--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Nov 25 13:37:07 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/346/PGRP-LB-PC/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2051.99 -2064.76
2 -2051.93 -2065.32
--------------------------------------
TOTAL -2051.96 -2065.08
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.624931 0.007924 0.468754 0.811508 0.617244 1277.15 1389.08 1.000
r(A<->C){all} 0.173457 0.001248 0.108964 0.242416 0.171935 896.39 949.45 1.000
r(A<->G){all} 0.216278 0.001805 0.135484 0.301119 0.213160 926.45 1086.97 1.000
r(A<->T){all} 0.115345 0.001702 0.038856 0.195234 0.112325 724.99 766.11 1.000
r(C<->G){all} 0.086550 0.000461 0.044450 0.127274 0.085082 1061.47 1096.41 1.000
r(C<->T){all} 0.290430 0.002433 0.195889 0.382359 0.287095 863.67 881.71 1.000
r(G<->T){all} 0.117941 0.001145 0.055895 0.185885 0.115437 858.90 947.12 1.001
pi(A){all} 0.210129 0.000211 0.183291 0.239217 0.209791 948.26 1077.01 1.000
pi(C){all} 0.335873 0.000261 0.306860 0.369988 0.335670 1299.01 1327.29 1.000
pi(G){all} 0.278728 0.000237 0.248555 0.307870 0.278633 1126.76 1196.18 1.000
pi(T){all} 0.175270 0.000179 0.148824 0.200635 0.175173 991.34 994.98 1.000
alpha{1,2} 0.178047 0.002400 0.089423 0.287474 0.175109 1132.01 1133.32 1.000
alpha{3} 2.072347 0.611477 0.764466 3.656266 1.947823 1258.38 1367.97 1.000
pinvar{all} 0.355198 0.008805 0.154051 0.517182 0.368988 1004.61 1067.87 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1787.073819
Model 2: PositiveSelection -1786.979894
Model 0: one-ratio -1805.437461
Model 3: discrete -1786.452812
Model 7: beta -1789.169534
Model 8: beta&w>1 -1786.559737
Model 0 vs 1 36.727284000000054
Model 2 vs 1 0.18784999999979846
Model 8 vs 7 5.219594000000143
>C1
MTALGLVLLSMMGYSQHMQQANLGDGVATARLLSRSDWGARLPKSVEHFQ
GPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIG
GDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKNL
IAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHINDTEG
VSSTTAPVVPHVHPQAAAPQKPHQSPPAAPKVooooo
>C2
MTALGLVLLSIMGYSQHMQQANLGDGVATARLLSRSDWGARLPKSVDHFQ
GPAPYVIIHHSYMPAVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGIG
GDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKNL
IAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLNASDG
ESSTAAPVVPHVHAQAAAPQTPHQSPPAAPKVooooo
>C3
MTALGLVLLSMMGYSQHMQQANLGDGVATARLLSRSDWGARLPKSVEHFQ
GPAPYVIIHHSYMPAVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGIG
GDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKNL
IAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLNATEG
VSSTAAPVVPHVHAQAAAPQTPHQSPPAAPKVooooo
>C4
MTALGLILLSMMGYSQHMQQANLGDGVATARLLSRSDWGARLPKSVDHFQ
GPAPYVIIHHSYMPGVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGIG
GDGMIYTGRGFNVVGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAARNL
ISFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLSETEG
VVSSTAAPVEPHVHPKAATQTPLAQSPPAAPKVoooo
>C5
MTALGLVLLSMMGYSQHMQQANLGTARLLSRSDWGARLPKSVEHFQGPAP
YVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGM
IYAGRGFNVIGAHAPKYNDRSVGIVLIGDWRTELPPKQMLDAAKDLIAFG
VFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHINDTEGVSST
KAPVEPHVHPQAATQQTPPKSPPAAPKVooooooooo
>C6
MTALGLVLLSMMGYSQHMQHANLGDGAATARLLSRSDWGARLPKSVEHFE
GPAPYVIIHHSYMPAVCYTTPDCMKSMRDMQDFHQLERGWNDIGYSFGIG
GDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKNL
IAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISGWPHFTHLNATEG
STPVPIEPHAHPQAASQTPPQSPPQSPPHAPAAAPKV
>C7
MTALGLVLLSMMGYSQPAVNLGESGVANARLLSRSDWGARLPKSVEHFQG
PAPYVIIHHSYMPGVCYTTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGG
DGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLI
SFGVFKGYIDPAYKLLGHRQVRDTECPGDRLFAEITGWPHFTLLNGTETT
TSAPVEPHVHPQPVAPQSPPAAPKVoooooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=253
C1 MTALGLVLLSMMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVEHF
C2 MTALGLVLLSIMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVDHF
C3 MTALGLVLLSMMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVEHF
C4 MTALGLILLSMMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVDHF
C5 MTALGLVLLSMMGYSQHMQQANLG-----TARLLSRSDWGARLPKSVEHF
C6 MTALGLVLLSMMGYSQHMQHANLGD-GAATARLLSRSDWGARLPKSVEHF
C7 MTALGLVLLSMMGYSQ--PAVNLGESGVANARLLSRSDWGARLPKSVEHF
******:***:***** .*** .*****************:**
C1 QGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
C2 QGPAPYVIIHHSYMPAVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGI
C3 QGPAPYVIIHHSYMPAVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGI
C4 QGPAPYVIIHHSYMPGVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGI
C5 QGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
C6 EGPAPYVIIHHSYMPAVCYTTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
C7 QGPAPYVIIHHSYMPGVCYTTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
:**************.***:**:***************************
C1 GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
C2 GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
C3 GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
C4 GGDGMIYTGRGFNVVGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAARN
C5 GGDGMIYAGRGFNVIGAHAPKYNDRSVGIVLIGDWRTELPPKQMLDAAKD
C6 GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
C7 GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
*******:******:*********:***********************::
C1 LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHINDTE
C2 LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLNASD
C3 LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLNATE
C4 LISFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLSETE
C5 LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHINDTE
C6 LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISGWPHFTHLNATE
C7 LISFGVFKGYIDPAYKLLGHRQVRDTECPGDRLFAEITGWPHFTLLNGTE
**:***************************.******:.***** :. ::
C1 GV-SSTTAPVVPHVHPQAAAP---QKPHQSPP----AAPKVooooo----
C2 GE-SSTAAPVVPHVHAQAAAP---QTPHQSPP----AAPKVooooo----
C3 GV-SSTAAPVVPHVHAQAAAP---QTPHQSPP----AAPKVooooo----
C4 GVVSSTAAPVEPHVHPKAATQ---TPLAQSPP----AAPKVoooo-----
C5 GV-SSTKAPVEPHVHPQAATQ---QTPPKSPP----AAPKVooooooooo
C6 GS---TPVPIEPHAHPQAASQTPPQSPPQSPPHAPAAAPKV---------
C7 TT---TSAPVEPHVHPQPVAP-------QSPP----AAPKVooooooooo
* .*: **.*.:..: :*** *****
C1 ---
C2 ---
C3 ---
C4 ---
C5 ---
C6 ---
C7 ooo
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 237 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 237 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [12302]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [12302]--->[11586]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.394 Mb, Max= 30.791 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MTALGLVLLSMMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVEHF
QGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHINDTE
GV-SSTTAPVVPHVHPQAAAP---QKPHQSPP----AAPKVooooo----
---
>C2
MTALGLVLLSIMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVDHF
QGPAPYVIIHHSYMPAVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLNASD
GE-SSTAAPVVPHVHAQAAAP---QTPHQSPP----AAPKVooooo----
---
>C3
MTALGLVLLSMMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVEHF
QGPAPYVIIHHSYMPAVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLNATE
GV-SSTAAPVVPHVHAQAAAP---QTPHQSPP----AAPKVooooo----
---
>C4
MTALGLILLSMMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVDHF
QGPAPYVIIHHSYMPGVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYTGRGFNVVGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAARN
LISFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLSETE
GVVSSTAAPVEPHVHPKAATQ---TPLAQSPP----AAPKVoooo-----
---
>C5
MTALGLVLLSMMGYSQHMQQANLG-----TARLLSRSDWGARLPKSVEHF
QGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYAGRGFNVIGAHAPKYNDRSVGIVLIGDWRTELPPKQMLDAAKD
LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHINDTE
GV-SSTKAPVEPHVHPQAATQ---QTPPKSPP----AAPKVooooooooo
---
>C6
MTALGLVLLSMMGYSQHMQHANLGD-GAATARLLSRSDWGARLPKSVEHF
EGPAPYVIIHHSYMPAVCYTTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISGWPHFTHLNATE
GS---TPVPIEPHAHPQAASQTPPQSPPQSPPHAPAAAPKV---------
---
>C7
MTALGLVLLSMMGYSQ--PAVNLGESGVANARLLSRSDWGARLPKSVEHF
QGPAPYVIIHHSYMPGVCYTTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
LISFGVFKGYIDPAYKLLGHRQVRDTECPGDRLFAEITGWPHFTLLNGTE
TT---TSAPVEPHVHPQPVAP-------QSPP----AAPKVooooooooo
ooo
FORMAT of file /tmp/tmp7225621295032640079aln Not Supported[FATAL:T-COFFEE]
>C1
MTALGLVLLSMMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVEHF
QGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHINDTE
GV-SSTTAPVVPHVHPQAAAP---QKPHQSPP----AAPKVooooo----
---
>C2
MTALGLVLLSIMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVDHF
QGPAPYVIIHHSYMPAVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLNASD
GE-SSTAAPVVPHVHAQAAAP---QTPHQSPP----AAPKVooooo----
---
>C3
MTALGLVLLSMMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVEHF
QGPAPYVIIHHSYMPAVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLNATE
GV-SSTAAPVVPHVHAQAAAP---QTPHQSPP----AAPKVooooo----
---
>C4
MTALGLILLSMMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVDHF
QGPAPYVIIHHSYMPGVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYTGRGFNVVGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAARN
LISFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLSETE
GVVSSTAAPVEPHVHPKAATQ---TPLAQSPP----AAPKVoooo-----
---
>C5
MTALGLVLLSMMGYSQHMQQANLG-----TARLLSRSDWGARLPKSVEHF
QGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYAGRGFNVIGAHAPKYNDRSVGIVLIGDWRTELPPKQMLDAAKD
LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHINDTE
GV-SSTKAPVEPHVHPQAATQ---QTPPKSPP----AAPKVooooooooo
---
>C6
MTALGLVLLSMMGYSQHMQHANLGD-GAATARLLSRSDWGARLPKSVEHF
EGPAPYVIIHHSYMPAVCYTTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISGWPHFTHLNATE
GS---TPVPIEPHAHPQAASQTPPQSPPQSPPHAPAAAPKV---------
---
>C7
MTALGLVLLSMMGYSQ--PAVNLGESGVANARLLSRSDWGARLPKSVEHF
QGPAPYVIIHHSYMPGVCYTTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
LISFGVFKGYIDPAYKLLGHRQVRDTECPGDRLFAEITGWPHFTLLNGTE
TT---TSAPVEPHVHPQPVAP-------QSPP----AAPKVooooooooo
ooo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:253 S:94 BS:253
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# PW_SEQ_DISTANCES
BOT 0 1 95.36 C1 C2 95.36
TOP 1 0 95.36 C2 C1 95.36
BOT 0 2 97.47 C1 C3 97.47
TOP 2 0 97.47 C3 C1 97.47
BOT 0 3 91.95 C1 C4 91.95
TOP 3 0 91.95 C4 C1 91.95
BOT 0 4 95.71 C1 C5 95.71
TOP 4 0 95.71 C5 C1 95.71
BOT 0 5 92.61 C1 C6 92.61
TOP 5 0 92.61 C6 C1 92.61
BOT 0 6 91.27 C1 C7 91.27
TOP 6 0 91.27 C7 C1 91.27
BOT 1 2 97.89 C2 C3 97.89
TOP 2 1 97.89 C3 C2 97.89
BOT 1 3 91.53 C2 C4 91.53
TOP 3 1 91.53 C4 C2 91.53
BOT 1 4 92.27 C2 C5 92.27
TOP 4 1 92.27 C5 C2 92.27
BOT 1 5 90.87 C2 C6 90.87
TOP 5 1 90.87 C6 C2 90.87
BOT 1 6 89.08 C2 C7 89.08
TOP 6 1 89.08 C7 C2 89.08
BOT 2 3 92.80 C3 C4 92.80
TOP 3 2 92.80 C4 C3 92.80
BOT 2 4 94.42 C3 C5 94.42
TOP 4 2 94.42 C5 C3 94.42
BOT 2 5 92.61 C3 C6 92.61
TOP 5 2 92.61 C6 C3 92.61
BOT 2 6 90.83 C3 C7 90.83
TOP 6 2 90.83 C7 C3 90.83
BOT 3 4 91.38 C4 C5 91.38
TOP 4 3 91.38 C5 C4 91.38
BOT 3 5 89.13 C4 C6 89.13
TOP 5 3 89.13 C6 C4 89.13
BOT 3 6 89.04 C4 C7 89.04
TOP 6 3 89.04 C7 C4 89.04
BOT 4 5 92.48 C5 C6 92.48
TOP 5 4 92.48 C6 C5 92.48
BOT 4 6 89.52 C5 C7 89.52
TOP 6 4 89.52 C7 C5 89.52
BOT 5 6 89.73 C6 C7 89.73
TOP 6 5 89.73 C7 C6 89.73
AVG 0 C1 * 94.06
AVG 1 C2 * 92.83
AVG 2 C3 * 94.34
AVG 3 C4 * 90.97
AVG 4 C5 * 92.63
AVG 5 C6 * 91.24
AVG 6 C7 * 89.91
TOT TOT * 92.28
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACAGCACTGGGATTAGTTCTGCTATCGATGATGGGCTATAGTCAGCA
C2 ATGACAGCACTGGGATTAGTTCTGCTATCGATAATGGGCTATAGTCAGCA
C3 ATGACAGCACTGGGATTAGTTCTGCTATCGATGATGGGCTATAGTCAGCA
C4 ATGACAGCACTGGGATTAATTCTGCTATCGATGATGGGCTATAGTCAGCA
C5 ATGACAGCACTGGGATTAGTTCTGCTATCGATGATGGGCTATAGTCAGCA
C6 ATGACAGCACTGGGATTAGTTTTGCTATCAATGATGGGCTATAGCCAGCA
C7 ATGACAGCACTGGGATTAGTTTTGCTATCCATGATGGGCTATAGCCAG--
******************.** ******* **.*********** ***
C1 CATGCAGCAGGCGAATCTGGGCGAC---GGTGTGGCCACCGCCCGCCTGC
C2 CATGCAGCAGGCGAATCTGGGCGAC---GGTGTGGCCACCGCCCGCCTGC
C3 CATGCAGCAGGCGAATCTGGGCGAC---GGTGTGGCCACCGCCCGCCTGC
C4 CATGCAGCAGGCAAATCTGGGCGAT---GGTGTGGCCACCGCCCGACTGC
C5 CATGCAGCAGGCGAATCTGGGC---------------ACCGCCCGGCTTC
C6 CATGCAGCATGCGAATTTGGGCGAT---GGAGCGGCCACCGCTCGACTTC
C7 ----CCCGCTGTGAATCTGGGCGAATCTGGGGTGGCCAACGCTCGACTCC
*. . * .*** ***** *.*** ** ** *
C1 TGTCCCGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGAGCACTTC
C2 TTTCCCGATCCGACTGGGGTGCCCGGCTGCCCAAGTCTGTGGACCACTTC
C3 TTTCCCGATCCGACTGGGGTGCACGGCTGCCCAAGTCCGTGGAGCACTTC
C4 TGTCCAGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGACCACTTT
C5 TGTCCCGATCCGACTGGGGTGCCCGCCTGCCCAAGTCCGTGGAGCACTTT
C6 TGTCCCGCTCCGACTGGGGCGCCCGTCTGCCCAAGTCCGTGGAGCACTTC
C7 TGTCCCGCTCCGACTGGGGTGCCCGGCTGCCCAAATCCGTGGAGCACTTC
* ***.*.*********** **.** ********.** ***** *****
C1 CAGGGTCCCGCGCCCTACGTCATCATCCATCACTCGTACATGCCGGCCGT
C2 CAGGGACCCGCGCCCTACGTCATCATCCACCACTCGTACATGCCGGCCGT
C3 CAGGGACCAGCGCCTTACGTCATCATCCACCACTCGTATATGCCGGCCGT
C4 CAGGGACCCGCGCCCTACGTCATCATCCACCACTCGTACATGCCAGGCGT
C5 CAAGGACCCGCGCCCTACGTGATCATCCACCACTCGTACATGCCAGCCGT
C6 GAGGGTCCCGCCCCCTACGTGATCATCCACCACTCTTACATGCCGGCGGT
C7 CAGGGTCCCGCCCCCTACGTGATCATCCACCACTCATATATGCCCGGCGT
*.**:**.** ** ***** ******** ***** ** ***** * **
C1 GTGCTACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACT
C2 GTGCTACTCCACTCCGGAATGCATGAAGAGCATGCGGGACATGCAGGACT
C3 GTGCTACTCAACTCCGGAATGCATGAAGAGCATGCGGGACATGCAGGACT
C4 GTGCTACTCCACTCCGGAGTGCATGAAGAGCATGCGGGACATGCAGGACT
C5 GTGCTACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACT
C6 GTGCTATACCACTCCCGACTGCATGAAGAGCATGCGCGACATGCAGGACT
C7 TTGCTATACCACGCCGGACTGCATGAAGAGCATGCGCGACATGCAGGACT
***** :*.** ** ** ***************** *************
C1 TCCATCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATC
C2 TCCATCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATC
C3 TTCATCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATC
C4 TCCACCAGCTGGAGCGCGGATGGAACGATATCGGATATAGCTTTGGCATC
C5 TCCACCAGCTGGAGCGCGGTTGGAACGATATCGGATATAGCTTTGGCATC
C6 TCCACCAGCTGGAGCGCGGTTGGAACGACATCGGCTATAGCTTCGGCATC
C7 TCCACCAACTGGAGCGCGGCTGGAACGATATCGGCTATAGCTTTGGAATC
* ** **.*********** ******** ** ** ******** **.***
C1 GGCGGCGATGGCATGATTTACACCGGCAGGGGATTCAATGTCATCGGAGC
C2 GGCGGCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCATCGGAGC
C3 GGCGGCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCATCGGAGC
C4 GGCGGCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCGTCGGAGC
C5 GGCGGCGATGGCATGATCTACGCAGGCAGGGGATTCAATGTCATCGGAGC
C6 GGCGGCGATGGCATGATCTACACCGGAAGGGGATTCAACGTTATCGGAGC
C7 GGCGGCGATGGGATGATCTACACCGGAAGGGGATTCAACGTTATCGGAGC
*********** ***** ***.*.**.*********** ** .*******
C1 TCATGCACCCAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAG
C2 TCATGCACCCAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAG
C3 TCATGCACCGAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAG
C4 TCATGCGCCGAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAG
C5 TCATGCGCCGAAGTACAATGACAGGAGCGTGGGCATCGTGCTGATCGGAG
C6 TCATGCACCCAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAG
C7 TCATGCCCCTAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAG
****** ** *************.************ *************
C1 ATTGGAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAAC
C2 ATTGGAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAAC
C3 ATTGGAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAAC
C4 ATTGGAGAACTGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAGGAAC
C5 ATTGGAGAACTGAACTTCCGCCCAAGCAGATGCTGGATGCGGCCAAGGAC
C6 ATTGGAGAACTGAACTGCCGCCCAAACAGATGCTGGACGCGGCCAAAAAC
C7 ATTGGAGAACTGAATTGCCTCCCAAACAGATGCTGGATGCGGCCAAGAAC
********** *** * ** *****.*********** *******...**
C1 CTGATCGCCTTTGGCGTTTTCAAGGGCTACATTGACCCTGCCTACAAGCT
C2 CTGATCGCCTTCGGAGTTTTCAAGGGCTACATTGACCCCGCCTACAAACT
C3 CTGATCGCCTTCGGCGTTTTCAAGGGCTACATTGACCCCGCCTACAAGCT
C4 CTGATCTCCTTCGGGGTGTTCAAGGGCTACATTGACCCCGCCTACAAGCT
C5 CTGATCGCCTTCGGGGTGTTCAAGGGCTACATTGACCCCGCCTACAAGCT
C6 CTGATCGCCTTCGGCGTGTTCAAGGGCTACATTGACCCCGCATACAAGCT
C7 CTGATCTCCTTTGGGGTCTTCAAGGGTTACATTGACCCCGCCTACAAGCT
****** **** ** ** ******** *********** **.*****.**
C1 GCTGGGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTGT
C2 GCTGGGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGAGGCCGCCTCT
C3 GCTGGGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTCT
C4 GCTGGGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGAGGCCGCCTGT
C5 GCTGGGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGGGGCCGCCTGT
C6 GCTGGGCCACCGACAGGTTCGTGACACCGAGTGTCCCGGAGGCAGGCTGT
C7 GCTGGGCCACAGACAGGTGCGGGACACCGAGTGTCCCGGGGACAGACTGT
**********.******* ** ** *********** ** *.*.* ** *
C1 TCGCCGAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAA
C2 TCGCCGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAACGCCAGCGAC
C3 TCGCCGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAACGCCACCGAA
C4 TTGCCGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAGCGAAACCGAA
C5 TTGCCGAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAA
C6 TCGCGGAGATCTCCGGCTGGCCGCACTTTACCCACCTAAACGCCACCGAA
C7 TCGCTGAGATCACCGGCTGGCCGCATTTCACCCTCCTAAACGGCACCGAG
* ** ******:**.********** ** ****:*.***.** .* ***
C1 GGCGTC---AGCAGCACCACGGCGCCCGTCGTGCCCCACGTCCATCCACA
C2 GGCGAG---AGCAGCACTGCGGCGCCCGTCGTGCCCCATGTCCATGCACA
C3 GGCGTG---AGCAGCACTGCGGCGCCCGTCGTGCCCCATGTCCATGCACA
C4 GGCGTAGTTAGCAGCACTGCTGCGCCCGTCGAGCCCCACGTCCATCCAAA
C5 GGCGTT---AGCAGTACGAAGGCGCCGGTCGAGCCCCACGTCCATCCACA
C6 GGCAGC---------ACCCCCGTCCCCATTGAACCGCACGCACATCCCCA
C7 ACCACC---------ACTTCGGCACCCGTGGAACCCCACGTCCATCCACA
. *. ** . * ** .* *:.** ** * .*** *..*
C1 GGCGGCAGCACCA---------CAAAAGCCGCACCAATCCCCGCCA----
C2 GGCGGCAGCACCA---------CAAACGCCGCACCAATCCCCGCCA----
C3 GGCGGCAGCACCA---------CAAACGCCGCACCAATCCCCGCCA----
C4 GGCGGCAACACAA---------ACGCCACTCGCCCAATCCCCGCCA----
C5 GGCGGCAACACAA---------CAAACGCCGCCCAAATCCCCGCCA----
C6 GGCGGCGTCCCAAACGCCACCCCAATCACCACCCCAATCGCCACCCCATG
C7 GCCGGTGGCGCCC---------------------CAATCCCCGCCA----
* *** . * *.. .**** **.**.
