1 1 1 0 1 | CCA 4 2 3 4 3 3 | Gln CAA 4 4 4 3 4 5 | CGA 2 2 2 2 2 2
CTG 13 11 11 13 11 11 | CCG 6 6 7 6 8 4 | CAG 11 11 11 10 11 8 | CGG 3 3 3 3 3 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 2 3 1 2 3 | Thr ACT 3 4 4 5 4 3 | Asn AAT 3 3 3 3 3 2 | Ser AGT 2 2 2 2 2 0
ATC 8 10 9 10 10 11 | ACC 7 5 6 5 4 7 | AAC 3 3 3 2 3 4 | AGC 4 6 5 6 4 5
ATA 1 0 0 0 1 0 | ACA 1 2 2 2 4 2 | Lys AAA 0 1 0 0 1 4 | Arg AGA 1 1 1 2 1 1
Met ATG 9 9 9 9 9 8 | ACG 1 1 1 1 2 1 | AAG 11 9 10 10 10 7 | AGG 1 1 1 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 0 1 2 | Ala GCT 2 2 2 3 2 3 | Asp GAT 5 5 5 5 5 2 | Gly GGT 3 2 2 1 2 2
GTC 7 6 6 6 4 3 | GCC 8 9 8 7 8 6 | GAC 9 9 7 8 9 11 | GGC 16 13 15 14 14 16
GTA 0 0 0 2 1 0 | GCA 4 5 6 3 3 4 | Glu GAA 2 2 3 3 2 3 | GGA 5 8 6 8 6 6
GTG 7 7 8 7 8 6 | GCG 6 7 7 6 7 8 | GAG 6 6 6 7 6 7 | GGG 0 0 0 1 2 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_PGRP-LB-PD
position 1: T:0.16064 C:0.27711 A:0.23695 G:0.32530
position 2: T:0.24498 C:0.26104 A:0.30120 G:0.19277
position 3: T:0.15261 C:0.42169 A:0.09639 G:0.32932
Average T:0.18608 C:0.31995 A:0.21151 G:0.28246
#2: D_sechellia_PGRP-LB-PD
position 1: T:0.16064 C:0.27309 A:0.23695 G:0.32932
position 2: T:0.23293 C:0.27309 A:0.29719 G:0.19679
position 3: T:0.14458 C:0.42570 A:0.11245 G:0.31727
Average T:0.17938 C:0.32396 A:0.21553 G:0.28112
#3: D_simulans_PGRP-LB-PD
position 1: T:0.16064 C:0.27309 A:0.23695 G:0.32932
position 2: T:0.23695 C:0.27711 A:0.29317 G:0.19277
position 3: T:0.15663 C:0.39759 A:0.11647 G:0.32932
Average T:0.18474 C:0.31593 A:0.21553 G:0.28380
#4: D_yakuba_PGRP-LB-PD
position 1: T:0.16466 C:0.26908 A:0.24096 G:0.32530
position 2: T:0.24096 C:0.26104 A:0.28916 G:0.20884
position 3: T:0.13655 C:0.40964 A:0.12450 G:0.32932
Average T:0.18072 C:0.31325 A:0.21821 G:0.28782
#5: D_erecta_PGRP-LB-PD
position 1: T:0.15261 C:0.27711 A:0.24900 G:0.32129
position 2: T:0.23695 C:0.26506 A:0.30120 G:0.19679
position 3: T:0.14859 C:0.39357 A:0.11245 G:0.34538
Average T:0.17938 C:0.31191 A:0.22088 G:0.28782
#6: D_elegans_PGRP-LB-PD
position 1: T:0.16064 C:0.28112 A:0.24096 G:0.31727
position 2: T:0.22892 C:0.28112 A:0.30120 G:0.18876
position 3: T:0.12851 C:0.46185 A:0.12851 G:0.28112
Average T:0.17269 C:0.34137 A:0.22356 G:0.26238
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 17 | Ser S TCT 13 | Tyr Y TAT 14 | Cys C TGT 11
TTC 32 | TCC 51 | TAC 40 | TGC 12
Leu L TTA 1 | TCA 2 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 14 | TAG 0 | Trp W TGG 26
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 7 | His H CAT 22 | Arg R CGT 2
CTC 6 | CCC 57 | CAC 51 | CGC 17
CTA 4 | CCA 19 | Gln Q CAA 24 | CGA 12