C1 --------GCTGCGCCCAAGGTC---------------------------
C2 --------GCTGCGCCCAAGGTC---------------------------
C3 --------GCTGCGCCCAAGGTC---------------------------
C4 --------GCTGCGCCCAAGGTC---------------------------
C5 --------GCTGCGCCCAAGGTC---------------------------
C6 CCCCGGCAGCTGCGCCCAAGGTC---------------------------
C7 --------GCTGCGCCCAAGGTC---------------------------
***************
C1 ---------
C2 ---------
C3 ---------
C4 ---------
C5 ---------
C6 ---------
C7 ---------
>C1
ATGACAGCACTGGGATTAGTTCTGCTATCGATGATGGGCTATAGTCAGCA
CATGCAGCAGGCGAATCTGGGCGAC---GGTGTGGCCACCGCCCGCCTGC
TGTCCCGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGAGCACTTC
CAGGGTCCCGCGCCCTACGTCATCATCCATCACTCGTACATGCCGGCCGT
GTGCTACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACT
TCCATCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATC
GGCGGCGATGGCATGATTTACACCGGCAGGGGATTCAATGTCATCGGAGC
TCATGCACCCAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAG
ATTGGAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAAC
CTGATCGCCTTTGGCGTTTTCAAGGGCTACATTGACCCTGCCTACAAGCT
GCTGGGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTGT
TCGCCGAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAA
GGCGTC---AGCAGCACCACGGCGCCCGTCGTGCCCCACGTCCATCCACA
GGCGGCAGCACCA---------CAAAAGCCGCACCAATCCCCGCCA----
--------GCTGCGCCCAAGGTC---------------------------
---------
>C2
ATGACAGCACTGGGATTAGTTCTGCTATCGATAATGGGCTATAGTCAGCA
CATGCAGCAGGCGAATCTGGGCGAC---GGTGTGGCCACCGCCCGCCTGC
TTTCCCGATCCGACTGGGGTGCCCGGCTGCCCAAGTCTGTGGACCACTTC
CAGGGACCCGCGCCCTACGTCATCATCCACCACTCGTACATGCCGGCCGT
GTGCTACTCCACTCCGGAATGCATGAAGAGCATGCGGGACATGCAGGACT
TCCATCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATC
GGCGGCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCATCGGAGC
TCATGCACCCAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAG
ATTGGAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAAC
CTGATCGCCTTCGGAGTTTTCAAGGGCTACATTGACCCCGCCTACAAACT
GCTGGGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGAGGCCGCCTCT
TCGCCGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAACGCCAGCGAC
GGCGAG---AGCAGCACTGCGGCGCCCGTCGTGCCCCATGTCCATGCACA
GGCGGCAGCACCA---------CAAACGCCGCACCAATCCCCGCCA----
--------GCTGCGCCCAAGGTC---------------------------
---------
>C3
ATGACAGCACTGGGATTAGTTCTGCTATCGATGATGGGCTATAGTCAGCA
CATGCAGCAGGCGAATCTGGGCGAC---GGTGTGGCCACCGCCCGCCTGC
TTTCCCGATCCGACTGGGGTGCACGGCTGCCCAAGTCCGTGGAGCACTTC
CAGGGACCAGCGCCTTACGTCATCATCCACCACTCGTATATGCCGGCCGT
GTGCTACTCAACTCCGGAATGCATGAAGAGCATGCGGGACATGCAGGACT
TTCATCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATC
GGCGGCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCATCGGAGC
TCATGCACCGAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAG
ATTGGAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAAC
CTGATCGCCTTCGGCGTTTTCAAGGGCTACATTGACCCCGCCTACAAGCT
GCTGGGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTCT
TCGCCGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAACGCCACCGAA
GGCGTG---AGCAGCACTGCGGCGCCCGTCGTGCCCCATGTCCATGCACA
GGCGGCAGCACCA---------CAAACGCCGCACCAATCCCCGCCA----
--------GCTGCGCCCAAGGTC---------------------------
---------
>C4
ATGACAGCACTGGGATTAATTCTGCTATCGATGATGGGCTATAGTCAGCA
CATGCAGCAGGCAAATCTGGGCGAT---GGTGTGGCCACCGCCCGACTGC
TGTCCAGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGACCACTTT
CAGGGACCCGCGCCCTACGTCATCATCCACCACTCGTACATGCCAGGCGT
GTGCTACTCCACTCCGGAGTGCATGAAGAGCATGCGGGACATGCAGGACT
TCCACCAGCTGGAGCGCGGATGGAACGATATCGGATATAGCTTTGGCATC
GGCGGCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCGTCGGAGC
TCATGCGCCGAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAG
ATTGGAGAACTGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAGGAAC
CTGATCTCCTTCGGGGTGTTCAAGGGCTACATTGACCCCGCCTACAAGCT
GCTGGGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGAGGCCGCCTGT
TTGCCGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAGCGAAACCGAA
GGCGTAGTTAGCAGCACTGCTGCGCCCGTCGAGCCCCACGTCCATCCAAA
GGCGGCAACACAA---------ACGCCACTCGCCCAATCCCCGCCA----
--------GCTGCGCCCAAGGTC---------------------------
---------
>C5
ATGACAGCACTGGGATTAGTTCTGCTATCGATGATGGGCTATAGTCAGCA
CATGCAGCAGGCGAATCTGGGC---------------ACCGCCCGGCTTC
TGTCCCGATCCGACTGGGGTGCCCGCCTGCCCAAGTCCGTGGAGCACTTT
CAAGGACCCGCGCCCTACGTGATCATCCACCACTCGTACATGCCAGCCGT
GTGCTACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACT
TCCACCAGCTGGAGCGCGGTTGGAACGATATCGGATATAGCTTTGGCATC
GGCGGCGATGGCATGATCTACGCAGGCAGGGGATTCAATGTCATCGGAGC
TCATGCGCCGAAGTACAATGACAGGAGCGTGGGCATCGTGCTGATCGGAG
ATTGGAGAACTGAACTTCCGCCCAAGCAGATGCTGGATGCGGCCAAGGAC
CTGATCGCCTTCGGGGTGTTCAAGGGCTACATTGACCCCGCCTACAAGCT
GCTGGGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGGGGCCGCCTGT
TTGCCGAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAA
GGCGTT---AGCAGTACGAAGGCGCCGGTCGAGCCCCACGTCCATCCACA
GGCGGCAACACAA---------CAAACGCCGCCCAAATCCCCGCCA----
--------GCTGCGCCCAAGGTC---------------------------
---------
>C6
ATGACAGCACTGGGATTAGTTTTGCTATCAATGATGGGCTATAGCCAGCA
CATGCAGCATGCGAATTTGGGCGAT---GGAGCGGCCACCGCTCGACTTC
TGTCCCGCTCCGACTGGGGCGCCCGTCTGCCCAAGTCCGTGGAGCACTTC
GAGGGTCCCGCCCCCTACGTGATCATCCACCACTCTTACATGCCGGCGGT
GTGCTATACCACTCCCGACTGCATGAAGAGCATGCGCGACATGCAGGACT
TCCACCAGCTGGAGCGCGGTTGGAACGACATCGGCTATAGCTTCGGCATC
GGCGGCGATGGCATGATCTACACCGGAAGGGGATTCAACGTTATCGGAGC
TCATGCACCCAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAG
ATTGGAGAACTGAACTGCCGCCCAAACAGATGCTGGACGCGGCCAAAAAC
CTGATCGCCTTCGGCGTGTTCAAGGGCTACATTGACCCCGCATACAAGCT
GCTGGGCCACCGACAGGTTCGTGACACCGAGTGTCCCGGAGGCAGGCTGT
TCGCGGAGATCTCCGGCTGGCCGCACTTTACCCACCTAAACGCCACCGAA
GGCAGC---------ACCCCCGTCCCCATTGAACCGCACGCACATCCCCA
GGCGGCGTCCCAAACGCCACCCCAATCACCACCCCAATCGCCACCCCATG
CCCCGGCAGCTGCGCCCAAGGTC---------------------------
---------
>C7
ATGACAGCACTGGGATTAGTTTTGCTATCCATGATGGGCTATAGCCAG--
----CCCGCTGTGAATCTGGGCGAATCTGGGGTGGCCAACGCTCGACTCC
TGTCCCGCTCCGACTGGGGTGCCCGGCTGCCCAAATCCGTGGAGCACTTC
CAGGGTCCCGCCCCCTACGTGATCATCCACCACTCATATATGCCCGGCGT
TTGCTATACCACGCCGGACTGCATGAAGAGCATGCGCGACATGCAGGACT
TCCACCAACTGGAGCGCGGCTGGAACGATATCGGCTATAGCTTTGGAATC
GGCGGCGATGGGATGATCTACACCGGAAGGGGATTCAACGTTATCGGAGC
TCATGCCCCTAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAG
ATTGGAGAACTGAATTGCCTCCCAAACAGATGCTGGATGCGGCCAAGAAC
CTGATCTCCTTTGGGGTCTTCAAGGGTTACATTGACCCCGCCTACAAGCT
GCTGGGCCACAGACAGGTGCGGGACACCGAGTGTCCCGGGGACAGACTGT
TCGCTGAGATCACCGGCTGGCCGCATTTCACCCTCCTAAACGGCACCGAG
ACCACC---------ACTTCGGCACCCGTGGAACCCCACGTCCATCCACA
GCCGGTGGCGCCC---------------------CAATCCCCGCCA----
--------GCTGCGCCCAAGGTC---------------------------
---------
>C1
MTALGLVLLSMMGYSQHMQQANLGDoGVATARLLSRSDWGARLPKSVEHF
QGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHINDTE
GVoSSTTAPVVPHVHPQAAAPoooQKPHQSPPooooAAPKV
>C2
MTALGLVLLSIMGYSQHMQQANLGDoGVATARLLSRSDWGARLPKSVDHF
QGPAPYVIIHHSYMPAVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLNASD
GEoSSTAAPVVPHVHAQAAAPoooQTPHQSPPooooAAPKV
>C3
MTALGLVLLSMMGYSQHMQQANLGDoGVATARLLSRSDWGARLPKSVEHF
QGPAPYVIIHHSYMPAVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLNATE
GVoSSTAAPVVPHVHAQAAAPoooQTPHQSPPooooAAPKV
>C4
MTALGLILLSMMGYSQHMQQANLGDoGVATARLLSRSDWGARLPKSVDHF
QGPAPYVIIHHSYMPGVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYTGRGFNVVGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAARN
LISFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLSETE
GVVSSTAAPVEPHVHPKAATQoooTPLAQSPPooooAAPKV
>C5
MTALGLVLLSMMGYSQHMQQANLGoooooTARLLSRSDWGARLPKSVEHF
QGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYAGRGFNVIGAHAPKYNDRSVGIVLIGDWRTELPPKQMLDAAKD
LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHINDTE
GVoSSTKAPVEPHVHPQAATQoooQTPPKSPPooooAAPKV
>C6
MTALGLVLLSMMGYSQHMQHANLGDoGAATARLLSRSDWGARLPKSVEHF
EGPAPYVIIHHSYMPAVCYTTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISGWPHFTHLNATE
GSoooTPVPIEPHAHPQAASQTPPQSPPQSPPHAPAAAPKV
>C7
MTALGLVLLSMMGYSQooPAVNLGESGVANARLLSRSDWGARLPKSVEHF
QGPAPYVIIHHSYMPGVCYTTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
LISFGVFKGYIDPAYKLLGHRQVRDTECPGDRLFAEITGWPHFTLLNGTE
TToooTSAPVEPHVHPQPVAPoooooooQSPPooooAAPKV
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 7 taxa and 759 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480080553
Setting output file names to "/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 157160866
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 6218355503
Seed = 1303383638
Swapseed = 1480080553
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 41 unique site patterns
Division 2 has 37 unique site patterns
Division 3 has 92 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2536.976614 -- -24.557203
Chain 2 -- -2520.038407 -- -24.557203
Chain 3 -- -2552.238142 -- -24.557203
Chain 4 -- -2567.492253 -- -24.557203
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2526.891977 -- -24.557203
Chain 2 -- -2571.181296 -- -24.557203
Chain 3 -- -2554.954145 -- -24.557203
Chain 4 -- -2521.100914 -- -24.557203
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2536.977] (-2520.038) (-2552.238) (-2567.492) * [-2526.892] (-2571.181) (-2554.954) (-2521.101)
500 -- (-2092.174) (-2105.979) (-2114.640) [-2094.291] * [-2094.692] (-2103.408) (-2101.512) (-2115.584) -- 0:33:19
1000 -- [-2080.220] (-2085.408) (-2092.741) (-2078.165) * [-2089.194] (-2098.135) (-2091.223) (-2095.279) -- 0:16:39
1500 -- (-2072.119) (-2059.480) (-2079.832) [-2056.628] * (-2086.317) (-2081.426) (-2083.156) [-2076.893] -- 0:11:05
2000 -- (-2067.207) (-2063.931) [-2057.212] (-2055.868) * (-2062.939) [-2069.430] (-2071.451) (-2069.845) -- 0:08:19
2500 -- [-2055.649] (-2072.190) (-2059.265) (-2056.638) * [-2055.505] (-2061.483) (-2061.172) (-2058.548) -- 0:06:39
3000 -- (-2064.470) [-2063.298] (-2057.704) (-2060.942) * (-2055.587) (-2059.937) (-2051.048) [-2054.155] -- 0:05:32
3500 -- [-2064.464] (-2053.591) (-2063.174) (-2056.223) * [-2055.746] (-2060.725) (-2056.000) (-2057.071) -- 0:09:29
4000 -- (-2064.127) [-2054.504] (-2054.380) (-2052.559) * [-2055.914] (-2061.008) (-2055.952) (-2053.496) -- 0:08:18
4500 -- (-2060.216) [-2054.194] (-2064.989) (-2056.907) * (-2058.981) [-2057.074] (-2058.245) (-2054.203) -- 0:07:22
5000 -- (-2054.942) (-2062.464) [-2061.346] (-2059.728) * (-2058.115) [-2055.914] (-2054.287) (-2056.306) -- 0:06:38
Average standard deviation of split frequencies: 0.078567
5500 -- [-2050.867] (-2052.742) (-2059.533) (-2054.019) * (-2054.429) (-2062.869) (-2056.842) [-2054.642] -- 0:06:01
6000 -- [-2055.749] (-2053.166) (-2056.524) (-2057.891) * (-2059.016) (-2057.103) (-2057.357) [-2052.980] -- 0:05:31
6500 -- (-2057.336) [-2053.223] (-2055.124) (-2062.413) * (-2057.712) [-2052.772] (-2058.522) (-2060.772) -- 0:07:38
7000 -- [-2057.501] (-2053.465) (-2054.052) (-2059.265) * (-2059.587) (-2057.603) (-2063.809) [-2053.653] -- 0:07:05
7500 -- (-2056.073) [-2054.865] (-2057.466) (-2067.337) * (-2055.789) [-2059.805] (-2059.272) (-2056.371) -- 0:06:37
8000 -- (-2060.801) [-2056.532] (-2054.340) (-2058.635) * (-2053.259) (-2060.297) [-2056.035] (-2057.999) -- 0:06:12
8500 -- (-2067.382) (-2060.787) [-2053.113] (-2059.341) * (-2056.056) (-2059.265) (-2061.344) [-2050.267] -- 0:05:49
9000 -- [-2058.214] (-2061.556) (-2065.049) (-2056.902) * (-2052.754) (-2051.935) [-2050.110] (-2057.508) -- 0:05:30
9500 -- (-2052.096) [-2053.499] (-2062.923) (-2055.045) * (-2064.429) [-2052.654] (-2050.851) (-2058.051) -- 0:06:57
10000 -- (-2058.841) (-2055.413) (-2070.137) [-2057.924] * (-2055.732) (-2058.483) [-2048.268] (-2055.071) -- 0:06:36
Average standard deviation of split frequencies: 0.026517
10500 -- (-2051.476) (-2056.829) (-2056.374) [-2052.845] * (-2057.526) [-2058.414] (-2055.382) (-2056.913) -- 0:06:16
11000 -- (-2054.261) [-2051.901] (-2054.289) (-2053.880) * (-2057.812) [-2050.926] (-2051.235) (-2055.522) -- 0:05:59
11500 -- (-2053.416) (-2054.416) (-2056.287) [-2057.919] * (-2054.515) (-2054.402) [-2052.336] (-2054.486) -- 0:05:43
12000 -- (-2055.558) (-2047.130) [-2053.772] (-2056.257) * (-2056.787) (-2059.082) [-2053.175] (-2049.925) -- 0:05:29
12500 -- [-2052.325] (-2063.910) (-2055.055) (-2053.078) * (-2062.664) (-2052.595) [-2055.445] (-2058.597) -- 0:06:35
13000 -- (-2051.476) (-2058.783) [-2049.288] (-2056.509) * (-2055.742) (-2056.783) (-2055.557) [-2048.491] -- 0:06:19
13500 -- (-2054.349) (-2054.304) [-2058.892] (-2059.503) * [-2048.973] (-2055.379) (-2063.237) (-2054.793) -- 0:06:05
14000 -- [-2054.893] (-2058.448) (-2066.902) (-2054.866) * (-2052.493) (-2055.729) [-2055.104] (-2053.596) -- 0:05:52
14500 -- (-2059.141) (-2060.480) (-2057.386) [-2057.645] * (-2058.448) (-2060.948) (-2054.682) [-2055.330] -- 0:05:39
15000 -- [-2054.702] (-2053.406) (-2061.520) (-2052.439) * (-2055.580) (-2054.732) (-2063.336) [-2060.082] -- 0:05:28
Average standard deviation of split frequencies: 0.005893
15500 -- (-2062.041) (-2059.226) (-2053.410) [-2052.367] * (-2051.662) [-2057.964] (-2053.550) (-2064.399) -- 0:06:21
16000 -- (-2057.054) (-2054.661) (-2056.238) [-2053.265] * (-2053.437) [-2051.947] (-2056.716) (-2057.242) -- 0:06:09
16500 -- (-2056.662) (-2055.263) (-2058.064) [-2052.727] * (-2058.552) (-2058.376) (-2059.786) [-2054.914] -- 0:05:57
17000 -- (-2058.969) [-2056.604] (-2060.600) (-2063.793) * (-2053.424) (-2052.353) (-2056.579) [-2059.797] -- 0:05:46
17500 -- (-2055.923) [-2054.558] (-2064.130) (-2055.539) * (-2050.574) (-2050.747) [-2060.204] (-2058.362) -- 0:05:36
18000 -- [-2060.685] (-2055.240) (-2057.610) (-2055.969) * (-2057.918) (-2057.571) (-2050.907) [-2059.170] -- 0:05:27
18500 -- (-2056.178) (-2052.241) (-2054.681) [-2065.219] * (-2057.041) (-2055.522) [-2054.148] (-2062.687) -- 0:06:11
19000 -- [-2061.245] (-2058.024) (-2053.500) (-2060.786) * (-2056.748) [-2054.859] (-2058.944) (-2059.512) -- 0:06:01
19500 -- (-2064.455) [-2054.737] (-2054.855) (-2051.481) * [-2050.621] (-2064.941) (-2061.103) (-2060.211) -- 0:05:51
20000 -- (-2061.910) (-2059.632) [-2061.297] (-2048.861) * (-2059.318) (-2056.166) (-2055.836) [-2056.869] -- 0:05:43
Average standard deviation of split frequencies: 0.013686
20500 -- (-2061.339) (-2064.040) (-2056.764) [-2050.522] * (-2056.768) (-2055.622) [-2052.029] (-2064.980) -- 0:05:34
21000 -- (-2070.773) [-2060.800] (-2064.771) (-2055.976) * (-2058.892) (-2049.765) (-2055.709) [-2059.675] -- 0:06:12
21500 -- (-2057.511) (-2059.175) (-2055.413) [-2054.880] * (-2057.147) [-2048.944] (-2060.305) (-2056.574) -- 0:06:04
22000 -- (-2056.418) [-2054.927] (-2055.195) (-2059.596) * (-2054.053) (-2050.087) [-2057.005] (-2063.591) -- 0:05:55
22500 -- (-2068.928) [-2059.804] (-2055.174) (-2055.492) * [-2052.712] (-2059.784) (-2057.873) (-2058.302) -- 0:05:47
23000 -- (-2056.253) (-2058.162) (-2058.616) [-2054.590] * (-2057.633) (-2059.156) [-2060.780] (-2061.221) -- 0:05:39
23500 -- (-2062.121) [-2060.312] (-2056.130) (-2050.741) * (-2055.562) (-2062.651) (-2062.387) [-2059.920] -- 0:05:32
24000 -- [-2060.108] (-2058.187) (-2058.563) (-2053.315) * [-2060.493] (-2054.949) (-2064.878) (-2057.053) -- 0:06:06
24500 -- (-2063.452) (-2055.677) (-2065.036) [-2052.560] * (-2061.010) (-2054.026) (-2057.831) [-2057.230] -- 0:05:58
25000 -- (-2061.061) (-2057.621) (-2056.638) [-2051.484] * (-2061.561) (-2053.929) [-2055.736] (-2058.231) -- 0:05:51
Average standard deviation of split frequencies: 0.024175
25500 -- (-2059.821) (-2053.035) (-2058.547) [-2054.145] * (-2057.272) (-2052.332) (-2059.019) [-2056.043] -- 0:05:43
26000 -- [-2065.322] (-2053.294) (-2053.605) (-2050.694) * (-2057.648) (-2064.723) [-2054.762] (-2058.338) -- 0:05:37
26500 -- [-2062.946] (-2055.708) (-2063.382) (-2055.148) * [-2054.970] (-2068.420) (-2057.697) (-2058.498) -- 0:05:30
27000 -- (-2055.198) (-2056.846) [-2058.676] (-2055.795) * [-2052.190] (-2056.729) (-2059.319) (-2054.340) -- 0:06:00
27500 -- (-2057.671) (-2059.694) (-2059.446) [-2059.949] * (-2058.449) (-2055.601) (-2062.265) [-2057.219] -- 0:05:53
28000 -- [-2055.024] (-2058.296) (-2052.583) (-2062.167) * (-2061.167) (-2062.808) (-2060.194) [-2063.131] -- 0:05:47
28500 -- (-2058.071) (-2064.976) [-2053.015] (-2055.309) * (-2055.760) (-2061.259) (-2060.652) [-2057.138] -- 0:05:40
29000 -- (-2068.907) (-2064.934) [-2054.381] (-2054.125) * (-2059.418) (-2056.807) (-2058.449) [-2059.644] -- 0:05:34
29500 -- (-2057.729) (-2062.196) [-2059.511] (-2058.279) * (-2059.375) (-2052.769) [-2060.253] (-2057.107) -- 0:05:28
30000 -- (-2054.077) (-2059.767) (-2058.580) [-2057.574] * (-2052.816) [-2057.800] (-2057.922) (-2062.970) -- 0:05:55
Average standard deviation of split frequencies: 0.015372
30500 -- (-2060.719) (-2064.763) (-2056.669) [-2066.887] * [-2052.105] (-2065.296) (-2051.368) (-2063.993) -- 0:05:49
31000 -- [-2052.921] (-2062.186) (-2058.338) (-2054.611) * (-2061.132) [-2049.955] (-2059.163) (-2056.523) -- 0:05:43
31500 -- (-2057.355) (-2063.331) (-2059.776) [-2056.627] * (-2053.345) (-2049.827) (-2052.908) [-2051.123] -- 0:05:38
32000 -- [-2051.581] (-2063.565) (-2057.701) (-2057.913) * (-2060.641) (-2054.926) [-2051.018] (-2052.195) -- 0:05:32
32500 -- (-2057.437) (-2061.335) [-2059.240] (-2057.700) * (-2059.549) (-2056.832) [-2051.094] (-2051.850) -- 0:05:27
33000 -- [-2062.855] (-2066.405) (-2052.195) (-2063.295) * [-2058.171] (-2062.524) (-2059.358) (-2062.300) -- 0:05:51
33500 -- (-2060.381) [-2056.072] (-2060.999) (-2063.577) * (-2058.815) [-2057.153] (-2060.842) (-2059.435) -- 0:05:46
34000 -- [-2052.440] (-2057.614) (-2058.048) (-2059.028) * (-2057.460) (-2068.019) [-2054.901] (-2063.341) -- 0:05:40
34500 -- (-2060.235) (-2055.285) (-2058.655) [-2060.411] * (-2062.857) (-2055.598) [-2059.990] (-2062.931) -- 0:05:35
35000 -- (-2055.285) (-2055.120) [-2055.987] (-2059.314) * (-2053.815) [-2059.147] (-2059.970) (-2057.352) -- 0:05:30