CTG 70 | CCG 37 | CAG 62 | CGG 15
------------------------------------------------------------------------------
Ile I ATT 15 | Thr T ACT 23 | Asn N AAT 17 | Ser S AGT 10
ATC 58 | ACC 34 | AAC 18 | AGC 30
ATA 2 | ACA 13 | Lys K AAA 6 | Arg R AGA 7
Met M ATG 53 | ACG 7 | AAG 57 | AGG 9
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 14 | Asp D GAT 27 | Gly G GGT 12
GTC 32 | GCC 46 | GAC 53 | GGC 88
GTA 3 | GCA 25 | Glu E GAA 15 | GGA 39
GTG 43 | GCG 41 | GAG 38 | GGG 3
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15997 C:0.27510 A:0.24029 G:0.32463
position 2: T:0.23695 C:0.26975 A:0.29719 G:0.19612
position 3: T:0.14458 C:0.41834 A:0.11513 G:0.32195
Average T:0.18050 C:0.32106 A:0.21754 G:0.28090
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_PGRP-LB-PD
D_sechellia_PGRP-LB-PD 0.3062 (0.0260 0.0850)
D_simulans_PGRP-LB-PD 0.1783 (0.0179 0.1003) 0.1023 (0.0071 0.0694)
D_yakuba_PGRP-LB-PD 0.2731 (0.0493 0.1804) 0.2962 (0.0483 0.1631) 0.2260 (0.0446 0.1974)
D_erecta_PGRP-LB-PD 0.1473 (0.0315 0.2140) 0.2419 (0.0482 0.1995) 0.1721 (0.0399 0.2317) 0.4376 (0.0540 0.1233)
D_elegans_PGRP-LB-PD 0.1329 (0.0609 0.4586) 0.1397 (0.0660 0.4727) 0.1109 (0.0597 0.5386) 0.1726 (0.0778 0.4505) 0.1287 (0.0647 0.5027)
Model 0: one-ratio
TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 165
lnL(ntime: 9 np: 11): -1896.251769 +0.000000
7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6
0.054024 0.037073 0.035716 0.031644 0.065051 0.024930 0.113958 0.114555 0.388262 1.378611 0.135139
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.86521
(1: 0.054024, (2: 0.035716, 3: 0.031644): 0.037073, ((4: 0.113958, 5: 0.114555): 0.024930, 6: 0.388262): 0.065051);
(D_melanogaster_PGRP-LB-PD: 0.054024, (D_sechellia_PGRP-LB-PD: 0.035716, D_simulans_PGRP-LB-PD: 0.031644): 0.037073, ((D_yakuba_PGRP-LB-PD: 0.113958, D_erecta_PGRP-LB-PD: 0.114555): 0.024930, D_elegans_PGRP-LB-PD: 0.388262): 0.065051);
Detailed output identifying parameters
kappa (ts/tv) = 1.37861
omega (dN/dS) = 0.13514
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.054 593.0 154.0 0.1351 0.0078 0.0575 4.6 8.8
7..8 0.037 593.0 154.0 0.1351 0.0053 0.0394 3.2 6.1
8..2 0.036 593.0 154.0 0.1351 0.0051 0.0380 3.0 5.8
8..3 0.032 593.0 154.0 0.1351 0.0045 0.0337 2.7 5.2
7..9 0.065 593.0 154.0 0.1351 0.0093 0.0692 5.5 10.7
9..10 0.025 593.0 154.0 0.1351 0.0036 0.0265 2.1 4.1
10..4 0.114 593.0 154.0 0.1351 0.0164 0.1212 9.7 18.7
10..5 0.115 593.0 154.0 0.1351 0.0165 0.1218 9.8 18.8
9..6 0.388 593.0 154.0 0.1351 0.0558 0.4129 33.1 63.6
tree length for dN: 0.1244
tree length for dS: 0.9202
Time used: 0:02
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 165
check convergence..