Average standard deviation of split frequencies: 0.021824
35500 -- (-2055.816) (-2064.342) [-2053.957] (-2054.391) * (-2052.723) [-2055.536] (-2060.435) (-2060.659) -- 0:05:53
36000 -- [-2054.551] (-2060.949) (-2056.592) (-2055.196) * (-2053.007) (-2054.573) (-2059.259) [-2054.696] -- 0:05:48
36500 -- (-2051.179) (-2054.487) (-2056.029) [-2060.533] * (-2061.435) (-2061.111) (-2063.213) [-2056.027] -- 0:05:43
37000 -- [-2049.843] (-2056.404) (-2054.318) (-2058.899) * (-2057.314) (-2057.820) [-2063.613] (-2056.748) -- 0:05:38
37500 -- (-2053.537) [-2056.893] (-2058.669) (-2053.227) * [-2054.773] (-2059.448) (-2059.411) (-2058.087) -- 0:05:33
38000 -- (-2059.281) (-2055.252) (-2055.161) [-2056.175] * [-2059.733] (-2059.685) (-2056.832) (-2063.127) -- 0:05:29
38500 -- (-2061.638) [-2052.637] (-2057.091) (-2052.124) * (-2051.839) [-2059.199] (-2059.130) (-2067.164) -- 0:05:49
39000 -- [-2060.609] (-2050.763) (-2053.204) (-2060.163) * (-2055.048) [-2059.662] (-2057.614) (-2059.942) -- 0:05:44
39500 -- (-2051.775) (-2057.565) [-2055.272] (-2062.925) * (-2059.718) (-2060.281) (-2054.948) [-2059.475] -- 0:05:40
40000 -- (-2051.514) (-2056.669) [-2051.615] (-2065.969) * [-2058.939] (-2063.111) (-2060.353) (-2054.923) -- 0:05:36
Average standard deviation of split frequencies: 0.023184
40500 -- (-2056.265) (-2053.103) (-2055.182) [-2059.977] * (-2062.692) (-2061.302) [-2056.722] (-2058.708) -- 0:05:31
41000 -- (-2055.268) (-2058.634) (-2063.395) [-2053.118] * [-2051.864] (-2065.592) (-2053.186) (-2064.374) -- 0:05:27
41500 -- (-2049.832) (-2059.093) (-2051.885) [-2057.176] * (-2058.247) (-2068.429) [-2050.461] (-2057.309) -- 0:05:46
42000 -- [-2054.221] (-2062.097) (-2054.659) (-2054.382) * (-2050.795) [-2057.554] (-2050.291) (-2058.511) -- 0:05:42
42500 -- (-2061.321) [-2056.897] (-2055.329) (-2058.814) * (-2052.249) (-2052.915) (-2055.812) [-2059.872] -- 0:05:37
43000 -- (-2061.658) [-2059.679] (-2057.624) (-2061.619) * (-2059.224) (-2057.974) (-2052.555) [-2061.305] -- 0:05:33
43500 -- [-2054.865] (-2059.447) (-2065.610) (-2057.097) * (-2062.806) (-2059.899) [-2059.718] (-2061.363) -- 0:05:29
44000 -- (-2054.198) [-2056.752] (-2058.197) (-2057.110) * (-2061.261) [-2059.555] (-2054.627) (-2060.684) -- 0:05:25
44500 -- (-2061.451) [-2052.884] (-2051.456) (-2055.775) * [-2068.125] (-2061.547) (-2063.921) (-2057.619) -- 0:05:43
45000 -- (-2056.553) (-2056.721) (-2053.908) [-2049.820] * (-2056.684) (-2055.002) (-2059.213) [-2055.769] -- 0:05:39
Average standard deviation of split frequencies: 0.030744
45500 -- (-2054.490) (-2060.102) [-2054.931] (-2055.693) * (-2063.724) (-2054.821) (-2049.571) [-2055.286] -- 0:05:35
46000 -- (-2063.223) [-2053.026] (-2060.799) (-2054.757) * [-2050.020] (-2051.941) (-2052.498) (-2057.089) -- 0:05:31
46500 -- [-2054.583] (-2055.685) (-2054.626) (-2052.204) * (-2055.605) (-2060.050) [-2054.394] (-2056.607) -- 0:05:28
47000 -- [-2052.541] (-2052.605) (-2057.842) (-2052.409) * [-2056.662] (-2053.516) (-2050.121) (-2052.412) -- 0:05:24
47500 -- (-2064.654) [-2054.439] (-2056.296) (-2062.568) * (-2065.679) [-2052.402] (-2051.039) (-2060.448) -- 0:05:40
48000 -- (-2052.246) (-2049.598) [-2053.110] (-2054.179) * (-2061.750) [-2052.843] (-2051.758) (-2057.707) -- 0:05:37
48500 -- (-2049.330) (-2052.649) (-2053.597) [-2051.770] * (-2055.131) [-2051.121] (-2062.150) (-2066.094) -- 0:05:33
49000 -- [-2057.599] (-2054.012) (-2051.363) (-2054.164) * [-2055.771] (-2051.541) (-2054.151) (-2056.423) -- 0:05:29
49500 -- (-2061.573) (-2054.329) [-2053.549] (-2059.630) * [-2051.456] (-2049.401) (-2055.639) (-2058.540) -- 0:05:26
50000 -- (-2056.865) [-2063.198] (-2056.072) (-2062.624) * [-2051.792] (-2056.294) (-2052.417) (-2052.952) -- 0:05:23
Average standard deviation of split frequencies: 0.031013
50500 -- [-2055.642] (-2062.162) (-2054.760) (-2063.466) * [-2056.812] (-2056.217) (-2052.832) (-2054.885) -- 0:05:38
51000 -- (-2056.664) [-2051.613] (-2054.436) (-2056.710) * [-2057.649] (-2051.630) (-2052.897) (-2053.017) -- 0:05:34
51500 -- [-2063.145] (-2060.360) (-2058.894) (-2060.108) * (-2052.322) [-2062.009] (-2054.338) (-2058.662) -- 0:05:31
52000 -- (-2060.282) (-2053.041) (-2058.274) [-2056.611] * [-2053.220] (-2055.337) (-2058.802) (-2054.434) -- 0:05:28
52500 -- (-2060.436) (-2059.918) [-2054.510] (-2064.359) * [-2052.424] (-2058.182) (-2061.177) (-2057.474) -- 0:05:24
53000 -- (-2058.201) [-2057.920] (-2057.401) (-2064.792) * (-2055.962) [-2053.774] (-2053.283) (-2054.587) -- 0:05:39
53500 -- (-2059.455) (-2071.978) [-2055.496] (-2061.002) * (-2054.710) [-2055.799] (-2058.330) (-2058.351) -- 0:05:36
54000 -- (-2052.784) [-2053.516] (-2060.689) (-2067.034) * (-2054.266) (-2060.224) (-2053.063) [-2055.177] -- 0:05:32
54500 -- (-2063.156) (-2054.162) [-2061.032] (-2057.853) * [-2055.281] (-2053.508) (-2059.682) (-2060.567) -- 0:05:29
55000 -- [-2054.503] (-2056.223) (-2060.984) (-2057.831) * (-2056.839) (-2052.429) [-2053.825] (-2055.508) -- 0:05:26
Average standard deviation of split frequencies: 0.019642
55500 -- [-2053.449] (-2054.560) (-2060.697) (-2059.662) * (-2057.630) [-2060.118] (-2054.771) (-2053.549) -- 0:05:23
56000 -- (-2056.716) (-2054.939) [-2057.548] (-2058.698) * (-2062.711) (-2054.636) [-2055.828] (-2056.749) -- 0:05:37
56500 -- (-2053.440) [-2055.797] (-2059.551) (-2057.722) * (-2062.239) (-2055.887) (-2054.486) [-2056.609] -- 0:05:33
57000 -- (-2056.028) [-2056.419] (-2053.571) (-2055.212) * (-2058.558) (-2058.292) (-2057.406) [-2059.077] -- 0:05:30
57500 -- [-2057.989] (-2061.211) (-2049.810) (-2057.654) * [-2059.698] (-2063.528) (-2055.949) (-2059.112) -- 0:05:27
58000 -- [-2055.971] (-2056.660) (-2059.599) (-2059.047) * (-2065.268) (-2056.935) [-2053.882] (-2056.689) -- 0:05:24
58500 -- [-2052.730] (-2054.644) (-2061.603) (-2059.770) * [-2060.467] (-2061.839) (-2055.542) (-2061.075) -- 0:05:21
59000 -- (-2051.338) [-2062.133] (-2057.826) (-2061.060) * (-2057.130) (-2060.403) [-2048.499] (-2057.284) -- 0:05:34
59500 -- (-2055.042) [-2051.020] (-2062.406) (-2054.425) * (-2061.249) (-2060.174) (-2054.128) [-2059.693] -- 0:05:31
60000 -- (-2055.727) (-2056.141) [-2062.990] (-2057.484) * [-2053.348] (-2058.835) (-2056.283) (-2057.031) -- 0:05:29
Average standard deviation of split frequencies: 0.015541
60500 -- [-2066.037] (-2053.979) (-2057.148) (-2062.393) * (-2057.096) (-2058.935) [-2053.265] (-2057.163) -- 0:05:26
61000 -- (-2054.627) (-2058.274) (-2069.448) [-2062.325] * [-2055.569] (-2051.936) (-2063.487) (-2058.740) -- 0:05:23
61500 -- [-2056.590] (-2057.521) (-2061.944) (-2058.431) * [-2064.334] (-2055.393) (-2056.291) (-2055.650) -- 0:05:20
62000 -- (-2061.318) (-2061.387) (-2069.538) [-2060.844] * [-2066.317] (-2060.255) (-2057.643) (-2062.422) -- 0:05:32
62500 -- (-2059.223) [-2051.470] (-2061.963) (-2065.633) * (-2065.066) [-2057.576] (-2057.612) (-2057.673) -- 0:05:30
63000 -- (-2060.835) (-2054.086) (-2061.090) [-2058.161] * [-2054.838] (-2055.620) (-2057.172) (-2056.612) -- 0:05:27
63500 -- (-2060.221) [-2050.615] (-2063.539) (-2058.304) * (-2056.770) (-2057.762) (-2059.154) [-2055.445] -- 0:05:24
64000 -- (-2062.092) [-2052.252] (-2062.987) (-2060.121) * (-2060.175) (-2060.703) [-2052.397] (-2051.021) -- 0:05:21
64500 -- (-2051.825) (-2062.034) (-2061.103) [-2060.093] * (-2061.597) (-2054.341) [-2057.442] (-2062.153) -- 0:05:19
65000 -- (-2058.993) (-2054.007) (-2058.315) [-2053.147] * (-2061.695) [-2050.082] (-2054.209) (-2056.478) -- 0:05:30
Average standard deviation of split frequencies: 0.005952
65500 -- (-2057.009) (-2064.002) (-2056.568) [-2056.956] * [-2055.078] (-2052.765) (-2054.436) (-2061.136) -- 0:05:28
66000 -- (-2057.086) (-2062.251) (-2053.004) [-2066.879] * (-2062.167) [-2056.787] (-2059.760) (-2057.221) -- 0:05:25
66500 -- (-2062.239) [-2065.520] (-2058.004) (-2057.859) * [-2055.228] (-2056.468) (-2060.045) (-2055.308) -- 0:05:22
67000 -- [-2057.035] (-2068.961) (-2059.964) (-2055.267) * (-2052.332) (-2055.939) [-2063.217] (-2059.280) -- 0:05:20
67500 -- (-2057.086) (-2063.115) (-2061.758) [-2051.824] * (-2054.863) [-2053.971] (-2054.415) (-2064.456) -- 0:05:31
68000 -- [-2053.865] (-2060.973) (-2054.424) (-2053.026) * (-2054.537) (-2059.471) [-2060.709] (-2068.059) -- 0:05:28
68500 -- (-2050.540) (-2057.501) (-2064.052) [-2055.392] * (-2059.096) [-2060.491] (-2059.138) (-2064.939) -- 0:05:26
69000 -- (-2056.628) (-2056.240) (-2063.633) [-2052.808] * (-2055.555) [-2061.368] (-2052.643) (-2062.640) -- 0:05:23
69500 -- (-2057.993) (-2056.673) (-2052.298) [-2053.472] * [-2055.324] (-2068.209) (-2055.478) (-2066.070) -- 0:05:21
70000 -- (-2060.122) (-2061.143) [-2060.063] (-2058.804) * [-2064.239] (-2065.819) (-2057.810) (-2056.392) -- 0:05:18
Average standard deviation of split frequencies: 0.010006
70500 -- (-2053.440) (-2065.525) [-2052.989] (-2051.766) * (-2059.361) [-2062.374] (-2055.966) (-2058.560) -- 0:05:29
71000 -- (-2052.041) (-2066.549) (-2055.237) [-2055.216] * (-2056.550) (-2065.377) (-2053.410) [-2061.097] -- 0:05:27
71500 -- [-2056.804] (-2058.603) (-2054.432) (-2055.165) * [-2056.699] (-2064.904) (-2059.459) (-2059.706) -- 0:05:24
72000 -- (-2056.543) [-2053.448] (-2056.757) (-2057.302) * [-2052.527] (-2057.813) (-2059.172) (-2056.345) -- 0:05:22
72500 -- (-2059.374) (-2058.121) (-2067.536) [-2051.784] * (-2058.298) (-2062.294) (-2061.684) [-2055.905] -- 0:05:19
73000 -- (-2060.996) (-2063.521) [-2054.125] (-2053.216) * (-2055.884) [-2055.242] (-2058.353) (-2053.112) -- 0:05:17
73500 -- (-2063.523) (-2057.355) [-2053.153] (-2049.038) * (-2060.972) (-2058.648) (-2051.266) [-2052.537] -- 0:05:27
74000 -- (-2064.284) (-2056.068) [-2049.045] (-2058.271) * (-2059.868) (-2062.964) (-2059.217) [-2051.605] -- 0:05:25
74500 -- (-2062.858) (-2066.724) (-2054.155) [-2056.949] * [-2057.635] (-2056.638) (-2055.410) (-2056.285) -- 0:05:22
75000 -- (-2054.519) (-2064.664) (-2057.679) [-2055.869] * (-2053.725) (-2061.471) (-2059.357) [-2056.192] -- 0:05:20
Average standard deviation of split frequencies: 0.007236
75500 -- (-2064.964) (-2056.570) (-2058.091) [-2059.549] * (-2053.055) (-2053.840) (-2059.312) [-2057.544] -- 0:05:18
76000 -- [-2051.465] (-2055.429) (-2056.605) (-2056.626) * (-2060.349) [-2065.925] (-2064.025) (-2055.111) -- 0:05:16
76500 -- [-2051.380] (-2059.245) (-2057.527) (-2065.949) * [-2056.792] (-2053.248) (-2057.320) (-2055.293) -- 0:05:25
77000 -- (-2057.594) (-2057.369) (-2056.311) [-2057.170] * (-2061.072) (-2059.230) [-2049.938] (-2049.414) -- 0:05:23
77500 -- (-2057.842) (-2062.781) (-2060.637) [-2062.157] * (-2062.373) (-2052.245) (-2056.313) [-2053.482] -- 0:05:21
78000 -- (-2050.779) [-2055.395] (-2054.791) (-2057.936) * (-2062.996) (-2057.633) (-2056.713) [-2052.179] -- 0:05:19
78500 -- (-2058.430) (-2058.474) [-2052.689] (-2058.007) * (-2051.674) (-2052.551) (-2054.646) [-2051.648] -- 0:05:16
79000 -- (-2054.870) (-2056.810) (-2061.062) [-2057.616] * [-2058.037] (-2051.588) (-2057.072) (-2060.843) -- 0:05:14
79500 -- [-2058.406] (-2051.007) (-2061.230) (-2056.652) * (-2058.920) (-2058.143) [-2052.406] (-2059.881) -- 0:05:24
80000 -- (-2057.374) [-2055.642] (-2065.999) (-2058.084) * (-2058.022) (-2056.950) (-2056.093) [-2050.901] -- 0:05:22
Average standard deviation of split frequencies: 0.002922
80500 -- (-2055.434) (-2048.887) [-2063.731] (-2064.601) * (-2060.955) (-2056.218) (-2056.113) [-2052.648] -- 0:05:19
81000 -- (-2052.525) (-2070.545) [-2056.790] (-2070.653) * [-2060.086] (-2062.878) (-2052.570) (-2059.934) -- 0:05:17
81500 -- (-2057.781) (-2056.989) (-2056.423) [-2053.984] * (-2058.574) [-2055.637] (-2056.423) (-2058.864) -- 0:05:15
82000 -- [-2054.473] (-2055.637) (-2062.442) (-2052.228) * (-2055.266) (-2056.183) [-2052.956] (-2054.751) -- 0:05:13
82500 -- (-2056.562) (-2062.540) [-2057.635] (-2053.771) * [-2055.548] (-2057.752) (-2055.929) (-2056.171) -- 0:05:22
83000 -- (-2061.807) (-2057.433) (-2064.164) [-2056.068] * (-2053.984) (-2056.936) (-2060.605) [-2057.870] -- 0:05:20
83500 -- (-2055.359) (-2055.935) (-2062.337) [-2057.257] * (-2053.794) (-2062.095) [-2053.661] (-2058.368) -- 0:05:18
84000 -- (-2051.931) (-2061.189) (-2053.338) [-2058.706] * [-2054.085] (-2052.149) (-2061.859) (-2062.721) -- 0:05:16
84500 -- (-2057.198) (-2064.806) (-2050.038) [-2058.727] * (-2054.436) [-2058.213] (-2059.244) (-2052.910) -- 0:05:14
85000 -- [-2054.303] (-2059.334) (-2059.263) (-2057.937) * [-2057.774] (-2059.418) (-2057.870) (-2055.051) -- 0:05:22
Average standard deviation of split frequencies: 0.008222
85500 -- (-2057.669) (-2055.946) [-2056.102] (-2054.124) * [-2054.709] (-2063.534) (-2060.125) (-2056.768) -- 0:05:20
86000 -- (-2048.706) (-2065.175) (-2052.573) [-2056.394] * [-2052.285] (-2057.937) (-2057.335) (-2063.029) -- 0:05:18
86500 -- (-2056.345) (-2055.754) [-2052.263] (-2056.133) * (-2054.283) [-2056.990] (-2065.906) (-2056.035) -- 0:05:16
87000 -- (-2059.344) (-2062.183) (-2053.109) [-2056.379] * (-2057.113) [-2059.333] (-2058.335) (-2053.209) -- 0:05:14
87500 -- (-2059.526) [-2059.051] (-2055.547) (-2056.729) * (-2053.511) [-2051.544] (-2062.754) (-2060.323) -- 0:05:12
88000 -- (-2065.771) [-2058.834] (-2058.007) (-2070.012) * [-2053.954] (-2053.940) (-2058.636) (-2068.863) -- 0:05:21
88500 -- (-2058.464) [-2063.733] (-2071.783) (-2062.140) * (-2055.870) (-2055.024) [-2055.476] (-2057.889) -- 0:05:19
89000 -- [-2048.185] (-2062.387) (-2074.119) (-2060.901) * [-2058.356] (-2054.364) (-2059.956) (-2057.142) -- 0:05:17
89500 -- (-2056.371) [-2051.674] (-2056.049) (-2057.447) * (-2062.468) (-2052.972) (-2056.425) [-2055.674] -- 0:05:15
90000 -- (-2056.695) [-2056.885] (-2055.510) (-2055.996) * (-2056.264) (-2057.415) (-2050.818) [-2049.489] -- 0:05:13
Average standard deviation of split frequencies: 0.009532
90500 -- [-2057.482] (-2052.779) (-2062.686) (-2056.898) * [-2061.585] (-2057.306) (-2056.086) (-2056.459) -- 0:05:11
91000 -- (-2058.445) (-2057.194) (-2054.964) [-2055.431] * (-2061.490) (-2054.670) [-2051.308] (-2057.857) -- 0:05:19
91500 -- (-2055.243) (-2057.266) (-2053.855) [-2057.888] * (-2057.942) (-2060.853) (-2060.617) [-2053.319] -- 0:05:17
92000 -- [-2052.951] (-2058.288) (-2059.988) (-2062.589) * [-2061.994] (-2058.352) (-2050.655) (-2052.647) -- 0:05:15
92500 -- [-2055.828] (-2057.221) (-2059.186) (-2064.370) * [-2062.711] (-2054.418) (-2052.352) (-2058.088) -- 0:05:13
93000 -- (-2056.167) (-2062.380) [-2057.087] (-2061.575) * (-2062.036) (-2057.170) [-2057.696] (-2058.034) -- 0:05:12
93500 -- [-2057.822] (-2064.022) (-2055.588) (-2063.855) * (-2064.609) [-2052.595] (-2052.719) (-2055.666) -- 0:05:10
94000 -- [-2057.749] (-2053.525) (-2060.694) (-2062.861) * (-2057.389) (-2054.491) [-2058.243] (-2055.926) -- 0:05:18
94500 -- [-2056.223] (-2053.694) (-2054.618) (-2059.729) * [-2059.171] (-2063.052) (-2052.261) (-2058.124) -- 0:05:16
95000 -- (-2054.152) [-2054.867] (-2057.260) (-2064.578) * (-2055.013) (-2063.465) (-2058.651) [-2059.482] -- 0:05:14
Average standard deviation of split frequencies: 0.009003
95500 -- (-2054.117) (-2057.797) (-2062.482) [-2058.024] * (-2063.638) (-2063.744) (-2056.178) [-2053.940] -- 0:05:12
96000 -- (-2064.580) (-2053.608) [-2058.397] (-2059.054) * (-2056.753) (-2066.717) (-2051.232) [-2051.022] -- 0:05:10
96500 -- [-2053.321] (-2053.647) (-2059.383) (-2057.862) * [-2058.545] (-2062.564) (-2052.647) (-2054.916) -- 0:05:08
97000 -- [-2052.820] (-2064.398) (-2058.997) (-2060.031) * (-2062.368) (-2057.038) [-2051.070] (-2055.134) -- 0:05:16
97500 -- (-2059.309) (-2053.449) (-2057.665) [-2054.254] * (-2061.601) [-2059.760] (-2054.960) (-2064.366) -- 0:05:14
98000 -- (-2055.572) (-2057.659) (-2055.056) [-2052.323] * (-2065.629) (-2059.711) [-2057.459] (-2057.114) -- 0:05:12
98500 -- [-2056.859] (-2051.240) (-2058.359) (-2059.791) * [-2053.886] (-2064.355) (-2055.644) (-2055.333) -- 0:05:11
99000 -- (-2055.901) (-2057.425) (-2055.290) [-2058.121] * (-2061.831) (-2062.195) (-2055.910) [-2059.521] -- 0:05:09
99500 -- [-2054.726] (-2052.023) (-2060.549) (-2057.549) * (-2049.755) (-2065.163) [-2056.010] (-2061.889) -- 0:05:16
100000 -- (-2051.828) (-2054.176) [-2056.483] (-2059.574) * (-2056.480) (-2059.316) [-2054.147] (-2056.916) -- 0:05:15
Average standard deviation of split frequencies: 0.010302
100500 -- [-2055.524] (-2057.811) (-2065.561) (-2058.543) * (-2056.606) [-2059.041] (-2049.900) (-2063.218) -- 0:05:13
101000 -- [-2055.977] (-2057.971) (-2059.812) (-2056.395) * (-2057.839) [-2056.953] (-2064.105) (-2055.103) -- 0:05:11
101500 -- (-2057.003) (-2055.813) [-2056.569] (-2059.956) * (-2058.564) (-2056.367) [-2049.693] (-2055.423) -- 0:05:09
102000 -- (-2049.795) (-2057.668) [-2058.732] (-2056.104) * (-2056.250) (-2055.603) [-2057.120] (-2067.610) -- 0:05:08
102500 -- (-2054.101) (-2056.302) (-2057.591) [-2058.370] * (-2057.802) [-2050.223] (-2055.240) (-2052.623) -- 0:05:15
103000 -- (-2053.061) (-2056.223) [-2056.827] (-2051.812) * [-2056.184] (-2060.010) (-2056.081) (-2058.970) -- 0:05:13
103500 -- (-2055.771) (-2063.772) [-2053.381] (-2069.218) * [-2060.829] (-2053.136) (-2056.629) (-2053.497) -- 0:05:11
104000 -- (-2059.017) (-2061.324) (-2049.209) [-2054.321] * (-2057.716) (-2064.638) [-2056.956] (-2055.678) -- 0:05:10
104500 -- (-2053.675) [-2059.843] (-2055.827) (-2052.755) * (-2055.756) (-2055.144) (-2054.850) [-2054.631] -- 0:05:08
105000 -- (-2054.107) [-2058.497] (-2049.796) (-2056.951) * [-2056.220] (-2058.083) (-2052.136) (-2054.685) -- 0:05:06
Average standard deviation of split frequencies: 0.009636
105500 -- (-2058.539) (-2053.427) [-2048.366] (-2053.155) * (-2055.810) (-2051.864) [-2053.731] (-2057.833) -- 0:05:13
106000 -- (-2057.381) (-2056.717) [-2050.671] (-2052.461) * (-2050.259) [-2053.805] (-2052.570) (-2058.831) -- 0:05:12
106500 -- (-2063.460) [-2055.101] (-2057.492) (-2053.994) * (-2056.433) (-2059.732) [-2061.710] (-2057.759) -- 0:05:10
107000 -- (-2056.984) [-2057.074] (-2056.252) (-2053.031) * (-2055.059) [-2056.256] (-2061.291) (-2052.894) -- 0:05:08
107500 -- (-2055.592) [-2055.589] (-2056.033) (-2053.248) * (-2056.093) (-2053.296) (-2057.202) [-2054.337] -- 0:05:07
108000 -- (-2062.867) [-2054.232] (-2055.847) (-2056.751) * [-2050.636] (-2060.727) (-2047.305) (-2063.981) -- 0:05:05
108500 -- (-2056.273) (-2057.969) [-2052.261] (-2063.000) * [-2056.751] (-2056.652) (-2055.562) (-2054.422) -- 0:05:12
109000 -- (-2055.676) (-2061.045) (-2061.648) [-2050.225] * (-2059.753) (-2063.997) (-2055.691) [-2054.513] -- 0:05:10
109500 -- (-2055.459) (-2051.715) (-2059.749) [-2057.490] * (-2055.642) (-2060.957) [-2054.820] (-2053.722) -- 0:05:09
110000 -- (-2058.355) (-2054.832) (-2061.374) [-2054.793] * (-2056.884) (-2059.300) (-2058.605) [-2050.668] -- 0:05:07
Average standard deviation of split frequencies: 0.014909
110500 -- [-2053.086] (-2055.613) (-2054.785) (-2064.118) * (-2061.170) (-2062.948) [-2052.549] (-2056.734) -- 0:05:05
111000 -- (-2056.085) (-2068.719) [-2055.530] (-2066.122) * (-2054.460) [-2051.656] (-2059.282) (-2059.797) -- 0:05:04
111500 -- (-2056.284) [-2057.916] (-2055.069) (-2059.655) * [-2053.078] (-2057.931) (-2056.388) (-2059.172) -- 0:05:10
112000 -- (-2058.128) [-2057.878] (-2064.210) (-2063.807) * (-2050.002) [-2054.705] (-2056.879) (-2058.035) -- 0:05:09
112500 -- (-2059.987) (-2059.470) [-2059.175] (-2058.680) * (-2050.720) (-2059.457) [-2053.040] (-2062.336) -- 0:05:07
113000 -- (-2050.904) [-2054.433] (-2058.709) (-2057.311) * (-2068.853) (-2058.775) [-2052.836] (-2053.661) -- 0:05:06
113500 -- (-2052.335) [-2058.822] (-2061.153) (-2057.364) * [-2057.030] (-2057.344) (-2055.735) (-2054.356) -- 0:05:04
114000 -- [-2056.959] (-2063.998) (-2067.323) (-2055.510) * (-2057.700) (-2057.161) [-2056.485] (-2061.878) -- 0:05:03
114500 -- [-2054.082] (-2059.095) (-2060.854) (-2057.334) * (-2063.471) (-2059.575) [-2056.478] (-2059.352) -- 0:05:09
115000 -- (-2055.563) [-2060.451] (-2064.222) (-2061.055) * [-2058.859] (-2054.036) (-2059.115) (-2053.057) -- 0:05:07
Average standard deviation of split frequencies: 0.012869
115500 -- (-2061.105) (-2066.115) [-2054.145] (-2065.186) * (-2054.880) (-2054.822) (-2066.903) [-2056.383] -- 0:05:06
116000 -- [-2052.318] (-2062.997) (-2059.123) (-2052.742) * (-2065.350) (-2062.019) [-2052.447] (-2054.568) -- 0:05:04
116500 -- [-2052.516] (-2063.066) (-2057.883) (-2053.637) * (-2056.792) (-2063.973) (-2055.710) [-2062.938] -- 0:05:03
117000 -- [-2059.362] (-2059.834) (-2057.051) (-2054.312) * (-2060.781) [-2057.251] (-2053.819) (-2067.060) -- 0:05:01
117500 -- [-2055.300] (-2059.239) (-2059.604) (-2055.924) * (-2057.847) (-2053.744) [-2053.283] (-2067.652) -- 0:05:07
118000 -- (-2057.000) (-2059.828) (-2053.692) [-2058.405] * (-2052.510) (-2075.757) (-2059.153) [-2055.364] -- 0:05:06
118500 -- (-2052.555) (-2066.735) [-2055.421] (-2061.110) * (-2058.979) [-2053.767] (-2055.593) (-2060.160) -- 0:05:04
119000 -- [-2055.403] (-2058.721) (-2054.634) (-2061.855) * [-2052.399] (-2062.590) (-2056.893) (-2057.708) -- 0:05:03
119500 -- [-2056.907] (-2053.083) (-2062.361) (-2056.653) * [-2055.949] (-2053.661) (-2055.596) (-2071.110) -- 0:05:02
120000 -- (-2055.298) (-2057.116) (-2061.029) [-2057.503] * [-2061.539] (-2062.182) (-2057.509) (-2063.523) -- 0:05:08
Average standard deviation of split frequencies: 0.012371
120500 -- [-2048.724] (-2056.465) (-2055.537) (-2055.007) * [-2052.118] (-2066.725) (-2052.939) (-2064.783) -- 0:05:06
121000 -- (-2066.309) (-2051.637) [-2057.206] (-2057.555) * [-2050.866] (-2067.678) (-2057.620) (-2060.022) -- 0:05:05
121500 -- (-2061.423) (-2058.824) [-2056.820] (-2063.435) * [-2058.514] (-2062.460) (-2059.763) (-2058.052) -- 0:05:03
122000 -- (-2059.780) [-2058.460] (-2061.661) (-2056.071) * (-2058.162) (-2060.251) (-2058.958) [-2054.512] -- 0:05:02
122500 -- (-2051.739) (-2052.451) (-2060.417) [-2061.635] * (-2056.768) [-2059.026] (-2051.431) (-2065.877) -- 0:05:00
123000 -- (-2055.081) (-2055.574) [-2053.648] (-2060.910) * [-2056.972] (-2060.839) (-2056.674) (-2062.867) -- 0:05:06
123500 -- [-2063.427] (-2056.705) (-2064.908) (-2056.641) * (-2058.187) [-2059.428] (-2055.528) (-2056.126) -- 0:05:05
124000 -- (-2054.350) [-2056.414] (-2059.936) (-2055.671) * [-2054.736] (-2056.314) (-2060.865) (-2059.105) -- 0:05:03
124500 -- (-2060.866) (-2058.949) [-2059.917] (-2061.753) * (-2051.541) [-2055.202] (-2051.153) (-2059.230) -- 0:05:02
125000 -- [-2051.999] (-2060.133) (-2053.418) (-2049.875) * (-2049.997) (-2056.109) (-2052.620) [-2056.873] -- 0:05:01
Average standard deviation of split frequencies: 0.011847
125500 -- (-2053.848) (-2070.130) [-2056.226] (-2058.023) * (-2053.197) [-2055.707] (-2051.375) (-2062.851) -- 0:04:59
126000 -- [-2054.178] (-2055.591) (-2058.860) (-2054.928) * (-2053.910) (-2060.511) (-2052.291) [-2066.459] -- 0:05:05
126500 -- [-2062.543] (-2055.601) (-2055.487) (-2053.658) * (-2063.483) (-2060.345) (-2055.372) [-2059.638] -- 0:05:03
127000 -- (-2058.354) (-2062.426) [-2061.255] (-2054.869) * [-2061.705] (-2055.000) (-2058.167) (-2057.256) -- 0:05:02
127500 -- (-2059.169) (-2058.160) (-2058.479) [-2050.978] * (-2062.678) (-2058.307) [-2060.644] (-2058.937) -- 0:05:01
128000 -- (-2064.444) [-2051.175] (-2062.999) (-2055.710) * [-2048.794] (-2061.232) (-2061.261) (-2059.374) -- 0:04:59
128500 -- (-2060.392) [-2053.870] (-2058.021) (-2050.728) * [-2055.631] (-2058.379) (-2055.340) (-2061.215) -- 0:04:58
129000 -- (-2055.158) [-2058.447] (-2049.819) (-2054.440) * (-2066.068) [-2058.965] (-2059.366) (-2053.961) -- 0:05:03
129500 -- (-2054.820) [-2055.294] (-2057.823) (-2060.743) * (-2062.373) [-2060.098] (-2059.326) (-2067.466) -- 0:05:02
130000 -- (-2053.303) [-2056.409] (-2061.994) (-2059.107) * (-2059.422) (-2059.443) (-2058.046) [-2060.341] -- 0:05:01
Average standard deviation of split frequencies: 0.013829
130500 -- (-2053.775) [-2053.242] (-2056.888) (-2057.096) * (-2057.119) [-2062.157] (-2056.764) (-2054.959) -- 0:04:59
131000 -- (-2062.624) [-2050.954] (-2060.952) (-2056.762) * (-2058.496) (-2054.720) (-2060.599) [-2062.892] -- 0:04:58
131500 -- (-2061.050) [-2051.358] (-2056.470) (-2055.047) * [-2057.379] (-2054.244) (-2058.429) (-2056.121) -- 0:05:03
132000 -- [-2057.503] (-2057.878) (-2056.769) (-2054.939) * [-2056.277] (-2055.742) (-2062.520) (-2055.586) -- 0:05:02
132500 -- (-2060.191) (-2063.518) (-2052.996) [-2054.786] * (-2050.031) (-2057.479) (-2056.631) [-2053.071] -- 0:05:01
133000 -- (-2053.799) (-2055.318) [-2056.791] (-2058.287) * [-2057.107] (-2054.835) (-2055.217) (-2061.574) -- 0:04:59
133500 -- (-2051.022) (-2057.238) [-2053.734] (-2052.389) * [-2056.412] (-2052.182) (-2059.520) (-2057.768) -- 0:04:58
134000 -- (-2054.577) (-2059.067) (-2059.133) [-2053.566] * (-2061.150) (-2061.283) (-2063.938) [-2053.823] -- 0:04:57
134500 -- (-2061.927) (-2064.133) [-2051.483] (-2056.561) * (-2052.445) [-2053.324] (-2064.064) (-2055.239) -- 0:05:02
135000 -- (-2063.232) [-2052.408] (-2053.058) (-2057.539) * (-2056.700) [-2055.709] (-2055.557) (-2056.257) -- 0:05:01
Average standard deviation of split frequencies: 0.016753
135500 -- [-2054.701] (-2061.415) (-2063.011) (-2061.871) * (-2055.357) [-2051.559] (-2067.928) (-2051.745) -- 0:04:59
136000 -- (-2060.794) (-2053.099) (-2054.490) [-2062.246] * (-2053.577) (-2054.024) (-2058.454) [-2057.893] -- 0:04:58
136500 -- (-2059.326) (-2055.476) (-2052.728) [-2054.778] * (-2055.589) (-2056.817) (-2060.480) [-2049.665] -- 0:04:57
137000 -- [-2061.124] (-2060.716) (-2054.675) (-2056.086) * (-2056.496) [-2052.239] (-2058.750) (-2052.621) -- 0:04:56
137500 -- (-2058.241) (-2056.110) [-2055.346] (-2054.061) * [-2053.575] (-2057.707) (-2060.088) (-2053.528) -- 0:05:01
138000 -- (-2057.765) [-2060.752] (-2056.626) (-2054.852) * [-2052.092] (-2055.424) (-2056.067) (-2055.456) -- 0:04:59
138500 -- [-2056.906] (-2061.709) (-2054.393) (-2053.381) * (-2057.811) [-2052.621] (-2056.282) (-2060.425) -- 0:04:58
139000 -- (-2055.230) (-2061.734) [-2059.268] (-2055.789) * [-2054.500] (-2060.763) (-2054.740) (-2049.804) -- 0:04:57
139500 -- (-2061.263) [-2057.894] (-2055.643) (-2058.114) * (-2054.784) (-2054.369) [-2056.691] (-2049.368) -- 0:04:56
140000 -- (-2054.551) [-2055.563] (-2054.501) (-2056.925) * (-2053.071) (-2050.432) [-2061.261] (-2055.060) -- 0:04:54
Average standard deviation of split frequencies: 0.013963
140500 -- [-2053.855] (-2061.202) (-2061.978) (-2054.004) * (-2058.674) (-2054.406) [-2054.546] (-2059.482) -- 0:04:59
141000 -- (-2067.057) (-2060.434) (-2057.032) [-2049.584] * (-2056.057) (-2058.993) (-2057.385) [-2053.104] -- 0:04:58
141500 -- [-2057.592] (-2054.730) (-2056.627) (-2058.066) * (-2061.966) [-2062.613] (-2062.590) (-2052.843) -- 0:04:57
142000 -- [-2057.301] (-2062.865) (-2061.992) (-2053.132) * (-2055.162) [-2054.986] (-2059.774) (-2053.726) -- 0:04:56
142500 -- (-2060.229) (-2061.674) [-2055.850] (-2054.184) * (-2057.546) [-2054.612] (-2050.251) (-2056.938) -- 0:04:54
143000 -- (-2055.974) (-2056.556) [-2054.746] (-2058.059) * (-2055.993) (-2055.709) (-2053.381) [-2056.204] -- 0:04:53
143500 -- (-2060.254) [-2062.322] (-2060.618) (-2060.019) * (-2056.200) [-2049.713] (-2056.140) (-2057.904) -- 0:04:58
144000 -- (-2058.189) [-2060.986] (-2057.560) (-2061.039) * (-2055.019) (-2054.708) [-2054.287] (-2056.233) -- 0:04:57
144500 -- (-2056.553) [-2057.242] (-2057.112) (-2057.148) * (-2056.205) (-2051.145) [-2052.027] (-2057.487) -- 0:04:56
145000 -- [-2054.910] (-2055.871) (-2060.384) (-2054.097) * [-2055.679] (-2054.098) (-2059.290) (-2055.019) -- 0:04:54
Average standard deviation of split frequencies: 0.010225
145500 -- (-2067.366) (-2055.850) [-2051.939] (-2054.726) * [-2058.402] (-2056.226) (-2054.212) (-2061.009) -- 0:04:53
146000 -- (-2062.703) [-2061.053] (-2060.534) (-2058.205) * (-2064.691) [-2056.210] (-2050.211) (-2065.040) -- 0:04:52
146500 -- (-2061.315) (-2063.648) (-2056.023) [-2057.109] * (-2055.314) (-2055.212) (-2059.240) [-2057.284] -- 0:04:57
147000 -- (-2052.391) (-2058.937) (-2057.165) [-2051.305] * (-2060.936) (-2056.776) (-2057.682) [-2052.070] -- 0:04:55
147500 -- [-2057.190] (-2063.394) (-2057.433) (-2055.199) * (-2063.853) (-2058.134) [-2051.314] (-2051.464) -- 0:04:54
148000 -- [-2060.486] (-2062.015) (-2052.943) (-2054.825) * (-2059.121) (-2063.704) [-2052.273] (-2053.014) -- 0:04:53
148500 -- [-2063.067] (-2055.123) (-2054.038) (-2055.569) * [-2055.260] (-2062.998) (-2056.568) (-2057.403) -- 0:04:52
149000 -- (-2056.075) (-2064.818) (-2050.950) [-2058.486] * [-2054.221] (-2055.607) (-2058.344) (-2055.950) -- 0:04:56
149500 -- (-2063.580) (-2067.269) [-2053.359] (-2060.288) * [-2055.700] (-2057.560) (-2058.193) (-2054.490) -- 0:04:55
150000 -- (-2058.219) (-2055.298) (-2061.665) [-2051.281] * (-2057.361) [-2054.116] (-2061.194) (-2053.934) -- 0:04:54
Average standard deviation of split frequencies: 0.006779
150500 -- (-2064.127) (-2050.446) [-2057.498] (-2054.432) * (-2057.454) (-2060.232) [-2057.086] (-2056.003) -- 0:04:53
151000 -- (-2061.226) (-2054.554) [-2055.231] (-2056.715) * (-2052.107) (-2056.278) (-2060.723) [-2054.347] -- 0:04:52
151500 -- (-2060.936) (-2055.248) (-2061.987) [-2056.656] * (-2057.214) [-2049.274] (-2062.361) (-2054.308) -- 0:04:51
152000 -- (-2063.589) (-2061.303) [-2057.300] (-2051.491) * [-2053.157] (-2052.354) (-2064.373) (-2052.895) -- 0:04:55
152500 -- (-2068.331) (-2058.663) [-2053.702] (-2049.650) * (-2056.673) [-2054.368] (-2059.933) (-2058.495) -- 0:04:54
153000 -- (-2064.235) [-2057.598] (-2054.033) (-2057.375) * (-2063.295) (-2063.146) (-2058.723) [-2055.488] -- 0:04:53
153500 -- (-2059.459) (-2059.276) (-2056.730) [-2049.795] * (-2056.828) [-2057.408] (-2057.099) (-2056.066) -- 0:04:52
154000 -- (-2060.273) (-2053.869) (-2059.332) [-2054.638] * (-2064.427) (-2059.959) [-2059.623] (-2054.115) -- 0:04:51
154500 -- (-2060.909) (-2056.673) [-2059.894] (-2061.441) * (-2055.220) (-2052.645) [-2060.349] (-2054.745) -- 0:04:50
155000 -- (-2056.150) (-2059.727) (-2060.794) [-2056.944] * (-2059.362) (-2053.655) [-2057.968] (-2062.193) -- 0:04:54
Average standard deviation of split frequencies: 0.006547
155500 -- (-2059.670) (-2058.964) (-2056.215) [-2057.748] * (-2054.275) (-2057.180) (-2052.673) [-2051.333] -- 0:04:53
156000 -- (-2061.938) [-2055.904] (-2055.613) (-2060.791) * (-2056.221) [-2054.718] (-2059.994) (-2054.535) -- 0:04:52
156500 -- (-2059.840) [-2053.801] (-2055.725) (-2066.090) * (-2053.464) (-2056.829) (-2058.703) [-2060.521] -- 0:04:51
157000 -- [-2057.763] (-2060.441) (-2059.937) (-2059.958) * (-2049.669) (-2057.749) [-2056.662] (-2062.264) -- 0:04:49
157500 -- [-2053.346] (-2064.310) (-2067.890) (-2056.943) * (-2056.719) (-2059.097) [-2057.455] (-2055.409) -- 0:04:48
158000 -- [-2054.350] (-2055.290) (-2058.754) (-2057.415) * (-2064.905) [-2056.952] (-2053.381) (-2055.367) -- 0:04:53
158500 -- (-2064.556) (-2057.339) (-2057.844) [-2054.880] * (-2060.301) [-2055.230] (-2059.091) (-2059.087) -- 0:04:52
159000 -- [-2055.239] (-2057.464) (-2058.763) (-2063.814) * [-2058.329] (-2062.181) (-2058.231) (-2057.047) -- 0:04:50
159500 -- (-2058.761) [-2051.212] (-2060.681) (-2062.879) * (-2052.296) [-2055.596] (-2063.034) (-2061.527) -- 0:04:49
160000 -- [-2056.846] (-2058.276) (-2049.900) (-2058.793) * [-2051.588] (-2057.370) (-2058.126) (-2057.519) -- 0:04:48
Average standard deviation of split frequencies: 0.009291
160500 -- (-2057.037) (-2055.549) [-2056.860] (-2054.338) * (-2059.352) (-2056.777) (-2054.074) [-2057.947] -- 0:04:47
161000 -- (-2057.141) (-2059.282) (-2057.069) [-2049.945] * (-2061.660) (-2057.453) [-2059.152] (-2052.053) -- 0:04:51
161500 -- (-2061.549) [-2056.553] (-2057.003) (-2058.320) * (-2062.126) [-2061.186] (-2054.291) (-2052.352) -- 0:04:50
162000 -- [-2057.407] (-2054.134) (-2060.300) (-2055.557) * (-2057.505) (-2061.502) (-2050.270) [-2053.262] -- 0:04:49
162500 -- (-2060.248) (-2053.450) [-2053.742] (-2053.525) * (-2058.209) [-2060.446] (-2058.461) (-2057.184) -- 0:04:48
163000 -- (-2056.459) (-2053.575) [-2056.349] (-2055.081) * (-2057.876) (-2057.322) (-2060.276) [-2055.531] -- 0:04:47
163500 -- (-2067.526) (-2054.010) (-2057.208) [-2055.532] * (-2056.125) [-2059.561] (-2054.246) (-2054.394) -- 0:04:51
164000 -- (-2057.818) (-2057.843) (-2054.966) [-2053.604] * (-2057.910) (-2067.774) (-2059.630) [-2060.030] -- 0:04:50
164500 -- [-2054.573] (-2049.269) (-2055.109) (-2054.887) * (-2056.913) (-2055.815) (-2058.101) [-2052.356] -- 0:04:49
165000 -- (-2055.738) [-2056.449] (-2052.442) (-2066.699) * (-2059.371) (-2053.092) [-2055.514] (-2062.772) -- 0:04:48
Average standard deviation of split frequencies: 0.006153
165500 -- (-2063.265) (-2054.876) (-2056.743) [-2055.737] * (-2055.475) [-2052.452] (-2062.700) (-2059.651) -- 0:04:47
166000 -- (-2052.757) (-2053.754) (-2052.388) [-2047.868] * [-2055.708] (-2053.301) (-2061.807) (-2057.901) -- 0:04:46
166500 -- [-2052.567] (-2058.999) (-2054.221) (-2056.673) * [-2056.684] (-2058.080) (-2059.071) (-2054.487) -- 0:04:50
167000 -- (-2054.716) (-2057.368) [-2058.055] (-2049.260) * [-2059.385] (-2063.489) (-2061.405) (-2064.693) -- 0:04:49
167500 -- (-2064.145) [-2058.336] (-2049.373) (-2049.673) * (-2060.656) (-2062.713) (-2056.810) [-2063.099] -- 0:04:48
168000 -- (-2062.965) (-2059.776) [-2056.605] (-2051.826) * [-2056.134] (-2054.857) (-2055.629) (-2058.065) -- 0:04:47
168500 -- (-2061.238) [-2058.005] (-2057.801) (-2062.116) * [-2055.747] (-2054.917) (-2058.952) (-2064.382) -- 0:04:46
169000 -- (-2054.513) [-2058.303] (-2063.212) (-2059.958) * [-2058.909] (-2059.231) (-2054.845) (-2065.596) -- 0:04:45
169500 -- (-2064.922) [-2055.817] (-2061.003) (-2067.496) * [-2058.775] (-2060.660) (-2051.053) (-2066.082) -- 0:04:49
170000 -- (-2060.986) (-2054.391) [-2054.086] (-2056.431) * (-2057.210) [-2050.789] (-2055.161) (-2061.821) -- 0:04:48
Average standard deviation of split frequencies: 0.005985
170500 -- (-2053.544) [-2055.237] (-2052.877) (-2052.237) * (-2056.486) [-2055.391] (-2054.204) (-2058.759) -- 0:04:47
171000 -- (-2053.983) [-2051.084] (-2057.062) (-2056.695) * [-2055.978] (-2060.577) (-2059.971) (-2054.759) -- 0:04:46
171500 -- [-2052.523] (-2053.521) (-2061.743) (-2058.183) * (-2058.383) [-2058.328] (-2064.073) (-2053.992) -- 0:04:45
172000 -- (-2060.684) (-2056.824) (-2054.718) [-2056.538] * [-2060.647] (-2063.715) (-2056.814) (-2061.280) -- 0:04:44
172500 -- (-2054.969) (-2055.055) [-2055.639] (-2053.232) * (-2057.555) (-2060.500) [-2058.758] (-2055.378) -- 0:04:47
173000 -- (-2056.555) [-2053.671] (-2052.422) (-2062.464) * (-2059.322) (-2066.847) [-2058.859] (-2054.427) -- 0:04:46
173500 -- (-2057.994) (-2058.923) (-2056.142) [-2068.205] * (-2059.738) [-2054.233] (-2058.260) (-2049.797) -- 0:04:45
174000 -- (-2060.411) (-2057.399) (-2053.097) [-2056.065] * (-2055.892) [-2050.336] (-2061.785) (-2052.148) -- 0:04:44
174500 -- (-2052.202) (-2051.242) [-2048.193] (-2055.777) * (-2056.430) [-2054.071] (-2055.507) (-2056.745) -- 0:04:43
175000 -- (-2055.282) [-2053.776] (-2053.657) (-2050.978) * (-2059.645) [-2053.550] (-2057.225) (-2054.649) -- 0:04:47