lnL(ntime: 9 np: 12): -1876.238336 +0.000000
7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6
0.057936 0.036939 0.037054 0.033246 0.068476 0.027882 0.119094 0.121961 0.429487 1.400384 0.901064 0.059370
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.93207
(1: 0.057936, (2: 0.037054, 3: 0.033246): 0.036939, ((4: 0.119094, 5: 0.121961): 0.027882, 6: 0.429487): 0.068476);
(D_melanogaster_PGRP-LB-PD: 0.057936, (D_sechellia_PGRP-LB-PD: 0.037054, D_simulans_PGRP-LB-PD: 0.033246): 0.036939, ((D_yakuba_PGRP-LB-PD: 0.119094, D_erecta_PGRP-LB-PD: 0.121961): 0.027882, D_elegans_PGRP-LB-PD: 0.429487): 0.068476);
Detailed output identifying parameters
kappa (ts/tv) = 1.40038
dN/dS (w) for site classes (K=2)
p: 0.90106 0.09894
w: 0.05937 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.058 592.8 154.2 0.1524 0.0090 0.0590 5.3 9.1
7..8 0.037 592.8 154.2 0.1524 0.0057 0.0376 3.4 5.8
8..2 0.037 592.8 154.2 0.1524 0.0058 0.0377 3.4 5.8
8..3 0.033 592.8 154.2 0.1524 0.0052 0.0338 3.1 5.2
7..9 0.068 592.8 154.2 0.1524 0.0106 0.0697 6.3 10.8
9..10 0.028 592.8 154.2 0.1524 0.0043 0.0284 2.6 4.4
10..4 0.119 592.8 154.2 0.1524 0.0185 0.1212 11.0 18.7
10..5 0.122 592.8 154.2 0.1524 0.0189 0.1242 11.2 19.1
9..6 0.429 592.8 154.2 0.1524 0.0667 0.4372 39.5 67.4
Time used: 0:08
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 165
lnL(ntime: 9 np: 14): -1875.321254 +0.000000
7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6
0.059331 0.036996 0.037474 0.033913 0.070223 0.029528 0.121490 0.125232 0.445331 1.432747 0.934898 0.000000 0.073338 1.696606
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.95952
(1: 0.059331, (2: 0.037474, 3: 0.033913): 0.036996, ((4: 0.121490, 5: 0.125232): 0.029528, 6: 0.445331): 0.070223);
(D_melanogaster_PGRP-LB-PD: 0.059331, (D_sechellia_PGRP-LB-PD: 0.037474, D_simulans_PGRP-LB-PD: 0.033913): 0.036996, ((D_yakuba_PGRP-LB-PD: 0.121490, D_erecta_PGRP-LB-PD: 0.125232): 0.029528, D_elegans_PGRP-LB-PD: 0.445331): 0.070223);
Detailed output identifying parameters
kappa (ts/tv) = 1.43275
dN/dS (w) for site classes (K=3)
p: 0.93490 0.00000 0.06510
w: 0.07334 1.00000 1.69661
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.059 592.4 154.6 0.1790 0.0101 0.0567 6.0 8.8
7..8 0.037 592.4 154.6 0.1790 0.0063 0.0353 3.7 5.5
8..2 0.037 592.4 154.6 0.1790 0.0064 0.0358 3.8 5.5
8..3 0.034 592.4 154.6 0.1790 0.0058 0.0324 3.4 5.0
7..9 0.070 592.4 154.6 0.1790 0.0120 0.0671 7.1 10.4
9..10 0.030 592.4 154.6 0.1790 0.0051 0.0282 3.0 4.4
10..4 0.121 592.4 154.6 0.1790 0.0208 0.1161 12.3 17.9
10..5 0.125 592.4 154.6 0.1790 0.0214 0.1196 12.7 18.5
9..6 0.445 592.4 154.6 0.1790 0.0762 0.4255 45.1 65.8
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PD)
Pr(w>1) post mean +- SE for w
13 G 0.999** 1.695
14 P 0.997** 1.691
15 T 0.511 0.903
17 L 0.793 1.361
26 L 0.762 1.310
214 I 0.934 1.589
216 D 0.950 1.615
220 V 0.985* 1.672
222 T 0.999** 1.695
235 A 0.893 1.523
237 Q 0.835 1.428
238 K 0.992** 1.684
240 H 0.533 0.938
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PD)
Pr(w>1) post mean +- SE for w
13 G 0.672 1.802 +- 0.949
14 P 0.739 1.997 +- 1.183
214 I 0.594 1.709 +- 1.025
220 V 0.561 1.648 +- 0.920
222 T 0.720 1.960 +- 1.162
235 A 0.528 1.588 +- 0.985
238 K 0.635 1.774 +- 0.990
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.536 0.299 0.099 0.034 0.014 0.007 0.004 0.003 0.002 0.002
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.180