Average standard deviation of split frequencies: 0.007589
175500 -- (-2054.323) (-2058.266) (-2051.658) [-2050.270] * [-2054.885] (-2055.532) (-2062.094) (-2053.786) -- 0:04:46
176000 -- (-2057.983) (-2059.990) [-2052.768] (-2054.460) * (-2056.365) [-2055.835] (-2057.807) (-2058.177) -- 0:04:45
176500 -- (-2059.200) [-2056.252] (-2057.381) (-2052.991) * (-2053.762) [-2052.617] (-2051.989) (-2068.344) -- 0:04:44
177000 -- (-2058.826) [-2054.610] (-2050.630) (-2055.625) * (-2064.506) (-2055.480) [-2061.004] (-2053.926) -- 0:04:43
177500 -- (-2059.265) [-2058.881] (-2053.897) (-2054.824) * (-2066.501) (-2058.229) (-2057.823) [-2053.437] -- 0:04:42
178000 -- [-2053.758] (-2050.160) (-2052.334) (-2059.730) * (-2052.712) (-2054.726) [-2056.206] (-2055.920) -- 0:04:46
178500 -- [-2055.147] (-2065.774) (-2051.378) (-2067.822) * (-2058.603) (-2055.688) [-2063.446] (-2052.685) -- 0:04:45
179000 -- (-2064.324) (-2057.039) [-2054.025] (-2056.659) * [-2052.047] (-2057.401) (-2059.442) (-2058.456) -- 0:04:44
179500 -- (-2058.193) (-2055.191) (-2059.160) [-2052.033] * (-2061.411) [-2052.722] (-2056.869) (-2058.019) -- 0:04:43
180000 -- [-2054.966] (-2054.205) (-2060.265) (-2062.914) * (-2057.587) (-2053.742) (-2057.246) [-2055.475] -- 0:04:42
Average standard deviation of split frequencies: 0.009132
180500 -- (-2059.203) [-2056.476] (-2052.001) (-2049.733) * (-2061.660) (-2054.423) (-2056.333) [-2053.393] -- 0:04:46
181000 -- (-2063.093) (-2052.013) (-2052.747) [-2053.579] * [-2054.534] (-2054.984) (-2059.367) (-2057.257) -- 0:04:45
181500 -- (-2054.889) (-2055.459) [-2057.387] (-2052.712) * (-2063.388) (-2057.736) (-2052.072) [-2050.940] -- 0:04:44
182000 -- (-2055.856) (-2052.999) (-2053.842) [-2058.556] * (-2054.732) [-2055.308] (-2056.414) (-2047.174) -- 0:04:43
182500 -- [-2058.011] (-2060.662) (-2064.466) (-2057.848) * (-2060.935) (-2053.467) (-2054.168) [-2054.078] -- 0:04:42
183000 -- (-2058.010) [-2053.097] (-2054.002) (-2058.749) * (-2066.021) (-2057.517) [-2050.156] (-2056.522) -- 0:04:41
183500 -- (-2062.656) [-2060.532] (-2058.789) (-2066.383) * (-2065.271) (-2057.578) [-2050.085] (-2055.029) -- 0:04:44
184000 -- (-2054.135) (-2061.657) (-2058.802) [-2052.563] * (-2059.162) [-2057.279] (-2056.267) (-2054.153) -- 0:04:43
184500 -- (-2051.995) [-2052.605] (-2054.790) (-2058.479) * (-2052.549) (-2054.026) [-2061.056] (-2052.375) -- 0:04:42
185000 -- (-2055.300) (-2054.382) (-2064.081) [-2051.648] * (-2064.545) [-2053.751] (-2061.564) (-2052.543) -- 0:04:41
Average standard deviation of split frequencies: 0.009715
185500 -- (-2060.185) [-2058.752] (-2052.802) (-2054.186) * (-2068.485) (-2055.393) (-2061.845) [-2053.828] -- 0:04:41
186000 -- (-2061.744) (-2063.587) [-2057.545] (-2060.298) * (-2054.025) (-2053.998) (-2056.251) [-2055.539] -- 0:04:40
186500 -- (-2061.808) [-2052.815] (-2056.711) (-2053.943) * [-2050.255] (-2053.059) (-2060.667) (-2064.519) -- 0:04:43
187000 -- (-2054.318) (-2055.277) [-2059.838] (-2050.835) * [-2052.980] (-2050.592) (-2054.556) (-2054.679) -- 0:04:42
187500 -- (-2061.925) [-2049.600] (-2059.769) (-2059.013) * (-2053.425) (-2056.923) (-2058.010) [-2054.412] -- 0:04:41
188000 -- (-2057.720) [-2057.436] (-2066.474) (-2061.487) * (-2058.630) (-2059.177) (-2054.217) [-2054.905] -- 0:04:40
188500 -- (-2052.442) (-2059.473) [-2061.342] (-2060.476) * (-2065.123) (-2062.558) (-2055.365) [-2054.216] -- 0:04:39
189000 -- [-2054.137] (-2054.169) (-2053.563) (-2056.460) * (-2057.696) (-2058.633) (-2058.518) [-2049.670] -- 0:04:38
189500 -- (-2052.621) (-2059.665) (-2054.021) [-2055.007] * (-2052.115) (-2057.566) [-2055.458] (-2054.967) -- 0:04:42
190000 -- (-2059.048) (-2059.717) (-2064.006) [-2049.331] * (-2060.840) (-2052.487) (-2055.554) [-2055.994] -- 0:04:41
Average standard deviation of split frequencies: 0.010302
190500 -- [-2059.563] (-2055.444) (-2053.549) (-2054.153) * (-2049.932) (-2061.142) (-2070.534) [-2052.863] -- 0:04:40
191000 -- (-2055.011) [-2054.842] (-2052.380) (-2054.765) * [-2054.785] (-2057.192) (-2057.068) (-2066.310) -- 0:04:39
191500 -- (-2062.479) (-2060.933) (-2053.287) [-2051.601] * (-2058.905) (-2054.812) (-2063.165) [-2052.340] -- 0:04:38
192000 -- (-2055.493) [-2053.435] (-2052.810) (-2062.699) * (-2054.851) (-2052.118) [-2056.159] (-2058.972) -- 0:04:37
192500 -- (-2063.990) (-2054.548) [-2059.796] (-2050.642) * (-2055.829) (-2060.412) (-2055.263) [-2064.143] -- 0:04:41
193000 -- (-2058.427) (-2063.720) [-2050.905] (-2059.939) * (-2057.434) [-2057.724] (-2061.921) (-2055.928) -- 0:04:40
193500 -- (-2068.318) (-2056.753) (-2053.968) [-2051.809] * [-2057.964] (-2054.575) (-2055.073) (-2059.629) -- 0:04:39
194000 -- [-2059.607] (-2054.975) (-2054.758) (-2062.462) * [-2053.495] (-2055.138) (-2064.068) (-2056.326) -- 0:04:38
194500 -- [-2058.427] (-2053.906) (-2058.600) (-2058.166) * (-2056.044) (-2054.806) (-2068.044) [-2052.297] -- 0:04:37
195000 -- [-2059.341] (-2060.284) (-2055.639) (-2066.666) * [-2058.944] (-2056.285) (-2059.843) (-2055.968) -- 0:04:36
Average standard deviation of split frequencies: 0.011625
195500 -- (-2063.567) (-2053.679) (-2054.610) [-2061.134] * (-2051.049) (-2048.870) (-2065.310) [-2057.703] -- 0:04:39
196000 -- (-2060.489) (-2052.694) (-2055.489) [-2058.100] * (-2050.443) (-2052.671) (-2059.671) [-2054.801] -- 0:04:38
196500 -- (-2065.319) (-2052.534) (-2060.252) [-2059.552] * (-2052.766) [-2055.591] (-2062.597) (-2062.445) -- 0:04:38
197000 -- (-2054.386) (-2056.392) (-2064.524) [-2056.848] * [-2050.222] (-2057.597) (-2061.763) (-2053.685) -- 0:04:37
197500 -- (-2058.384) [-2054.011] (-2062.399) (-2054.979) * (-2050.006) [-2058.111] (-2061.736) (-2059.695) -- 0:04:36
198000 -- (-2056.236) (-2066.854) (-2065.330) [-2051.877] * (-2059.643) (-2059.235) [-2065.237] (-2060.642) -- 0:04:35
198500 -- (-2052.275) (-2069.950) (-2059.457) [-2054.277] * (-2063.912) (-2061.010) (-2060.913) [-2055.114] -- 0:04:38
199000 -- [-2051.600] (-2064.822) (-2061.943) (-2053.105) * (-2067.955) [-2063.153] (-2063.040) (-2057.441) -- 0:04:37
199500 -- (-2054.664) (-2055.751) [-2054.263] (-2053.814) * (-2058.022) (-2057.297) (-2053.420) [-2057.928] -- 0:04:36
200000 -- (-2054.241) (-2050.042) [-2051.149] (-2059.523) * (-2065.123) [-2058.589] (-2051.109) (-2053.870) -- 0:04:36
Average standard deviation of split frequencies: 0.010571
200500 -- [-2057.760] (-2057.986) (-2054.241) (-2063.824) * (-2057.056) [-2055.978] (-2055.506) (-2050.553) -- 0:04:35
201000 -- [-2055.450] (-2065.088) (-2054.499) (-2054.103) * [-2057.763] (-2057.498) (-2060.179) (-2049.393) -- 0:04:38
201500 -- (-2052.791) (-2059.703) (-2053.701) [-2057.257] * (-2061.022) (-2054.602) (-2055.351) [-2052.517] -- 0:04:37
202000 -- (-2059.676) (-2056.392) (-2056.954) [-2056.691] * [-2054.737] (-2053.857) (-2051.962) (-2052.039) -- 0:04:36
202500 -- (-2053.360) [-2060.803] (-2059.184) (-2064.753) * (-2053.282) (-2063.029) (-2054.224) [-2053.813] -- 0:04:35
203000 -- (-2064.330) [-2054.741] (-2059.546) (-2061.552) * (-2052.837) (-2060.704) [-2054.187] (-2054.353) -- 0:04:34
203500 -- (-2055.327) (-2057.392) (-2058.501) [-2058.042] * (-2052.527) (-2069.442) [-2053.687] (-2061.889) -- 0:04:33
204000 -- (-2059.309) (-2067.175) (-2060.707) [-2060.581] * (-2053.592) (-2059.300) (-2057.180) [-2056.083] -- 0:04:37
204500 -- (-2058.437) (-2061.536) [-2050.542] (-2057.321) * (-2057.159) [-2056.718] (-2054.143) (-2056.054) -- 0:04:36
205000 -- (-2057.134) (-2053.255) [-2058.054] (-2062.228) * (-2055.584) (-2056.863) [-2056.509] (-2063.872) -- 0:04:35
Average standard deviation of split frequencies: 0.008772
205500 -- (-2056.563) (-2051.230) (-2053.304) [-2057.750] * [-2051.866] (-2056.181) (-2057.495) (-2058.141) -- 0:04:34
206000 -- (-2057.651) (-2055.164) (-2057.768) [-2056.072] * (-2059.742) [-2054.190] (-2052.516) (-2057.480) -- 0:04:33
206500 -- (-2063.752) (-2053.720) [-2056.566] (-2053.769) * (-2053.968) (-2058.942) (-2052.852) [-2059.321] -- 0:04:32
207000 -- (-2051.658) (-2055.004) (-2054.970) [-2054.245] * (-2055.550) (-2060.946) (-2057.308) [-2051.309] -- 0:04:35
207500 -- (-2059.279) [-2057.317] (-2060.527) (-2061.680) * (-2063.685) (-2059.937) [-2059.027] (-2055.107) -- 0:04:34
208000 -- (-2054.948) [-2055.319] (-2059.498) (-2062.205) * (-2056.586) [-2061.191] (-2057.562) (-2054.036) -- 0:04:34
208500 -- (-2057.517) [-2052.189] (-2061.285) (-2059.825) * (-2053.611) [-2064.141] (-2056.030) (-2052.985) -- 0:04:33
209000 -- (-2056.529) (-2062.079) [-2051.544] (-2054.535) * (-2050.805) [-2054.912] (-2061.448) (-2056.583) -- 0:04:32
209500 -- (-2060.141) (-2058.154) [-2051.621] (-2061.097) * (-2063.544) [-2055.243] (-2054.028) (-2061.397) -- 0:04:31
210000 -- (-2060.026) (-2051.956) (-2054.277) [-2057.851] * (-2053.546) (-2052.319) (-2055.680) [-2048.680] -- 0:04:34
Average standard deviation of split frequencies: 0.005370
210500 -- (-2055.028) (-2062.715) [-2058.339] (-2057.548) * [-2050.727] (-2057.182) (-2054.890) (-2055.318) -- 0:04:33
211000 -- (-2055.711) (-2059.800) [-2054.513] (-2053.798) * (-2063.242) (-2056.391) [-2055.132] (-2052.542) -- 0:04:32
211500 -- [-2052.473] (-2059.083) (-2060.761) (-2050.013) * [-2059.624] (-2056.372) (-2060.268) (-2065.714) -- 0:04:32
212000 -- (-2054.987) (-2065.290) [-2053.848] (-2053.090) * (-2060.681) [-2055.324] (-2057.428) (-2064.298) -- 0:04:31
212500 -- (-2056.573) (-2060.123) [-2058.337] (-2061.323) * [-2057.919] (-2061.495) (-2060.647) (-2055.770) -- 0:04:30
213000 -- (-2055.935) [-2054.376] (-2057.022) (-2057.688) * (-2058.538) (-2050.288) (-2061.176) [-2052.526] -- 0:04:33
213500 -- (-2051.304) [-2054.945] (-2061.381) (-2060.728) * [-2059.901] (-2057.000) (-2060.199) (-2055.413) -- 0:04:32
214000 -- [-2052.745] (-2054.345) (-2059.053) (-2053.348) * (-2062.043) (-2052.616) (-2056.019) [-2056.362] -- 0:04:31
214500 -- [-2055.293] (-2067.288) (-2064.014) (-2061.168) * [-2051.880] (-2058.096) (-2061.484) (-2055.582) -- 0:04:30
215000 -- (-2057.476) (-2063.524) [-2054.752] (-2056.864) * (-2053.515) (-2056.238) [-2057.499] (-2056.989) -- 0:04:30
Average standard deviation of split frequencies: 0.004365
215500 -- (-2049.632) [-2058.003] (-2053.747) (-2054.561) * (-2055.552) (-2058.849) (-2052.785) [-2059.645] -- 0:04:29
216000 -- [-2054.100] (-2057.970) (-2058.381) (-2055.160) * (-2055.659) (-2063.914) (-2056.168) [-2057.146] -- 0:04:32
216500 -- (-2056.328) [-2054.770] (-2065.611) (-2062.621) * (-2053.811) (-2053.087) [-2055.045] (-2056.753) -- 0:04:31
217000 -- [-2050.537] (-2056.872) (-2055.246) (-2057.258) * (-2052.649) (-2060.842) [-2056.486] (-2054.295) -- 0:04:30
217500 -- [-2057.276] (-2055.314) (-2049.231) (-2063.697) * (-2050.483) [-2064.700] (-2054.357) (-2053.990) -- 0:04:29
218000 -- [-2055.116] (-2063.180) (-2053.698) (-2057.936) * (-2052.298) (-2060.234) [-2052.534] (-2057.723) -- 0:04:29
218500 -- [-2059.241] (-2059.507) (-2052.264) (-2061.605) * (-2055.410) (-2054.434) (-2057.103) [-2057.364] -- 0:04:28
219000 -- (-2052.626) [-2052.372] (-2051.022) (-2054.926) * (-2053.013) [-2056.649] (-2053.462) (-2062.791) -- 0:04:31
219500 -- (-2052.583) (-2064.414) (-2060.964) [-2060.650] * [-2052.535] (-2053.299) (-2056.883) (-2055.257) -- 0:04:30
220000 -- [-2051.462] (-2061.067) (-2059.600) (-2053.005) * (-2052.170) (-2056.605) (-2058.897) [-2059.693] -- 0:04:29
Average standard deviation of split frequencies: 0.005127
220500 -- [-2055.006] (-2067.693) (-2062.677) (-2058.249) * (-2062.741) [-2051.094] (-2059.009) (-2062.552) -- 0:04:28
221000 -- (-2064.574) [-2055.998] (-2054.210) (-2057.022) * [-2055.070] (-2054.529) (-2056.081) (-2062.645) -- 0:04:27
221500 -- [-2052.642] (-2053.356) (-2056.367) (-2055.639) * (-2054.165) (-2051.540) [-2056.154] (-2058.346) -- 0:04:30
222000 -- [-2055.471] (-2061.493) (-2052.271) (-2051.180) * (-2056.906) (-2054.721) [-2051.735] (-2059.067) -- 0:04:29
222500 -- [-2056.427] (-2059.574) (-2061.192) (-2051.778) * (-2054.255) (-2052.486) [-2055.744] (-2057.203) -- 0:04:29
223000 -- (-2051.955) [-2052.674] (-2059.183) (-2059.284) * (-2059.229) (-2057.740) (-2051.661) [-2054.365] -- 0:04:28
223500 -- [-2054.550] (-2050.409) (-2053.739) (-2060.877) * [-2065.773] (-2055.810) (-2053.431) (-2054.741) -- 0:04:27
224000 -- (-2056.219) [-2052.720] (-2056.422) (-2058.714) * (-2059.183) (-2059.451) (-2052.327) [-2060.762] -- 0:04:30
224500 -- (-2058.103) (-2057.395) (-2057.655) [-2054.068] * [-2052.684] (-2055.550) (-2056.169) (-2057.575) -- 0:04:29
225000 -- (-2061.985) (-2053.977) [-2055.704] (-2053.341) * [-2052.486] (-2060.049) (-2052.503) (-2061.308) -- 0:04:28
Average standard deviation of split frequencies: 0.004172
225500 -- (-2057.509) [-2056.406] (-2057.585) (-2058.300) * (-2053.466) [-2059.286] (-2049.412) (-2056.456) -- 0:04:27
226000 -- [-2053.244] (-2055.505) (-2055.964) (-2058.375) * [-2048.049] (-2061.032) (-2055.539) (-2057.163) -- 0:04:27
226500 -- (-2063.549) [-2050.554] (-2060.125) (-2053.672) * (-2052.943) (-2069.901) (-2053.371) [-2054.389] -- 0:04:26
227000 -- (-2063.763) [-2057.194] (-2053.907) (-2050.550) * [-2046.122] (-2061.401) (-2066.206) (-2055.650) -- 0:04:29
227500 -- (-2057.226) [-2052.317] (-2055.722) (-2058.042) * (-2052.267) (-2056.552) (-2054.027) [-2052.684] -- 0:04:28
228000 -- (-2058.327) [-2056.951] (-2059.742) (-2054.558) * (-2054.932) (-2057.758) [-2058.443] (-2068.899) -- 0:04:27
228500 -- (-2055.433) [-2053.392] (-2058.318) (-2055.343) * (-2058.313) (-2061.632) [-2055.101] (-2058.963) -- 0:04:26
229000 -- (-2058.596) (-2053.606) (-2050.824) [-2048.390] * [-2055.646] (-2058.771) (-2057.100) (-2067.112) -- 0:04:25
229500 -- [-2048.967] (-2049.796) (-2060.500) (-2050.071) * (-2059.631) (-2060.300) [-2052.208] (-2061.067) -- 0:04:25
230000 -- [-2054.367] (-2065.954) (-2056.611) (-2053.422) * [-2057.646] (-2056.065) (-2059.196) (-2053.638) -- 0:04:27
Average standard deviation of split frequencies: 0.004496
230500 -- (-2057.196) [-2053.347] (-2053.023) (-2057.854) * (-2056.981) (-2057.343) (-2056.171) [-2053.512] -- 0:04:27
231000 -- [-2055.885] (-2051.766) (-2061.352) (-2053.277) * (-2054.271) [-2053.915] (-2059.150) (-2060.850) -- 0:04:26
231500 -- (-2056.465) (-2054.066) [-2053.575] (-2059.571) * (-2065.676) (-2053.041) (-2056.792) [-2056.135] -- 0:04:25
232000 -- (-2052.362) (-2059.637) [-2053.356] (-2055.459) * (-2057.061) (-2057.581) (-2054.517) [-2055.503] -- 0:04:24
232500 -- (-2048.474) (-2052.888) (-2059.122) [-2058.598] * (-2056.562) (-2065.915) [-2049.680] (-2050.909) -- 0:04:24
233000 -- (-2056.633) (-2056.078) [-2055.774] (-2053.606) * (-2060.754) (-2065.647) [-2060.776] (-2060.784) -- 0:04:26
233500 -- (-2061.683) (-2049.960) [-2054.743] (-2051.282) * [-2051.697] (-2059.157) (-2065.816) (-2052.121) -- 0:04:25
234000 -- (-2058.351) [-2054.614] (-2058.303) (-2058.727) * [-2055.061] (-2055.192) (-2057.889) (-2059.702) -- 0:04:25
234500 -- (-2058.212) (-2057.371) (-2058.537) [-2052.345] * (-2056.711) (-2052.438) [-2055.539] (-2068.736) -- 0:04:24
235000 -- (-2054.155) [-2059.682] (-2051.913) (-2054.158) * (-2055.302) (-2059.506) (-2056.015) [-2057.750] -- 0:04:23
Average standard deviation of split frequencies: 0.005992
235500 -- (-2053.961) (-2057.998) [-2052.618] (-2063.193) * (-2061.791) (-2057.931) (-2055.891) [-2056.725] -- 0:04:26
236000 -- (-2051.591) (-2059.841) (-2059.833) [-2053.344] * (-2056.316) (-2051.358) (-2057.868) [-2055.437] -- 0:04:25
236500 -- [-2055.792] (-2065.911) (-2064.852) (-2055.183) * (-2058.182) (-2064.874) (-2053.345) [-2054.630] -- 0:04:24
237000 -- (-2056.270) (-2065.274) [-2058.966] (-2053.118) * (-2054.594) (-2055.997) [-2059.974] (-2054.259) -- 0:04:23
237500 -- (-2057.844) (-2066.442) [-2053.344] (-2049.447) * [-2053.592] (-2060.342) (-2055.279) (-2051.462) -- 0:04:23
238000 -- [-2053.209] (-2057.769) (-2061.361) (-2059.525) * (-2064.554) (-2053.513) [-2054.369] (-2055.635) -- 0:04:22
238500 -- [-2056.048] (-2051.905) (-2048.964) (-2054.376) * (-2060.460) (-2054.205) [-2053.321] (-2054.306) -- 0:04:25
239000 -- (-2055.143) (-2055.048) [-2054.376] (-2054.031) * (-2056.526) [-2052.075] (-2049.231) (-2062.024) -- 0:04:24
239500 -- (-2061.677) (-2054.426) [-2053.755] (-2052.929) * [-2051.933] (-2057.513) (-2054.115) (-2054.967) -- 0:04:23
240000 -- [-2054.567] (-2051.575) (-2057.604) (-2057.404) * (-2055.673) [-2059.457] (-2064.968) (-2064.495) -- 0:04:22
Average standard deviation of split frequencies: 0.003134
240500 -- (-2063.337) (-2060.493) [-2055.358] (-2056.963) * [-2052.162] (-2052.104) (-2057.006) (-2054.609) -- 0:04:22
241000 -- [-2062.347] (-2053.964) (-2058.464) (-2059.371) * (-2061.972) (-2059.673) (-2057.699) [-2065.197] -- 0:04:24
241500 -- [-2059.979] (-2064.462) (-2059.387) (-2060.307) * (-2053.901) (-2060.203) [-2052.245] (-2061.371) -- 0:04:23
242000 -- (-2055.539) (-2059.452) [-2054.620] (-2064.777) * [-2052.064] (-2054.341) (-2053.863) (-2064.033) -- 0:04:23
242500 -- (-2054.997) (-2060.720) [-2055.482] (-2062.981) * (-2055.933) (-2055.763) (-2056.651) [-2055.141] -- 0:04:22
243000 -- (-2061.385) (-2059.926) (-2058.733) [-2056.860] * (-2054.004) [-2053.874] (-2060.274) (-2057.057) -- 0:04:24
243500 -- (-2054.845) (-2056.113) (-2052.186) [-2052.678] * (-2055.657) [-2052.331] (-2054.380) (-2055.954) -- 0:04:24
244000 -- [-2050.754] (-2059.613) (-2060.034) (-2052.540) * (-2054.480) (-2059.249) [-2052.493] (-2059.669) -- 0:04:23
244500 -- (-2054.097) [-2057.796] (-2053.001) (-2059.744) * (-2060.123) [-2054.262] (-2051.594) (-2057.214) -- 0:04:22
245000 -- [-2051.254] (-2055.552) (-2056.142) (-2070.844) * (-2053.240) [-2049.092] (-2056.551) (-2059.915) -- 0:04:21
Average standard deviation of split frequencies: 0.003449
245500 -- [-2052.669] (-2055.622) (-2056.884) (-2057.154) * (-2052.307) [-2049.509] (-2048.384) (-2064.408) -- 0:04:21
246000 -- [-2049.374] (-2061.743) (-2053.212) (-2055.176) * (-2053.101) (-2052.253) [-2054.469] (-2058.551) -- 0:04:23
246500 -- (-2049.080) (-2053.869) [-2055.345] (-2066.102) * [-2053.566] (-2059.114) (-2056.572) (-2062.129) -- 0:04:22
247000 -- (-2054.625) (-2054.395) [-2053.482] (-2063.327) * (-2055.137) [-2055.721] (-2056.949) (-2063.407) -- 0:04:22
247500 -- (-2059.485) (-2057.854) (-2057.416) [-2051.841] * (-2056.479) [-2056.452] (-2057.075) (-2053.252) -- 0:04:21
248000 -- [-2053.800] (-2055.265) (-2057.026) (-2061.185) * [-2056.040] (-2055.805) (-2060.141) (-2055.333) -- 0:04:20
248500 -- [-2059.401] (-2062.018) (-2059.941) (-2057.774) * [-2059.428] (-2055.551) (-2054.107) (-2051.977) -- 0:04:20
249000 -- (-2063.471) (-2053.076) [-2057.229] (-2058.009) * (-2057.827) (-2059.912) [-2055.641] (-2052.632) -- 0:04:22
249500 -- (-2056.855) (-2060.855) (-2056.354) [-2055.756] * [-2052.084] (-2059.416) (-2050.975) (-2056.655) -- 0:04:21
250000 -- (-2056.594) [-2060.382] (-2057.253) (-2063.691) * (-2058.062) (-2062.172) [-2056.647] (-2053.964) -- 0:04:21
Average standard deviation of split frequencies: 0.002633
250500 -- (-2059.161) (-2053.607) (-2054.053) [-2055.559] * (-2053.743) (-2058.245) [-2056.029] (-2060.982) -- 0:04:20
251000 -- (-2054.165) (-2059.639) [-2054.186] (-2055.788) * (-2054.892) (-2060.767) [-2052.975] (-2057.624) -- 0:04:19
251500 -- (-2070.473) (-2049.516) (-2051.470) [-2054.042] * (-2055.276) (-2051.750) (-2054.936) [-2055.322] -- 0:04:21
252000 -- (-2052.724) [-2055.148] (-2051.037) (-2052.713) * (-2055.073) (-2060.738) (-2051.419) [-2063.329] -- 0:04:21
252500 -- (-2057.664) (-2060.752) [-2052.767] (-2063.856) * (-2060.411) (-2059.957) [-2062.293] (-2057.343) -- 0:04:20
253000 -- [-2057.261] (-2053.174) (-2054.037) (-2058.699) * (-2059.086) (-2055.315) (-2064.569) [-2050.829] -- 0:04:19
253500 -- (-2059.887) (-2063.160) (-2060.583) [-2056.618] * (-2056.345) (-2052.169) (-2058.428) [-2049.759] -- 0:04:19
254000 -- [-2068.616] (-2057.375) (-2058.355) (-2058.878) * (-2062.115) (-2061.151) [-2065.263] (-2057.122) -- 0:04:18
254500 -- [-2061.693] (-2056.323) (-2062.270) (-2063.007) * (-2056.833) [-2053.995] (-2059.388) (-2063.040) -- 0:04:20
255000 -- (-2053.611) [-2051.512] (-2067.660) (-2055.932) * (-2059.154) (-2054.141) [-2052.338] (-2063.204) -- 0:04:20
Average standard deviation of split frequencies: 0.004910
255500 -- [-2055.589] (-2052.989) (-2056.512) (-2057.843) * (-2059.675) (-2054.329) (-2058.247) [-2054.273] -- 0:04:19
256000 -- (-2057.898) [-2060.054] (-2052.068) (-2056.233) * (-2063.358) (-2056.214) (-2066.934) [-2052.079] -- 0:04:18
256500 -- (-2052.531) (-2057.446) [-2055.900] (-2057.706) * (-2060.190) [-2053.200] (-2065.092) (-2057.030) -- 0:04:17
257000 -- [-2062.527] (-2048.906) (-2059.326) (-2053.500) * [-2051.748] (-2058.187) (-2060.817) (-2061.214) -- 0:04:20
257500 -- [-2056.231] (-2057.004) (-2065.840) (-2056.472) * [-2051.784] (-2068.655) (-2071.005) (-2055.893) -- 0:04:19
258000 -- (-2062.995) (-2055.362) (-2059.816) [-2051.699] * (-2059.556) (-2065.635) (-2060.611) [-2058.203] -- 0:04:18
258500 -- (-2065.125) (-2058.596) [-2054.562] (-2054.322) * (-2056.474) (-2056.476) [-2052.694] (-2058.379) -- 0:04:18
259000 -- (-2060.084) (-2056.026) (-2059.006) [-2063.238] * (-2052.452) (-2052.724) (-2056.675) [-2052.222] -- 0:04:17
259500 -- (-2057.694) [-2063.712] (-2060.203) (-2062.903) * (-2057.443) (-2058.806) [-2052.175] (-2054.186) -- 0:04:16
260000 -- [-2059.994] (-2057.868) (-2055.114) (-2058.124) * (-2058.102) (-2052.903) (-2055.341) [-2054.215] -- 0:04:19
Average standard deviation of split frequencies: 0.003979
260500 -- (-2059.095) (-2061.731) (-2054.889) [-2056.215] * [-2051.761] (-2056.754) (-2056.764) (-2054.314) -- 0:04:18
261000 -- (-2063.485) [-2051.369] (-2054.422) (-2053.368) * (-2050.330) (-2063.082) (-2057.678) [-2055.873] -- 0:04:17
261500 -- (-2050.263) [-2054.893] (-2064.501) (-2057.093) * (-2061.582) (-2059.419) [-2054.796] (-2057.108) -- 0:04:16
262000 -- (-2058.917) [-2050.024] (-2057.794) (-2061.824) * [-2058.089] (-2055.824) (-2057.866) (-2060.555) -- 0:04:16
262500 -- [-2052.047] (-2062.745) (-2056.886) (-2060.804) * (-2062.197) (-2053.726) [-2061.524] (-2065.911) -- 0:04:18
263000 -- (-2057.896) (-2060.151) [-2057.304] (-2062.139) * (-2060.916) (-2052.815) (-2056.764) [-2053.553] -- 0:04:17
263500 -- (-2060.866) (-2055.089) (-2067.009) [-2058.792] * (-2061.856) (-2051.739) [-2053.961] (-2055.931) -- 0:04:17
264000 -- (-2066.123) (-2057.340) [-2060.419] (-2063.520) * (-2061.134) [-2053.683] (-2055.321) (-2053.334) -- 0:04:16
264500 -- (-2054.142) [-2056.612] (-2065.871) (-2067.316) * (-2060.817) (-2054.419) [-2058.664] (-2049.616) -- 0:04:15
265000 -- (-2061.031) (-2057.404) (-2057.432) [-2062.981] * (-2064.255) (-2057.847) (-2067.559) [-2055.531] -- 0:04:17
Average standard deviation of split frequencies: 0.004608
265500 -- (-2065.148) (-2058.781) (-2055.796) [-2050.900] * (-2061.851) (-2054.597) [-2058.764] (-2052.345) -- 0:04:17
266000 -- (-2057.624) [-2056.517] (-2056.044) (-2066.654) * (-2054.163) (-2053.790) (-2056.646) [-2056.663] -- 0:04:16
266500 -- [-2055.301] (-2060.960) (-2054.243) (-2053.259) * [-2054.568] (-2059.852) (-2055.126) (-2057.094) -- 0:04:15
267000 -- [-2057.284] (-2057.923) (-2051.702) (-2054.420) * (-2054.336) [-2060.744] (-2059.260) (-2062.452) -- 0:04:15
267500 -- (-2056.862) (-2056.529) (-2054.417) [-2053.821] * (-2058.059) (-2055.303) (-2056.888) [-2054.055] -- 0:04:14
268000 -- (-2070.737) (-2053.807) (-2060.515) [-2055.549] * (-2058.512) [-2050.455] (-2056.606) (-2058.362) -- 0:04:16
268500 -- [-2058.428] (-2057.871) (-2056.523) (-2065.173) * (-2059.353) [-2055.547] (-2051.289) (-2061.860) -- 0:04:16
269000 -- [-2058.725] (-2059.794) (-2053.320) (-2065.094) * [-2052.837] (-2058.265) (-2052.836) (-2057.687) -- 0:04:15
269500 -- (-2063.333) [-2055.190] (-2055.950) (-2056.539) * (-2056.812) (-2055.922) [-2048.171] (-2061.946) -- 0:04:14
270000 -- (-2057.968) [-2052.749] (-2056.966) (-2062.417) * (-2051.876) [-2057.022] (-2052.916) (-2059.274) -- 0:04:14
Average standard deviation of split frequencies: 0.003832
270500 -- (-2066.016) (-2054.968) (-2058.628) [-2058.698] * [-2059.517] (-2057.413) (-2056.298) (-2060.557) -- 0:04:13
271000 -- (-2065.799) [-2055.145] (-2060.375) (-2061.603) * (-2067.216) (-2055.272) [-2059.226] (-2055.027) -- 0:04:15
271500 -- (-2058.430) [-2059.210] (-2052.532) (-2061.694) * (-2059.098) [-2058.542] (-2063.927) (-2058.937) -- 0:04:14
272000 -- (-2054.491) [-2050.778] (-2056.181) (-2066.562) * (-2059.636) [-2058.581] (-2066.219) (-2058.189) -- 0:04:14
272500 -- [-2054.375] (-2051.054) (-2054.839) (-2058.162) * (-2053.382) [-2056.587] (-2053.717) (-2059.332) -- 0:04:13
273000 -- (-2062.442) [-2051.303] (-2056.771) (-2058.738) * (-2052.381) (-2058.789) (-2055.663) [-2055.390] -- 0:04:12
273500 -- (-2055.486) (-2051.760) [-2054.108] (-2056.576) * (-2063.196) [-2058.395] (-2055.701) (-2064.566) -- 0:04:12
274000 -- (-2062.886) (-2061.304) (-2049.996) [-2056.129] * (-2058.138) (-2058.478) [-2052.831] (-2059.245) -- 0:04:14
274500 -- (-2061.529) (-2056.900) [-2051.029] (-2058.548) * (-2057.397) (-2063.962) [-2050.375] (-2066.919) -- 0:04:13
275000 -- (-2059.655) [-2057.921] (-2053.608) (-2056.611) * [-2056.434] (-2062.081) (-2057.164) (-2054.411) -- 0:04:13
Average standard deviation of split frequencies: 0.004099
275500 -- (-2055.558) (-2059.843) [-2051.569] (-2057.100) * (-2065.918) [-2053.330] (-2056.290) (-2064.422) -- 0:04:12
276000 -- (-2050.132) (-2054.309) [-2054.180] (-2062.007) * (-2056.830) (-2062.946) [-2053.244] (-2058.130) -- 0:04:11
276500 -- (-2058.969) [-2055.085] (-2056.396) (-2055.445) * [-2049.942] (-2054.952) (-2052.556) (-2058.850) -- 0:04:11
277000 -- [-2052.396] (-2054.309) (-2063.767) (-2067.504) * (-2053.246) (-2059.194) [-2057.172] (-2054.130) -- 0:04:13
277500 -- (-2054.522) (-2064.167) (-2052.877) [-2056.357] * (-2054.639) (-2054.111) [-2053.639] (-2056.540) -- 0:04:12
278000 -- [-2055.129] (-2056.198) (-2057.455) (-2051.704) * [-2051.333] (-2053.586) (-2059.554) (-2068.319) -- 0:04:11
278500 -- (-2054.003) (-2058.406) (-2051.390) [-2058.589] * (-2054.716) (-2056.374) [-2052.991] (-2057.230) -- 0:04:11
279000 -- (-2052.584) [-2057.942] (-2061.650) (-2058.818) * (-2060.493) [-2050.748] (-2058.328) (-2052.596) -- 0:04:10
279500 -- (-2058.739) (-2066.477) [-2060.510] (-2054.568) * [-2056.575] (-2060.265) (-2064.785) (-2054.515) -- 0:04:10
280000 -- [-2060.637] (-2055.814) (-2068.469) (-2064.161) * (-2058.565) (-2064.573) (-2062.884) [-2055.684] -- 0:04:12
Average standard deviation of split frequencies: 0.002016
280500 -- (-2055.104) [-2053.719] (-2067.117) (-2055.012) * (-2056.832) (-2054.552) (-2060.784) [-2054.914] -- 0:04:11
281000 -- (-2061.383) [-2054.575] (-2060.006) (-2061.275) * (-2060.982) [-2061.901] (-2061.477) (-2055.789) -- 0:04:10
281500 -- [-2055.376] (-2061.061) (-2064.338) (-2059.833) * [-2057.191] (-2059.254) (-2059.824) (-2059.913) -- 0:04:10
282000 -- (-2054.005) (-2054.643) [-2059.615] (-2052.722) * (-2056.655) [-2056.760] (-2062.423) (-2052.704) -- 0:04:09
282500 -- (-2058.779) [-2064.942] (-2058.007) (-2057.362) * (-2062.922) (-2055.448) [-2055.538] (-2052.708) -- 0:04:08
283000 -- [-2053.776] (-2063.631) (-2062.358) (-2053.910) * (-2059.876) [-2054.558] (-2055.578) (-2064.282) -- 0:04:10
283500 -- (-2054.743) [-2054.147] (-2064.072) (-2055.080) * (-2054.874) [-2058.281] (-2055.140) (-2063.033) -- 0:04:10
284000 -- (-2058.481) [-2051.286] (-2063.113) (-2054.213) * (-2054.253) [-2064.379] (-2057.877) (-2057.156) -- 0:04:09
284500 -- (-2057.826) (-2064.817) [-2060.222] (-2060.511) * (-2053.991) (-2055.571) (-2055.070) [-2062.185] -- 0:04:08
285000 -- (-2068.623) [-2052.623] (-2064.161) (-2056.357) * (-2052.709) [-2057.096] (-2052.523) (-2057.620) -- 0:04:08
Average standard deviation of split frequencies: 0.001648
285500 -- (-2056.206) (-2054.996) [-2058.504] (-2060.133) * [-2061.646] (-2053.999) (-2050.751) (-2060.011) -- 0:04:07
286000 -- (-2057.237) (-2060.989) [-2056.993] (-2053.356) * [-2053.382] (-2052.354) (-2058.106) (-2059.304) -- 0:04:09
286500 -- (-2057.653) (-2054.784) [-2054.579] (-2057.523) * (-2056.905) (-2058.838) (-2065.263) [-2058.601] -- 0:04:09
287000 -- [-2049.301] (-2058.767) (-2057.033) (-2060.093) * (-2058.841) (-2055.765) (-2062.397) [-2054.593] -- 0:04:08
287500 -- (-2060.359) [-2056.611] (-2059.242) (-2056.887) * (-2062.018) (-2054.216) (-2063.613) [-2052.691] -- 0:04:07
288000 -- (-2056.304) [-2056.684] (-2059.650) (-2055.231) * (-2064.365) (-2055.639) [-2060.466] (-2055.953) -- 0:04:07
288500 -- (-2063.758) (-2059.926) (-2054.758) [-2057.085] * [-2059.477] (-2056.607) (-2061.844) (-2053.564) -- 0:04:06
289000 -- (-2062.751) (-2055.112) [-2051.196] (-2060.244) * (-2061.311) (-2055.835) (-2057.797) [-2054.850] -- 0:04:08
289500 -- [-2055.588] (-2058.067) (-2058.256) (-2052.649) * [-2057.316] (-2055.576) (-2056.558) (-2059.417) -- 0:04:07
290000 -- [-2056.240] (-2057.038) (-2063.135) (-2061.109) * (-2059.964) (-2058.485) [-2063.835] (-2050.910) -- 0:04:07
Average standard deviation of split frequencies: 0.001622
290500 -- (-2059.776) (-2060.342) (-2063.119) [-2054.924] * [-2057.662] (-2054.403) (-2056.302) (-2053.217) -- 0:04:06
291000 -- (-2058.484) [-2057.730] (-2060.945) (-2054.590) * [-2061.296] (-2056.023) (-2058.917) (-2054.375) -- 0:04:06
291500 -- (-2062.887) [-2056.062] (-2061.163) (-2060.275) * (-2068.256) [-2053.815] (-2050.886) (-2051.172) -- 0:04:07
292000 -- [-2059.454] (-2054.588) (-2060.415) (-2053.350) * (-2061.863) (-2056.685) (-2059.122) [-2055.597] -- 0:04:07
292500 -- (-2061.261) (-2054.008) [-2053.691] (-2055.650) * (-2064.842) (-2054.356) (-2053.627) [-2053.118] -- 0:04:06
293000 -- [-2061.216] (-2051.453) (-2053.060) (-2055.035) * (-2057.949) (-2059.612) [-2049.774] (-2057.632) -- 0:04:06
293500 -- [-2054.040] (-2053.937) (-2053.216) (-2055.732) * (-2060.590) (-2053.045) (-2055.380) [-2052.694] -- 0:04:05
294000 -- (-2055.605) (-2052.083) [-2051.973] (-2054.954) * (-2055.304) (-2061.405) (-2060.465) [-2053.400] -- 0:04:04
294500 -- (-2056.475) (-2054.970) [-2053.803] (-2062.669) * [-2072.213] (-2056.002) (-2056.271) (-2057.065) -- 0:04:06
295000 -- (-2059.702) (-2061.133) (-2062.146) [-2056.493] * (-2071.810) (-2057.025) (-2052.253) [-2054.870] -- 0:04:06
Average standard deviation of split frequencies: 0.001593
295500 -- (-2061.862) (-2058.250) (-2051.548) [-2058.556] * [-2054.113] (-2051.885) (-2050.257) (-2059.254) -- 0:04:05
296000 -- (-2058.970) [-2052.479] (-2059.637) (-2057.863) * [-2060.357] (-2051.653) (-2053.093) (-2058.369) -- 0:04:04
296500 -- (-2064.144) (-2060.940) (-2059.807) [-2050.703] * (-2063.768) [-2058.974] (-2057.965) (-2061.854) -- 0:04:04
297000 -- (-2063.533) (-2055.692) (-2060.753) [-2057.559] * (-2060.751) [-2052.635] (-2053.969) (-2055.877) -- 0:04:03
297500 -- [-2059.803] (-2055.833) (-2052.505) (-2058.783) * (-2061.569) [-2049.235] (-2053.641) (-2058.606) -- 0:04:05
298000 -- (-2064.418) (-2055.997) (-2064.870) [-2053.618] * [-2056.658] (-2061.592) (-2053.605) (-2054.343) -- 0:04:04
298500 -- (-2061.718) [-2051.481] (-2060.116) (-2054.193) * (-2056.308) (-2057.131) (-2051.706) [-2054.453] -- 0:04:04
299000 -- (-2057.694) (-2068.288) (-2062.531) [-2054.123] * (-2054.516) (-2057.485) (-2069.109) [-2058.207] -- 0:04:03
299500 -- [-2054.030] (-2058.285) (-2064.326) (-2058.928) * [-2060.236] (-2055.643) (-2053.765) (-2059.269) -- 0:04:03
300000 -- (-2059.386) (-2065.678) (-2054.568) [-2055.229] * [-2055.442] (-2057.136) (-2050.248) (-2053.569) -- 0:04:02
Average standard deviation of split frequencies: 0.001881
300500 -- (-2065.291) (-2050.942) [-2050.581] (-2055.876) * (-2051.129) (-2064.839) (-2054.592) [-2053.344] -- 0:04:04
301000 -- (-2056.149) (-2056.227) [-2057.284] (-2060.187) * (-2055.545) (-2055.363) [-2056.324] (-2058.524) -- 0:04:03
301500 -- [-2054.010] (-2062.167) (-2052.926) (-2054.983) * (-2063.809) (-2055.058) (-2054.717) [-2060.860] -- 0:04:03
302000 -- (-2056.256) [-2057.207] (-2051.710) (-2066.223) * [-2059.501] (-2057.958) (-2052.486) (-2063.109) -- 0:04:02
302500 -- (-2057.219) [-2054.543] (-2054.255) (-2052.395) * (-2056.330) [-2054.448] (-2065.238) (-2070.560) -- 0:04:02
303000 -- (-2063.900) [-2062.330] (-2073.459) (-2059.774) * (-2053.492) [-2053.674] (-2059.182) (-2066.256) -- 0:04:01
303500 -- (-2059.896) [-2059.278] (-2061.953) (-2055.784) * [-2057.448] (-2058.345) (-2065.882) (-2061.590) -- 0:04:03
304000 -- [-2053.813] (-2062.005) (-2054.792) (-2053.980) * (-2055.321) (-2056.381) (-2062.854) [-2058.338] -- 0:04:02
304500 -- [-2054.685] (-2061.594) (-2061.553) (-2058.272) * [-2057.973] (-2058.185) (-2060.889) (-2061.054) -- 0:04:02
305000 -- [-2055.940] (-2059.595) (-2055.284) (-2064.511) * [-2058.707] (-2054.274) (-2054.749) (-2058.335) -- 0:04:01
Average standard deviation of split frequencies: 0.001849
305500 -- (-2067.802) [-2055.782] (-2054.928) (-2053.195) * (-2054.302) (-2055.867) (-2059.473) [-2053.117] -- 0:04:00
306000 -- [-2052.907] (-2062.044) (-2055.481) (-2051.040) * (-2050.463) (-2060.262) [-2056.467] (-2055.903) -- 0:04:00
306500 -- (-2058.985) (-2053.129) (-2055.736) [-2053.449] * (-2055.605) (-2064.188) [-2051.762] (-2059.795) -- 0:04:02
307000 -- [-2054.096] (-2055.364) (-2053.855) (-2055.980) * (-2056.378) (-2061.217) (-2063.877) [-2055.972] -- 0:04:01
307500 -- (-2053.600) (-2063.601) (-2057.317) [-2060.592] * (-2056.123) (-2061.371) [-2051.801] (-2053.694) -- 0:04:00
308000 -- (-2057.269) [-2052.626] (-2053.091) (-2061.952) * (-2054.059) (-2053.744) [-2059.110] (-2052.858) -- 0:04:00
308500 -- (-2053.696) [-2058.378] (-2060.545) (-2062.517) * [-2057.032] (-2058.843) (-2060.286) (-2052.028) -- 0:03:59
309000 -- (-2050.825) (-2060.071) (-2056.873) [-2060.059] * (-2059.133) (-2061.970) [-2059.824] (-2054.999) -- 0:03:59
309500 -- [-2050.841] (-2053.691) (-2054.963) (-2057.768) * (-2053.005) (-2051.488) (-2057.430) [-2056.192] -- 0:04:00
310000 -- (-2059.795) (-2062.314) [-2056.406] (-2062.110) * (-2059.710) (-2056.276) (-2062.602) [-2055.670] -- 0:04:00
Average standard deviation of split frequencies: 0.001214
310500 -- (-2064.888) (-2054.147) [-2053.446] (-2065.660) * [-2057.223] (-2057.502) (-2061.719) (-2059.714) -- 0:03:59
311000 -- (-2060.213) (-2056.317) [-2053.100] (-2057.204) * (-2052.615) [-2058.955] (-2058.199) (-2060.064) -- 0:03:59
311500 -- (-2057.609) (-2055.833) [-2052.730] (-2051.062) * [-2058.009] (-2059.433) (-2053.045) (-2057.099) -- 0:03:58
312000 -- [-2051.972] (-2057.478) (-2052.685) (-2056.269) * [-2052.766] (-2054.070) (-2065.460) (-2056.507) -- 0:03:58
312500 -- (-2061.232) [-2055.867] (-2057.583) (-2057.460) * [-2052.262] (-2069.701) (-2066.006) (-2064.820) -- 0:03:59
313000 -- (-2050.935) (-2056.769) (-2061.232) [-2056.041] * (-2063.511) (-2059.134) (-2059.366) [-2052.576] -- 0:03:59
313500 -- (-2057.445) (-2057.971) (-2055.474) [-2057.167] * (-2055.657) [-2050.643] (-2052.701) (-2060.217) -- 0:03:58
314000 -- (-2053.647) [-2056.501] (-2057.845) (-2056.078) * (-2054.151) (-2051.439) [-2053.319] (-2052.701) -- 0:03:58
314500 -- (-2051.179) (-2054.416) (-2058.196) [-2054.719] * [-2053.896] (-2058.470) (-2053.804) (-2060.296) -- 0:03:57