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.009 0.292 0.519
sum of density on p0-p1 = 1.000000
Time used: 0:29
Model 3: discrete (3 categories)
TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 165
lnL(ntime: 9 np: 15): -1875.288646 +0.000000
7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6
0.059247 0.037168 0.037508 0.033917 0.070672 0.029377 0.121856 0.125342 0.446136 1.428967 0.212564 0.728124 0.000001 0.100340 1.801516
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.96122
(1: 0.059247, (2: 0.037508, 3: 0.033917): 0.037168, ((4: 0.121856, 5: 0.125342): 0.029377, 6: 0.446136): 0.070672);
(D_melanogaster_PGRP-LB-PD: 0.059247, (D_sechellia_PGRP-LB-PD: 0.037508, D_simulans_PGRP-LB-PD: 0.033917): 0.037168, ((D_yakuba_PGRP-LB-PD: 0.121856, D_erecta_PGRP-LB-PD: 0.125342): 0.029377, D_elegans_PGRP-LB-PD: 0.446136): 0.070672);
Detailed output identifying parameters
kappa (ts/tv) = 1.42897
dN/dS (w) for site classes (K=3)
p: 0.21256 0.72812 0.05931
w: 0.00000 0.10034 1.80152
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.059 592.5 154.5 0.1799 0.0102 0.0565 6.0 8.7
7..8 0.037 592.5 154.5 0.1799 0.0064 0.0354 3.8 5.5
8..2 0.038 592.5 154.5 0.1799 0.0064 0.0358 3.8 5.5
8..3 0.034 592.5 154.5 0.1799 0.0058 0.0323 3.4 5.0
7..9 0.071 592.5 154.5 0.1799 0.0121 0.0674 7.2 10.4
9..10 0.029 592.5 154.5 0.1799 0.0050 0.0280 3.0 4.3
10..4 0.122 592.5 154.5 0.1799 0.0209 0.1162 12.4 18.0
10..5 0.125 592.5 154.5 0.1799 0.0215 0.1195 12.7 18.5
9..6 0.446 592.5 154.5 0.1799 0.0765 0.4254 45.3 65.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PD)
Pr(w>1) post mean +- SE for w
13 G 0.998** 1.798
14 P 0.993** 1.790
17 L 0.712 1.312
26 L 0.670 1.240
214 I 0.904 1.639
216 D 0.902 1.634
220 V 0.970* 1.750
222 T 0.998** 1.798
235 A 0.847 1.541
237 Q 0.765 1.402
238 K 0.984* 1.775
Time used: 0:46
Model 7: beta (10 categories)
TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 165
lnL(ntime: 9 np: 12): -1878.591073 +0.000000
7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6
0.057003 0.037208 0.036791 0.033018 0.067284 0.027823 0.118314 0.120468 0.421591 1.394155 0.158541 0.850896
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.91950
(1: 0.057003, (2: 0.036791, 3: 0.033018): 0.037208, ((4: 0.118314, 5: 0.120468): 0.027823, 6: 0.421591): 0.067284);
(D_melanogaster_PGRP-LB-PD: 0.057003, (D_sechellia_PGRP-LB-PD: 0.036791, D_simulans_PGRP-LB-PD: 0.033018): 0.037208, ((D_yakuba_PGRP-LB-PD: 0.118314, D_erecta_PGRP-LB-PD: 0.120468): 0.027823, D_elegans_PGRP-LB-PD: 0.421591): 0.067284);
Detailed output identifying parameters
kappa (ts/tv) = 1.39415
Parameters in M7 (beta):
p = 0.15854 q = 0.85090
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00001 0.00020 0.00170 0.00829 0.02933 0.08352 0.20253 0.42997 0.79820
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.057 592.8 154.2 0.1554 0.0090 0.0576 5.3 8.9
7..8 0.037 592.8 154.2 0.1554 0.0058 0.0376 3.5 5.8
8..2 0.037 592.8 154.2 0.1554 0.0058 0.0372 3.4 5.7
8..3 0.033 592.8 154.2 0.1554 0.0052 0.0334 3.1 5.1
7..9 0.067 592.8 154.2 0.1554 0.0106 0.0680 6.3 10.5
9..10 0.028 592.8 154.2 0.1554 0.0044 0.0281 2.6 4.3
10..4 0.118 592.8 154.2 0.1554 0.0186 0.1196 11.0 18.4
10..5 0.120 592.8 154.2 0.1554 0.0189 0.1218 11.2 18.8
9..6 0.422 592.8 154.2 0.1554 0.0662 0.4263 39.3 65.7
Time used: 1:15
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 165
check convergence..