315000 -- [-2051.843] (-2055.258) (-2054.000) (-2062.335) * (-2053.601) (-2053.790) (-2055.159) [-2063.117] -- 0:03:57
Average standard deviation of split frequencies: 0.003580
315500 -- (-2052.297) [-2056.023] (-2062.037) (-2057.928) * (-2055.329) [-2054.748] (-2057.180) (-2053.318) -- 0:03:58
316000 -- (-2059.020) (-2062.552) [-2058.167] (-2050.181) * (-2057.440) (-2056.155) [-2057.202] (-2061.713) -- 0:03:58
316500 -- [-2058.985] (-2058.247) (-2058.983) (-2054.471) * (-2058.848) [-2054.833] (-2060.288) (-2056.734) -- 0:03:57
317000 -- (-2057.560) (-2059.754) (-2053.751) [-2048.190] * [-2057.891] (-2060.758) (-2062.181) (-2056.357) -- 0:03:57
317500 -- (-2051.403) (-2059.244) [-2053.200] (-2057.927) * [-2054.971] (-2059.120) (-2052.701) (-2054.520) -- 0:03:56
318000 -- (-2055.200) (-2062.678) [-2055.727] (-2060.409) * [-2060.333] (-2060.964) (-2058.975) (-2055.444) -- 0:03:55
318500 -- (-2052.426) [-2058.058] (-2057.418) (-2058.173) * (-2057.122) (-2059.478) [-2059.084] (-2055.557) -- 0:03:57
319000 -- (-2060.641) (-2054.016) (-2058.995) [-2055.871] * (-2063.416) (-2062.125) (-2064.377) [-2050.816] -- 0:03:56
319500 -- (-2061.308) (-2060.469) (-2063.747) [-2054.615] * [-2059.072] (-2063.201) (-2054.086) (-2051.689) -- 0:03:56
320000 -- [-2055.139] (-2056.900) (-2062.303) (-2064.098) * (-2058.249) (-2063.586) [-2054.886] (-2063.813) -- 0:03:55
Average standard deviation of split frequencies: 0.004116
320500 -- [-2061.607] (-2057.121) (-2058.850) (-2058.842) * (-2052.254) [-2063.241] (-2057.259) (-2053.533) -- 0:03:55
321000 -- (-2059.133) [-2058.794] (-2058.101) (-2059.834) * (-2059.812) (-2054.488) [-2060.497] (-2053.337) -- 0:03:54
321500 -- (-2053.449) (-2058.338) (-2057.128) [-2063.112] * (-2059.179) [-2051.129] (-2055.539) (-2054.624) -- 0:03:56
322000 -- [-2060.073] (-2059.299) (-2058.874) (-2052.904) * (-2058.025) (-2058.034) (-2052.613) [-2061.387] -- 0:03:55
322500 -- (-2050.244) [-2054.458] (-2050.917) (-2058.578) * (-2054.080) (-2058.596) [-2052.907] (-2058.144) -- 0:03:55
323000 -- (-2057.314) (-2060.219) (-2054.615) [-2053.510] * [-2049.279] (-2053.599) (-2052.777) (-2052.576) -- 0:03:54
323500 -- (-2053.542) (-2058.073) (-2057.600) [-2051.879] * (-2059.871) (-2058.037) (-2066.654) [-2051.059] -- 0:03:54
324000 -- (-2057.295) (-2056.693) (-2059.487) [-2055.316] * (-2054.029) [-2058.934] (-2051.513) (-2056.899) -- 0:03:53
324500 -- [-2052.364] (-2061.593) (-2061.020) (-2057.805) * (-2053.552) [-2055.816] (-2054.281) (-2064.448) -- 0:03:55
325000 -- (-2065.482) [-2060.728] (-2061.801) (-2052.747) * [-2050.592] (-2054.104) (-2059.507) (-2058.852) -- 0:03:54
Average standard deviation of split frequencies: 0.002892
325500 -- [-2051.246] (-2056.915) (-2061.653) (-2057.219) * (-2062.603) (-2062.203) [-2053.869] (-2061.762) -- 0:03:54
326000 -- (-2051.146) (-2060.241) (-2059.650) [-2058.342] * (-2053.646) [-2057.696] (-2059.234) (-2057.094) -- 0:03:53
326500 -- (-2059.596) (-2064.351) (-2054.290) [-2053.420] * (-2055.464) [-2055.899] (-2056.184) (-2068.469) -- 0:03:53
327000 -- [-2061.134] (-2056.184) (-2053.549) (-2053.558) * (-2057.375) (-2060.185) [-2056.773] (-2062.096) -- 0:03:52
327500 -- (-2058.535) (-2054.700) (-2051.940) [-2056.901] * [-2055.144] (-2059.355) (-2048.100) (-2058.337) -- 0:03:54
328000 -- [-2050.531] (-2053.032) (-2054.230) (-2061.231) * (-2056.454) (-2054.616) [-2053.472] (-2058.489) -- 0:03:53
328500 -- [-2059.557] (-2054.945) (-2055.150) (-2053.226) * (-2055.015) [-2055.338] (-2060.933) (-2057.479) -- 0:03:53
329000 -- [-2049.376] (-2058.305) (-2051.926) (-2056.575) * (-2055.358) [-2054.590] (-2055.352) (-2057.243) -- 0:03:52
329500 -- (-2053.979) (-2058.221) (-2058.210) [-2060.588] * (-2055.863) [-2060.793] (-2065.092) (-2062.839) -- 0:03:51
330000 -- [-2060.324] (-2063.689) (-2051.016) (-2065.155) * (-2059.788) [-2053.910] (-2059.405) (-2063.347) -- 0:03:51
Average standard deviation of split frequencies: 0.002566
330500 -- (-2058.505) (-2057.721) [-2056.725] (-2060.915) * [-2058.196] (-2066.545) (-2054.155) (-2059.924) -- 0:03:52
331000 -- (-2062.138) (-2054.408) [-2055.742] (-2057.538) * (-2058.401) [-2061.150] (-2052.112) (-2057.297) -- 0:03:52
331500 -- (-2062.413) (-2056.579) (-2060.527) [-2056.628] * (-2056.319) (-2060.390) (-2069.637) [-2058.036] -- 0:03:51
332000 -- [-2052.814] (-2056.811) (-2055.665) (-2063.990) * (-2057.153) (-2056.648) (-2053.808) [-2053.246] -- 0:03:51
332500 -- (-2052.420) (-2062.864) (-2060.817) [-2057.520] * (-2053.703) [-2059.158] (-2053.520) (-2059.267) -- 0:03:50
333000 -- (-2055.339) (-2055.318) (-2060.777) [-2051.621] * (-2062.023) [-2059.731] (-2055.211) (-2055.484) -- 0:03:52
333500 -- (-2049.496) (-2062.284) [-2053.970] (-2073.652) * [-2060.326] (-2056.660) (-2064.390) (-2052.528) -- 0:03:51
334000 -- (-2051.459) [-2058.395] (-2057.486) (-2055.329) * (-2054.936) (-2055.177) [-2055.839] (-2051.239) -- 0:03:51
334500 -- (-2054.935) (-2057.667) (-2057.614) [-2049.003] * (-2055.819) [-2052.135] (-2058.044) (-2055.071) -- 0:03:50
335000 -- (-2057.322) (-2056.316) [-2054.989] (-2052.291) * (-2064.170) (-2056.949) [-2054.697] (-2058.025) -- 0:03:50
Average standard deviation of split frequencies: 0.003648
335500 -- (-2054.100) (-2058.085) [-2052.771] (-2052.465) * (-2056.703) (-2057.937) [-2054.056] (-2047.379) -- 0:03:49
336000 -- (-2060.566) (-2052.427) [-2052.443] (-2051.686) * (-2052.305) (-2056.317) (-2061.105) [-2057.216] -- 0:03:51
336500 -- (-2054.578) (-2055.462) (-2055.256) [-2060.788] * (-2050.818) (-2052.109) [-2050.602] (-2058.391) -- 0:03:50
337000 -- (-2058.712) (-2056.320) (-2055.894) [-2054.932] * [-2058.839] (-2057.548) (-2054.021) (-2063.309) -- 0:03:50
337500 -- (-2053.688) (-2054.975) [-2055.993] (-2059.958) * [-2049.928] (-2059.714) (-2060.455) (-2053.647) -- 0:03:49
338000 -- (-2055.047) [-2055.616] (-2066.277) (-2054.680) * [-2057.108] (-2053.587) (-2057.638) (-2055.256) -- 0:03:49
338500 -- (-2058.814) [-2057.811] (-2060.022) (-2057.382) * (-2055.469) (-2056.623) [-2052.104] (-2059.543) -- 0:03:48
339000 -- [-2052.372] (-2055.515) (-2057.254) (-2061.111) * (-2059.804) (-2063.245) [-2056.769] (-2058.066) -- 0:03:50
339500 -- [-2056.206] (-2056.942) (-2061.948) (-2061.628) * (-2066.335) (-2058.453) [-2051.078] (-2059.933) -- 0:03:49
340000 -- [-2052.565] (-2058.588) (-2052.249) (-2054.425) * [-2058.600] (-2048.560) (-2048.708) (-2062.894) -- 0:03:49
Average standard deviation of split frequencies: 0.004151
340500 -- (-2059.663) [-2059.895] (-2060.042) (-2062.715) * (-2056.275) [-2056.006] (-2055.830) (-2058.752) -- 0:03:48
341000 -- (-2054.466) [-2055.046] (-2054.853) (-2058.041) * (-2059.248) (-2060.897) [-2054.729] (-2057.468) -- 0:03:48
341500 -- [-2050.652] (-2049.455) (-2059.215) (-2057.105) * [-2052.788] (-2055.027) (-2055.454) (-2058.368) -- 0:03:47
342000 -- (-2056.838) (-2070.141) [-2056.201] (-2054.397) * (-2055.457) (-2059.049) [-2054.812] (-2054.048) -- 0:03:48
342500 -- (-2057.981) (-2065.199) (-2053.175) [-2064.279] * (-2061.688) (-2062.703) [-2055.992] (-2056.215) -- 0:03:48
343000 -- (-2074.657) (-2054.662) [-2059.074] (-2070.669) * (-2056.810) (-2053.479) [-2053.224] (-2053.859) -- 0:03:47
343500 -- (-2062.086) (-2059.925) (-2068.867) [-2059.528] * [-2056.462] (-2060.349) (-2056.485) (-2061.559) -- 0:03:47
344000 -- (-2058.967) (-2057.277) (-2067.921) [-2055.047] * [-2054.579] (-2060.376) (-2060.290) (-2059.472) -- 0:03:46
344500 -- (-2065.672) (-2065.266) (-2057.671) [-2054.313] * [-2052.841] (-2069.706) (-2054.228) (-2057.274) -- 0:03:46
345000 -- (-2053.418) (-2075.932) (-2063.758) [-2056.643] * (-2054.826) (-2060.539) (-2055.573) [-2059.589] -- 0:03:47
Average standard deviation of split frequencies: 0.004360
345500 -- (-2053.949) (-2068.562) (-2052.583) [-2057.897] * [-2052.343] (-2060.857) (-2060.333) (-2058.806) -- 0:03:47
346000 -- (-2059.767) (-2063.556) [-2056.884] (-2061.654) * (-2051.238) (-2056.792) (-2060.646) [-2051.301] -- 0:03:46
346500 -- [-2056.496] (-2062.807) (-2054.330) (-2059.105) * (-2063.318) (-2058.111) (-2062.463) [-2049.012] -- 0:03:46
347000 -- [-2061.662] (-2056.613) (-2057.504) (-2058.264) * (-2059.542) (-2056.175) (-2057.335) [-2049.703] -- 0:03:45
347500 -- [-2053.855] (-2061.092) (-2057.702) (-2053.688) * (-2067.077) [-2058.665] (-2058.670) (-2050.919) -- 0:03:45
348000 -- (-2057.470) [-2058.423] (-2062.649) (-2052.295) * (-2057.220) (-2056.160) (-2055.258) [-2055.327] -- 0:03:46
348500 -- (-2059.289) (-2060.580) [-2055.997] (-2065.858) * [-2055.509] (-2056.933) (-2053.006) (-2058.973) -- 0:03:46
349000 -- (-2059.397) (-2058.694) [-2055.900] (-2061.754) * (-2062.858) (-2056.211) [-2050.084] (-2056.566) -- 0:03:45
349500 -- [-2055.395] (-2064.446) (-2054.874) (-2060.433) * (-2061.428) (-2063.301) [-2051.913] (-2053.469) -- 0:03:45
350000 -- (-2058.223) [-2057.602] (-2059.515) (-2062.437) * (-2060.430) (-2058.851) [-2057.290] (-2057.338) -- 0:03:44
Average standard deviation of split frequencies: 0.005108
350500 -- (-2059.064) (-2056.925) (-2059.983) [-2054.739] * (-2056.498) [-2058.816] (-2059.274) (-2062.713) -- 0:03:44
351000 -- (-2062.141) [-2056.572] (-2056.042) (-2057.117) * [-2054.438] (-2059.534) (-2058.527) (-2060.887) -- 0:03:45
351500 -- (-2056.164) [-2055.974] (-2065.988) (-2058.620) * (-2060.450) [-2057.556] (-2061.457) (-2065.055) -- 0:03:45
352000 -- (-2056.100) [-2055.949] (-2058.912) (-2053.358) * [-2063.277] (-2066.257) (-2060.305) (-2059.710) -- 0:03:44
352500 -- [-2052.886] (-2053.327) (-2057.557) (-2062.272) * (-2063.265) [-2057.743] (-2059.047) (-2057.635) -- 0:03:44
353000 -- (-2059.706) (-2059.038) (-2057.867) [-2060.134] * [-2055.915] (-2057.346) (-2058.405) (-2065.289) -- 0:03:43
353500 -- (-2057.413) (-2062.350) [-2057.835] (-2074.565) * (-2060.647) [-2054.121] (-2063.742) (-2060.077) -- 0:03:43
354000 -- [-2057.888] (-2058.979) (-2053.303) (-2058.833) * (-2056.754) (-2057.595) (-2059.024) [-2060.657] -- 0:03:44
354500 -- (-2052.243) (-2048.692) [-2052.647] (-2062.630) * (-2051.391) (-2070.780) (-2053.452) [-2053.756] -- 0:03:43
355000 -- [-2065.304] (-2054.419) (-2053.990) (-2059.180) * (-2057.479) (-2056.895) (-2054.134) [-2054.916] -- 0:03:43
Average standard deviation of split frequencies: 0.004767
355500 -- (-2055.411) (-2055.530) (-2058.643) [-2060.333] * [-2058.359] (-2056.468) (-2062.959) (-2056.164) -- 0:03:42
356000 -- (-2060.109) [-2049.260] (-2057.802) (-2066.077) * [-2053.557] (-2065.864) (-2062.583) (-2060.480) -- 0:03:42
356500 -- (-2059.951) (-2061.800) (-2059.075) [-2058.521] * (-2055.530) (-2052.097) (-2060.848) [-2059.226] -- 0:03:42
357000 -- (-2072.291) (-2053.848) [-2052.479] (-2055.673) * (-2052.510) (-2058.594) [-2054.655] (-2053.676) -- 0:03:43
357500 -- [-2062.680] (-2058.644) (-2057.423) (-2057.233) * (-2054.551) [-2053.814] (-2058.863) (-2056.923) -- 0:03:42
358000 -- [-2055.413] (-2061.405) (-2053.935) (-2053.593) * (-2051.879) (-2057.506) (-2057.536) [-2057.698] -- 0:03:42
358500 -- (-2056.713) (-2055.133) [-2052.130] (-2063.201) * [-2055.209] (-2060.850) (-2065.072) (-2061.256) -- 0:03:41
359000 -- [-2059.336] (-2057.867) (-2059.054) (-2060.253) * (-2054.660) [-2057.885] (-2055.239) (-2057.131) -- 0:03:41
359500 -- [-2058.280] (-2055.847) (-2060.817) (-2057.235) * (-2053.530) (-2055.025) [-2061.234] (-2052.929) -- 0:03:40
360000 -- (-2056.201) (-2053.154) [-2058.165] (-2057.827) * (-2053.690) (-2061.099) (-2060.573) [-2052.399] -- 0:03:42
Average standard deviation of split frequencies: 0.007581
360500 -- [-2058.244] (-2049.690) (-2061.083) (-2053.864) * (-2061.326) (-2056.769) (-2057.489) [-2061.347] -- 0:03:41
361000 -- (-2053.419) (-2058.377) [-2057.204] (-2057.079) * (-2051.988) (-2067.214) [-2060.256] (-2056.856) -- 0:03:41
361500 -- [-2053.500] (-2052.198) (-2052.441) (-2061.916) * (-2060.861) (-2051.721) [-2051.427] (-2052.932) -- 0:03:40
362000 -- (-2058.466) [-2053.992] (-2056.855) (-2063.480) * [-2055.717] (-2064.119) (-2054.791) (-2064.223) -- 0:03:40
362500 -- (-2059.604) (-2064.377) [-2059.033] (-2058.801) * (-2061.867) (-2055.005) [-2057.381] (-2055.782) -- 0:03:39
363000 -- [-2057.468] (-2056.882) (-2054.837) (-2061.008) * (-2060.714) (-2058.158) [-2055.426] (-2058.299) -- 0:03:41
363500 -- (-2056.680) (-2054.394) (-2056.235) [-2060.174] * [-2055.455] (-2054.967) (-2049.182) (-2062.611) -- 0:03:40
364000 -- (-2053.550) [-2059.693] (-2067.049) (-2064.052) * (-2067.008) [-2054.125] (-2062.970) (-2060.942) -- 0:03:40
364500 -- [-2049.873] (-2061.676) (-2050.528) (-2066.117) * (-2060.885) [-2053.015] (-2054.167) (-2056.466) -- 0:03:39
365000 -- (-2052.435) (-2058.109) [-2058.221] (-2055.027) * (-2052.671) [-2054.932] (-2055.415) (-2058.037) -- 0:03:39
Average standard deviation of split frequencies: 0.006698
365500 -- (-2052.597) (-2056.319) [-2053.352] (-2053.624) * [-2057.055] (-2051.824) (-2054.975) (-2059.988) -- 0:03:38
366000 -- (-2057.638) [-2051.376] (-2066.106) (-2054.377) * [-2052.349] (-2059.068) (-2054.109) (-2057.712) -- 0:03:39
366500 -- (-2054.713) (-2056.182) [-2055.825] (-2059.154) * (-2054.442) (-2057.905) [-2051.835] (-2055.967) -- 0:03:39
367000 -- [-2057.390] (-2056.110) (-2063.321) (-2057.365) * [-2051.944] (-2055.303) (-2061.674) (-2057.433) -- 0:03:39
367500 -- [-2055.867] (-2068.947) (-2063.627) (-2056.494) * [-2061.585] (-2060.925) (-2057.404) (-2054.546) -- 0:03:38
368000 -- (-2064.265) [-2056.198] (-2059.550) (-2058.264) * [-2057.387] (-2056.885) (-2068.154) (-2061.648) -- 0:03:38
368500 -- [-2052.339] (-2056.623) (-2072.602) (-2054.184) * (-2051.368) [-2058.917] (-2061.691) (-2060.647) -- 0:03:37
369000 -- (-2059.061) (-2053.837) [-2057.237] (-2056.786) * (-2054.637) (-2055.220) (-2061.247) [-2061.100] -- 0:03:38
369500 -- [-2056.159] (-2055.036) (-2055.989) (-2051.953) * (-2053.623) [-2056.625] (-2058.639) (-2063.421) -- 0:03:38
370000 -- (-2056.704) (-2055.458) [-2051.416] (-2056.092) * [-2058.166] (-2058.316) (-2057.728) (-2053.611) -- 0:03:37
Average standard deviation of split frequencies: 0.007885
370500 -- (-2057.506) (-2061.434) [-2054.158] (-2056.786) * (-2056.597) (-2054.538) [-2052.946] (-2058.015) -- 0:03:37
371000 -- (-2065.892) (-2059.679) [-2056.156] (-2062.737) * (-2055.832) (-2061.541) [-2055.166] (-2054.007) -- 0:03:37
371500 -- (-2056.636) [-2052.415] (-2062.193) (-2066.530) * (-2059.100) [-2052.277] (-2056.681) (-2058.376) -- 0:03:38
372000 -- (-2054.373) (-2054.039) [-2057.063] (-2058.414) * (-2057.118) (-2062.011) [-2055.425] (-2060.457) -- 0:03:37
372500 -- (-2058.617) (-2057.831) (-2064.772) [-2059.936] * (-2054.294) [-2064.231] (-2067.802) (-2055.693) -- 0:03:37
373000 -- (-2053.961) [-2053.337] (-2057.017) (-2056.189) * [-2059.735] (-2061.349) (-2053.549) (-2060.246) -- 0:03:36
373500 -- (-2055.450) [-2063.037] (-2056.140) (-2058.064) * [-2055.234] (-2061.371) (-2057.375) (-2054.665) -- 0:03:36
374000 -- [-2058.780] (-2060.939) (-2058.500) (-2052.144) * [-2054.941] (-2057.975) (-2057.010) (-2060.952) -- 0:03:35
374500 -- (-2053.878) [-2051.063] (-2053.537) (-2057.061) * [-2061.023] (-2062.297) (-2057.923) (-2054.500) -- 0:03:37
375000 -- (-2054.766) (-2057.116) [-2051.278] (-2073.519) * [-2053.793] (-2064.574) (-2058.858) (-2056.602) -- 0:03:36
Average standard deviation of split frequencies: 0.009779
375500 -- [-2058.391] (-2057.307) (-2051.535) (-2057.153) * [-2055.953] (-2062.645) (-2055.667) (-2058.527) -- 0:03:36
376000 -- (-2049.576) [-2054.230] (-2053.773) (-2057.776) * (-2050.377) (-2065.086) [-2057.190] (-2056.014) -- 0:03:35
376500 -- (-2057.066) (-2055.824) (-2052.767) [-2054.562] * (-2060.025) (-2066.498) (-2057.170) [-2056.336] -- 0:03:35
377000 -- (-2057.793) (-2065.208) (-2055.242) [-2055.817] * (-2066.346) (-2059.448) (-2055.232) [-2064.222] -- 0:03:34
377500 -- (-2053.024) [-2053.989] (-2056.299) (-2058.357) * (-2057.189) (-2061.465) [-2051.628] (-2058.604) -- 0:03:36
378000 -- (-2055.798) (-2065.950) (-2051.949) [-2057.740] * (-2062.962) (-2056.709) [-2056.728] (-2064.141) -- 0:03:35
378500 -- [-2060.176] (-2059.390) (-2058.174) (-2055.417) * (-2063.553) (-2055.139) (-2059.834) [-2058.724] -- 0:03:35
379000 -- (-2060.390) (-2052.926) (-2054.526) [-2062.181] * (-2060.424) (-2057.802) (-2054.002) [-2057.096] -- 0:03:34
379500 -- (-2073.984) [-2052.045] (-2061.917) (-2053.216) * (-2058.745) [-2055.726] (-2054.886) (-2051.597) -- 0:03:34
380000 -- (-2056.550) [-2055.825] (-2052.839) (-2054.268) * (-2057.389) (-2060.594) [-2053.787] (-2054.965) -- 0:03:33
Average standard deviation of split frequencies: 0.008421
380500 -- (-2058.397) (-2053.215) (-2061.273) [-2054.924] * (-2058.628) [-2058.949] (-2053.927) (-2055.012) -- 0:03:34
381000 -- (-2062.752) [-2056.850] (-2061.893) (-2064.026) * (-2057.972) [-2056.724] (-2058.727) (-2061.432) -- 0:03:34
381500 -- (-2052.158) [-2056.172] (-2060.952) (-2058.516) * [-2054.521] (-2056.599) (-2054.151) (-2059.723) -- 0:03:34
382000 -- [-2052.020] (-2051.417) (-2061.423) (-2068.035) * [-2054.911] (-2062.674) (-2060.127) (-2059.330) -- 0:03:33
382500 -- (-2066.324) [-2062.197] (-2054.743) (-2060.945) * (-2066.737) [-2053.389] (-2057.314) (-2053.678) -- 0:03:33
383000 -- [-2058.528] (-2055.093) (-2054.211) (-2061.088) * (-2065.199) (-2057.275) (-2059.549) [-2052.387] -- 0:03:32
383500 -- [-2066.252] (-2061.473) (-2060.326) (-2055.439) * (-2053.411) (-2054.863) (-2061.996) [-2060.573] -- 0:03:33
384000 -- [-2057.753] (-2059.972) (-2060.266) (-2051.229) * (-2054.210) [-2059.237] (-2059.250) (-2054.391) -- 0:03:33
384500 -- [-2057.908] (-2056.782) (-2060.157) (-2052.479) * (-2063.741) [-2055.647] (-2057.986) (-2051.619) -- 0:03:32