lnL(ntime: 9 np: 14): -1875.297185 +0.000000
7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6
0.059259 0.037149 0.037503 0.033919 0.070607 0.029407 0.121800 0.125330 0.446000 1.429509 0.940460 2.466116 28.912119 1.793445
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.96097
(1: 0.059259, (2: 0.037503, 3: 0.033919): 0.037149, ((4: 0.121800, 5: 0.125330): 0.029407, 6: 0.446000): 0.070607);
(D_melanogaster_PGRP-LB-PD: 0.059259, (D_sechellia_PGRP-LB-PD: 0.037503, D_simulans_PGRP-LB-PD: 0.033919): 0.037149, ((D_yakuba_PGRP-LB-PD: 0.121800, D_erecta_PGRP-LB-PD: 0.125330): 0.029407, D_elegans_PGRP-LB-PD: 0.446000): 0.070607);
Detailed output identifying parameters
kappa (ts/tv) = 1.42951
Parameters in M8 (beta&w>1):
p0 = 0.94046 p = 2.46612 q = 28.91212
(p1 = 0.05954) w = 1.79345
dN/dS (w) for site classes (K=11)
p: 0.09405 0.09405 0.09405 0.09405 0.09405 0.09405 0.09405 0.09405 0.09405 0.09405 0.05954
w: 0.01862 0.03236 0.04328 0.05362 0.06418 0.07557 0.08858 0.10452 0.12663 0.16895 1.79345
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.059 592.5 154.5 0.1798 0.0102 0.0565 6.0 8.7
7..8 0.037 592.5 154.5 0.1798 0.0064 0.0354 3.8 5.5
8..2 0.038 592.5 154.5 0.1798 0.0064 0.0358 3.8 5.5
8..3 0.034 592.5 154.5 0.1798 0.0058 0.0324 3.4 5.0
7..9 0.071 592.5 154.5 0.1798 0.0121 0.0673 7.2 10.4
9..10 0.029 592.5 154.5 0.1798 0.0050 0.0280 3.0 4.3
10..4 0.122 592.5 154.5 0.1798 0.0209 0.1162 12.4 18.0
10..5 0.125 592.5 154.5 0.1798 0.0215 0.1195 12.7 18.5
9..6 0.446 592.5 154.5 0.1798 0.0765 0.4254 45.3 65.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PD)
Pr(w>1) post mean +- SE for w
13 G 0.997** 1.789
14 P 0.992** 1.780
17 L 0.716 1.318
26 L 0.675 1.248
214 I 0.904 1.633
216 D 0.891 1.613
220 V 0.965* 1.735
222 T 0.997** 1.789
235 A 0.847 1.538
237 Q 0.767 1.404
238 K 0.981* 1.763
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PD)
Pr(w>1) post mean +- SE for w
13 G 0.889 2.075 +- 0.921
14 P 0.903 2.119 +- 0.948
214 I 0.737 1.815 +- 1.064
216 D 0.542 1.414 +- 0.965
220 V 0.746 1.822 +- 1.005
222 T 0.904 2.119 +- 0.939
235 A 0.647 1.635 +- 1.084
237 Q 0.512 1.331 +- 1.005
238 K 0.828 1.979 +- 0.981
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.999
p : 0.995 0.005 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.012 0.058 0.123 0.177 0.206 0.214 0.210
ws: 0.451 0.405 0.109 0.025 0.006 0.002 0.001 0.000 0.000 0.000
Time used: 2:13
Model 1: NearlyNeutral -1876.238336
Model 2: PositiveSelection -1875.321254
Model 0: one-ratio -1896.251769
Model 3: discrete -1875.288646
Model 7: beta -1878.591073
Model 8: beta&w>1 -1875.297185
Model 0 vs 1 40.026866000000155
Model 2 vs 1 1.8341639999998733
Model 8 vs 7 6.587776000000304
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PD)
Pr(w>1) post mean +- SE for w
13 G 0.997** 1.789
14 P 0.992** 1.780
17 L 0.716 1.318
26 L 0.675 1.248
214 I 0.904 1.633
216 D 0.891 1.613
220 V 0.965* 1.735
222 T 0.997** 1.789
235 A 0.847 1.538
237 Q 0.767 1.404
238 K 0.981* 1.763
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PD)
Pr(w>1) post mean +- SE for w
13 G 0.889 2.075 +- 0.921
14 P 0.903 2.119 +- 0.948
214 I 0.737 1.815 +- 1.064
216 D 0.542 1.414 +- 0.965
220 V 0.746 1.822 +- 1.005
222 T 0.904 2.119 +- 0.939
235 A 0.647 1.635 +- 1.084
237 Q 0.512 1.331 +- 1.005
238 K 0.828 1.979 +- 0.981
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