385000 -- (-2059.282) (-2050.870) (-2058.591) [-2053.327] * (-2064.664) (-2062.803) (-2065.503) [-2058.601] -- 0:03:32
Average standard deviation of split frequencies: 0.008793
385500 -- [-2052.145] (-2063.208) (-2055.000) (-2054.624) * (-2058.321) (-2058.904) (-2064.536) [-2057.974] -- 0:03:32
386000 -- (-2050.277) (-2066.472) (-2058.419) [-2064.665] * (-2054.541) [-2056.778] (-2064.651) (-2058.314) -- 0:03:31
386500 -- [-2056.473] (-2055.033) (-2061.636) (-2058.241) * (-2058.000) (-2059.698) (-2058.990) [-2058.485] -- 0:03:32
387000 -- (-2057.736) (-2060.661) [-2061.938] (-2053.300) * (-2054.464) (-2053.075) [-2055.897] (-2065.778) -- 0:03:32
387500 -- (-2059.396) (-2060.267) (-2056.719) [-2050.099] * (-2054.456) (-2056.012) [-2058.474] (-2065.083) -- 0:03:31
388000 -- (-2057.634) [-2053.292] (-2064.251) (-2053.110) * (-2059.894) [-2051.662] (-2056.939) (-2050.309) -- 0:03:31
388500 -- [-2056.571] (-2057.780) (-2056.700) (-2054.364) * (-2060.307) [-2053.896] (-2062.803) (-2056.106) -- 0:03:30
389000 -- (-2052.068) [-2059.139] (-2055.961) (-2053.829) * (-2052.797) (-2061.464) [-2053.688] (-2060.016) -- 0:03:30
389500 -- (-2055.855) (-2062.221) [-2051.634] (-2055.182) * (-2056.927) (-2054.108) [-2060.127] (-2059.108) -- 0:03:31
390000 -- (-2057.599) (-2059.366) (-2057.023) [-2050.370] * (-2060.703) [-2056.721] (-2055.501) (-2066.249) -- 0:03:31
Average standard deviation of split frequencies: 0.009653
390500 -- [-2063.447] (-2053.217) (-2058.897) (-2060.068) * [-2060.002] (-2056.682) (-2056.891) (-2060.220) -- 0:03:30
391000 -- (-2050.608) [-2055.491] (-2062.123) (-2056.698) * (-2060.295) (-2054.898) [-2053.584] (-2057.711) -- 0:03:30
391500 -- (-2067.978) [-2054.792] (-2064.136) (-2063.277) * (-2067.103) [-2057.553] (-2058.156) (-2058.866) -- 0:03:29
392000 -- (-2066.967) (-2055.708) (-2061.289) [-2059.588] * (-2063.946) [-2054.686] (-2061.138) (-2058.333) -- 0:03:29
392500 -- (-2061.658) (-2056.900) [-2060.781] (-2056.359) * (-2066.425) (-2050.803) (-2057.419) [-2050.802] -- 0:03:30
393000 -- (-2066.211) (-2055.606) [-2058.667] (-2058.503) * (-2055.971) [-2050.146] (-2061.234) (-2052.280) -- 0:03:30
393500 -- (-2056.946) (-2050.320) [-2055.306] (-2058.467) * (-2061.408) (-2054.568) (-2063.852) [-2052.506] -- 0:03:29
394000 -- (-2056.038) (-2068.766) [-2059.037] (-2064.231) * (-2053.435) [-2061.010] (-2059.101) (-2058.300) -- 0:03:29
394500 -- (-2060.003) [-2053.588] (-2057.128) (-2059.946) * (-2057.098) [-2062.168] (-2067.961) (-2056.062) -- 0:03:28
395000 -- (-2055.140) [-2057.385] (-2058.395) (-2055.109) * (-2057.063) (-2065.685) (-2060.655) [-2058.846] -- 0:03:28
Average standard deviation of split frequencies: 0.009523
395500 -- (-2053.013) (-2053.571) [-2056.390] (-2057.350) * (-2057.504) (-2055.088) (-2059.676) [-2050.933] -- 0:03:29
396000 -- (-2057.419) (-2058.461) (-2060.017) [-2053.206] * (-2059.569) (-2058.484) [-2053.536] (-2051.222) -- 0:03:28
396500 -- (-2058.859) [-2056.098] (-2061.958) (-2058.068) * (-2059.457) [-2051.625] (-2056.995) (-2054.857) -- 0:03:28
397000 -- (-2063.422) (-2056.722) (-2057.835) [-2052.603] * [-2057.351] (-2048.997) (-2059.530) (-2063.727) -- 0:03:28
397500 -- (-2053.094) (-2052.558) [-2055.911] (-2057.880) * [-2057.912] (-2059.179) (-2054.686) (-2057.387) -- 0:03:27
398000 -- (-2053.623) (-2055.416) [-2061.984] (-2052.570) * (-2063.129) [-2051.102] (-2056.356) (-2065.087) -- 0:03:27
398500 -- (-2057.939) (-2054.311) (-2061.407) [-2056.764] * (-2053.158) (-2054.962) [-2053.777] (-2054.953) -- 0:03:28
399000 -- (-2061.152) (-2057.978) (-2061.234) [-2058.277] * (-2061.654) (-2056.827) [-2061.262] (-2050.652) -- 0:03:27
399500 -- (-2059.319) (-2053.915) [-2054.999] (-2059.550) * [-2058.951] (-2052.271) (-2059.073) (-2051.462) -- 0:03:27
400000 -- (-2058.709) (-2062.338) [-2061.641] (-2058.145) * [-2055.937] (-2057.135) (-2061.411) (-2054.727) -- 0:03:27
Average standard deviation of split frequencies: 0.010354
400500 -- (-2058.720) [-2052.447] (-2064.985) (-2055.540) * (-2050.089) (-2064.681) (-2061.211) [-2055.726] -- 0:03:26
401000 -- (-2059.407) (-2054.814) (-2054.626) [-2054.339] * (-2063.556) (-2058.199) (-2060.358) [-2058.162] -- 0:03:26
401500 -- [-2065.495] (-2058.403) (-2058.594) (-2054.788) * (-2056.555) (-2053.523) [-2058.924] (-2062.670) -- 0:03:27
402000 -- (-2060.694) (-2051.878) (-2060.514) [-2058.216] * [-2051.730] (-2061.182) (-2057.614) (-2059.189) -- 0:03:26
402500 -- (-2052.852) [-2053.543] (-2058.073) (-2057.104) * [-2053.720] (-2052.705) (-2057.536) (-2062.874) -- 0:03:26
403000 -- (-2061.320) (-2063.671) (-2057.312) [-2053.905] * (-2049.526) (-2056.857) (-2059.002) [-2055.085] -- 0:03:25
403500 -- (-2055.726) [-2056.179] (-2054.539) (-2059.388) * (-2058.333) (-2057.573) (-2054.946) [-2054.383] -- 0:03:25
404000 -- (-2058.096) (-2060.313) (-2063.817) [-2058.203] * (-2059.010) [-2056.771] (-2053.297) (-2061.804) -- 0:03:26
404500 -- (-2055.179) (-2057.051) (-2056.361) [-2055.349] * (-2055.456) [-2055.635] (-2065.783) (-2052.268) -- 0:03:26
405000 -- (-2056.142) (-2056.988) [-2062.149] (-2057.933) * (-2056.178) [-2057.096] (-2053.342) (-2059.332) -- 0:03:25
Average standard deviation of split frequencies: 0.010450
405500 -- (-2056.776) (-2052.044) (-2063.450) [-2054.127] * (-2051.730) (-2058.153) [-2055.714] (-2058.326) -- 0:03:25
406000 -- [-2054.247] (-2054.971) (-2052.198) (-2053.455) * (-2059.812) (-2062.080) [-2058.962] (-2054.539) -- 0:03:24
406500 -- (-2062.859) [-2055.347] (-2051.579) (-2058.184) * (-2058.038) [-2048.047] (-2054.271) (-2055.065) -- 0:03:24
407000 -- (-2058.248) [-2055.134] (-2057.380) (-2054.307) * (-2055.806) (-2062.869) (-2069.248) [-2055.699] -- 0:03:25
407500 -- [-2057.184] (-2054.486) (-2051.896) (-2054.882) * [-2055.266] (-2063.589) (-2058.694) (-2049.815) -- 0:03:25
408000 -- (-2058.901) (-2055.523) (-2054.422) [-2051.847] * [-2052.048] (-2056.232) (-2053.073) (-2055.804) -- 0:03:24
408500 -- (-2055.228) (-2058.460) [-2052.806] (-2068.878) * [-2053.737] (-2060.721) (-2053.545) (-2054.991) -- 0:03:24
409000 -- (-2053.018) (-2052.265) (-2056.024) [-2056.653] * (-2051.748) (-2057.451) [-2051.737] (-2058.386) -- 0:03:23
409500 -- [-2054.684] (-2058.149) (-2058.060) (-2061.526) * (-2050.961) (-2051.677) [-2056.929] (-2059.204) -- 0:03:23
410000 -- (-2054.011) (-2050.882) (-2059.689) [-2054.291] * (-2051.050) [-2053.149] (-2055.489) (-2053.817) -- 0:03:24
Average standard deviation of split frequencies: 0.011709
410500 -- (-2058.781) [-2059.102] (-2058.220) (-2061.316) * (-2064.239) (-2055.023) [-2056.490] (-2053.966) -- 0:03:23
411000 -- (-2052.810) [-2053.507] (-2058.723) (-2056.633) * (-2067.624) (-2060.219) [-2056.743] (-2054.454) -- 0:03:23
411500 -- (-2054.412) [-2052.014] (-2060.652) (-2059.416) * (-2056.556) (-2069.456) (-2053.406) [-2054.144] -- 0:03:23
412000 -- (-2053.756) (-2068.126) [-2055.785] (-2052.165) * (-2065.690) (-2058.705) [-2056.114] (-2058.378) -- 0:03:22
412500 -- [-2060.720] (-2055.718) (-2065.469) (-2055.712) * (-2060.710) (-2063.294) (-2062.415) [-2058.099] -- 0:03:22
413000 -- (-2059.762) [-2055.879] (-2068.183) (-2063.106) * (-2060.082) (-2062.935) [-2056.617] (-2052.558) -- 0:03:23
413500 -- [-2055.597] (-2055.294) (-2063.032) (-2057.192) * (-2056.803) (-2063.904) (-2059.298) [-2052.109] -- 0:03:22
414000 -- (-2050.212) (-2058.542) [-2054.019] (-2067.928) * [-2056.715] (-2057.266) (-2063.430) (-2063.338) -- 0:03:22
414500 -- (-2059.658) [-2052.768] (-2058.172) (-2060.224) * (-2053.713) (-2057.076) [-2056.924] (-2056.964) -- 0:03:21
415000 -- [-2056.773] (-2056.471) (-2057.716) (-2055.996) * (-2060.358) [-2057.616] (-2057.132) (-2056.862) -- 0:03:21
Average standard deviation of split frequencies: 0.012692
415500 -- (-2052.376) (-2061.571) (-2059.101) [-2056.484] * [-2058.211] (-2063.381) (-2054.564) (-2062.439) -- 0:03:21
416000 -- (-2049.090) (-2062.797) (-2056.310) [-2054.865] * [-2060.159] (-2055.263) (-2054.239) (-2058.926) -- 0:03:22
416500 -- [-2050.878] (-2060.060) (-2054.059) (-2051.586) * (-2053.822) (-2054.717) [-2050.048] (-2055.566) -- 0:03:21
417000 -- [-2057.844] (-2052.778) (-2056.235) (-2060.926) * (-2056.345) (-2056.963) (-2055.328) [-2058.564] -- 0:03:21
417500 -- [-2055.292] (-2060.115) (-2059.183) (-2060.458) * (-2057.507) (-2053.894) [-2057.144] (-2056.029) -- 0:03:20
418000 -- (-2065.007) (-2055.562) [-2059.599] (-2058.696) * (-2059.873) (-2061.527) [-2052.332] (-2055.479) -- 0:03:20
418500 -- (-2055.235) (-2058.451) (-2062.766) [-2057.107] * (-2055.416) (-2059.221) [-2051.303] (-2056.526) -- 0:03:21
419000 -- [-2053.152] (-2063.123) (-2054.802) (-2068.861) * (-2057.841) (-2061.051) (-2057.309) [-2051.248] -- 0:03:21
419500 -- (-2050.836) [-2052.670] (-2059.565) (-2056.073) * [-2055.890] (-2057.958) (-2059.739) (-2061.709) -- 0:03:20
420000 -- (-2053.812) [-2057.250] (-2073.386) (-2055.068) * [-2056.017] (-2049.689) (-2056.133) (-2055.693) -- 0:03:20
Average standard deviation of split frequencies: 0.012103
420500 -- (-2058.187) [-2054.401] (-2056.052) (-2060.019) * (-2061.259) (-2052.993) [-2057.880] (-2056.453) -- 0:03:19
421000 -- [-2059.768] (-2052.260) (-2051.915) (-2054.481) * (-2062.756) (-2058.222) (-2050.539) [-2062.562] -- 0:03:19
421500 -- (-2056.570) [-2053.598] (-2055.137) (-2067.697) * (-2060.306) [-2053.886] (-2055.827) (-2064.682) -- 0:03:20
422000 -- (-2057.550) [-2053.511] (-2056.349) (-2055.038) * [-2056.463] (-2055.066) (-2058.465) (-2060.369) -- 0:03:19
422500 -- (-2051.383) (-2059.017) [-2048.416] (-2062.908) * (-2058.600) (-2063.672) (-2057.910) [-2052.473] -- 0:03:19
423000 -- (-2054.860) (-2058.477) (-2062.214) [-2053.647] * (-2051.595) (-2058.305) (-2054.553) [-2047.846] -- 0:03:19
423500 -- (-2049.763) [-2054.636] (-2058.282) (-2054.844) * [-2055.947] (-2057.041) (-2058.343) (-2058.444) -- 0:03:18
424000 -- [-2053.078] (-2055.552) (-2064.839) (-2050.377) * (-2054.488) [-2052.825] (-2065.621) (-2057.084) -- 0:03:19
424500 -- (-2055.579) (-2055.404) (-2056.658) [-2057.252] * (-2054.849) (-2057.730) [-2051.583] (-2058.674) -- 0:03:19
425000 -- (-2064.952) [-2050.567] (-2052.967) (-2054.052) * [-2053.528] (-2063.589) (-2057.960) (-2059.519) -- 0:03:18
Average standard deviation of split frequencies: 0.010845
425500 -- (-2053.831) [-2049.521] (-2060.576) (-2062.162) * (-2058.144) (-2069.422) (-2051.137) [-2058.934] -- 0:03:18
426000 -- (-2055.791) [-2058.494] (-2062.446) (-2058.060) * (-2060.444) (-2069.263) [-2055.980] (-2051.241) -- 0:03:18
426500 -- [-2054.233] (-2055.165) (-2059.889) (-2059.741) * (-2055.846) (-2060.661) (-2055.433) [-2056.746] -- 0:03:17
427000 -- (-2065.729) (-2062.052) [-2056.588] (-2056.251) * (-2060.204) (-2057.098) (-2059.645) [-2056.177] -- 0:03:18
427500 -- [-2055.246] (-2063.402) (-2061.278) (-2062.301) * (-2058.459) (-2051.968) (-2065.834) [-2051.755] -- 0:03:18
428000 -- (-2053.982) [-2051.739] (-2057.309) (-2057.221) * [-2055.630] (-2060.586) (-2057.961) (-2054.899) -- 0:03:17
428500 -- (-2062.435) [-2050.768] (-2059.895) (-2055.361) * (-2057.810) (-2059.319) [-2064.898] (-2050.072) -- 0:03:17
429000 -- (-2060.294) (-2050.555) [-2058.954] (-2053.594) * (-2058.243) (-2060.324) (-2067.230) [-2052.237] -- 0:03:16
429500 -- [-2052.415] (-2054.827) (-2056.206) (-2054.378) * (-2057.939) (-2055.510) (-2058.573) [-2050.897] -- 0:03:16
430000 -- [-2056.914] (-2056.400) (-2058.375) (-2053.976) * (-2058.242) (-2061.611) [-2057.204] (-2051.576) -- 0:03:17
Average standard deviation of split frequencies: 0.012259
430500 -- [-2054.548] (-2055.589) (-2060.332) (-2054.011) * [-2055.550] (-2062.841) (-2058.585) (-2059.607) -- 0:03:17
431000 -- (-2058.974) (-2056.961) [-2060.294] (-2053.336) * [-2049.401] (-2060.658) (-2061.047) (-2057.811) -- 0:03:16
431500 -- [-2056.930] (-2063.482) (-2067.315) (-2058.534) * (-2055.125) (-2069.308) (-2062.195) [-2053.804] -- 0:03:16
432000 -- (-2057.157) [-2057.682] (-2059.820) (-2053.602) * (-2062.233) (-2056.349) [-2052.508] (-2055.892) -- 0:03:15
432500 -- [-2055.874] (-2054.209) (-2068.757) (-2055.671) * (-2052.121) [-2049.119] (-2061.961) (-2054.585) -- 0:03:15
433000 -- (-2057.932) (-2054.349) [-2052.072] (-2059.643) * (-2056.973) (-2062.569) [-2053.826] (-2055.645) -- 0:03:16
433500 -- (-2055.250) (-2052.156) (-2053.997) [-2059.908] * (-2049.997) [-2066.153] (-2053.179) (-2051.128) -- 0:03:16
434000 -- (-2062.203) [-2059.222] (-2071.666) (-2051.934) * [-2052.947] (-2059.473) (-2053.921) (-2056.684) -- 0:03:15
434500 -- (-2061.323) (-2056.796) [-2058.247] (-2055.629) * (-2056.163) (-2058.590) (-2052.111) [-2055.098] -- 0:03:15
435000 -- (-2057.536) (-2059.655) [-2056.647] (-2058.396) * (-2052.070) (-2056.394) [-2051.482] (-2057.956) -- 0:03:14
Average standard deviation of split frequencies: 0.012542
435500 -- [-2057.640] (-2055.945) (-2051.881) (-2059.454) * [-2055.798] (-2056.699) (-2049.646) (-2056.575) -- 0:03:14
436000 -- (-2053.932) [-2053.709] (-2052.719) (-2060.718) * (-2053.409) (-2061.299) [-2053.120] (-2053.275) -- 0:03:15
436500 -- (-2056.229) (-2054.134) [-2058.843] (-2057.948) * [-2057.634] (-2061.476) (-2056.657) (-2061.509) -- 0:03:14
437000 -- (-2059.265) (-2059.733) [-2055.367] (-2058.647) * (-2052.017) (-2056.771) [-2059.925] (-2050.425) -- 0:03:14
437500 -- (-2059.756) (-2056.665) (-2051.163) [-2051.646] * (-2050.356) [-2049.183] (-2058.551) (-2054.598) -- 0:03:14
438000 -- [-2055.833] (-2057.414) (-2054.454) (-2057.594) * [-2062.662] (-2052.883) (-2062.029) (-2054.780) -- 0:03:13
438500 -- (-2054.450) (-2052.636) (-2056.072) [-2049.364] * [-2059.918] (-2061.496) (-2058.010) (-2057.673) -- 0:03:14
439000 -- (-2055.842) [-2052.612] (-2059.628) (-2054.717) * (-2068.625) (-2063.315) [-2055.569] (-2055.336) -- 0:03:14
439500 -- [-2053.452] (-2050.836) (-2058.333) (-2062.489) * [-2052.106] (-2058.626) (-2054.126) (-2057.907) -- 0:03:13
440000 -- [-2053.175] (-2055.717) (-2053.977) (-2051.215) * [-2059.724] (-2055.958) (-2057.608) (-2051.342) -- 0:03:13
Average standard deviation of split frequencies: 0.012623
440500 -- (-2058.714) (-2055.987) [-2052.486] (-2052.805) * [-2054.532] (-2060.686) (-2063.960) (-2053.920) -- 0:03:13
441000 -- (-2055.325) [-2060.852] (-2059.506) (-2055.845) * (-2064.656) (-2052.802) [-2057.551] (-2058.674) -- 0:03:12
441500 -- (-2055.425) [-2055.467] (-2063.232) (-2061.236) * (-2060.881) (-2062.410) (-2061.760) [-2050.985] -- 0:03:13
442000 -- (-2061.661) [-2063.161] (-2054.673) (-2056.140) * (-2072.557) (-2056.381) (-2056.574) [-2048.742] -- 0:03:13
442500 -- (-2055.739) [-2051.832] (-2063.017) (-2062.351) * (-2055.681) [-2059.140] (-2056.907) (-2055.300) -- 0:03:12
443000 -- (-2063.009) [-2057.892] (-2057.516) (-2051.189) * (-2056.274) (-2058.946) (-2055.401) [-2051.455] -- 0:03:12
443500 -- (-2056.392) (-2058.042) (-2060.045) [-2053.705] * [-2053.949] (-2060.498) (-2049.926) (-2058.105) -- 0:03:11
444000 -- (-2061.988) (-2059.855) (-2065.282) [-2053.324] * (-2056.361) [-2058.674] (-2055.254) (-2066.570) -- 0:03:11
444500 -- [-2062.801] (-2059.522) (-2067.427) (-2053.227) * (-2065.703) [-2053.311] (-2053.883) (-2061.545) -- 0:03:12
445000 -- (-2056.262) [-2055.114] (-2072.624) (-2053.417) * (-2058.552) (-2062.486) (-2050.549) [-2058.008] -- 0:03:12
Average standard deviation of split frequencies: 0.012684
445500 -- (-2052.021) [-2060.852] (-2057.418) (-2056.073) * [-2059.024] (-2057.711) (-2061.008) (-2054.088) -- 0:03:11
446000 -- [-2060.166] (-2061.569) (-2055.366) (-2057.322) * (-2058.701) (-2057.249) (-2067.608) [-2057.440] -- 0:03:11
446500 -- (-2065.955) (-2058.728) [-2056.837] (-2054.628) * (-2061.110) [-2051.913] (-2055.623) (-2058.213) -- 0:03:10
447000 -- (-2057.711) [-2056.636] (-2059.380) (-2053.974) * (-2059.304) (-2055.988) [-2055.011] (-2054.154) -- 0:03:10
447500 -- (-2062.560) [-2051.563] (-2065.789) (-2061.571) * (-2060.913) (-2057.919) (-2063.950) [-2057.117] -- 0:03:11
448000 -- (-2059.492) (-2055.230) [-2057.961] (-2054.136) * [-2060.477] (-2059.013) (-2065.772) (-2054.702) -- 0:03:10
448500 -- (-2061.833) (-2057.547) (-2058.801) [-2053.216] * (-2063.427) (-2063.565) (-2063.071) [-2051.606] -- 0:03:10
449000 -- [-2060.169] (-2066.316) (-2065.791) (-2058.544) * (-2056.661) (-2054.147) [-2058.338] (-2057.210) -- 0:03:10
449500 -- [-2051.547] (-2059.188) (-2060.245) (-2055.906) * (-2051.436) (-2058.468) (-2057.271) [-2057.234] -- 0:03:09
450000 -- (-2066.460) (-2056.009) [-2061.563] (-2052.427) * (-2062.076) [-2052.563] (-2059.658) (-2057.229) -- 0:03:09
Average standard deviation of split frequencies: 0.013180
450500 -- (-2056.280) (-2056.878) [-2055.381] (-2055.027) * (-2062.264) (-2054.530) (-2057.791) [-2054.884] -- 0:03:10
451000 -- (-2054.981) (-2054.218) [-2057.633] (-2062.842) * (-2056.084) (-2054.968) (-2059.275) [-2053.207] -- 0:03:09
451500 -- (-2056.315) [-2057.067] (-2052.521) (-2053.459) * [-2055.402] (-2056.484) (-2061.529) (-2056.711) -- 0:03:09
452000 -- (-2060.056) (-2059.962) [-2059.812] (-2059.715) * (-2061.435) [-2052.876] (-2067.971) (-2054.286) -- 0:03:09
452500 -- (-2063.145) (-2062.294) (-2061.552) [-2055.355] * (-2055.939) [-2052.986] (-2061.245) (-2057.902) -- 0:03:08
453000 -- (-2056.432) (-2059.551) [-2062.917] (-2064.356) * (-2053.570) (-2053.619) (-2057.843) [-2055.216] -- 0:03:08
453500 -- (-2053.216) (-2058.292) (-2053.131) [-2058.750] * (-2053.680) [-2056.825] (-2056.456) (-2060.805) -- 0:03:09
454000 -- (-2050.319) (-2060.855) [-2054.266] (-2056.517) * (-2059.281) [-2052.783] (-2057.788) (-2055.629) -- 0:03:08
454500 -- (-2051.252) (-2058.199) (-2058.671) [-2058.433] * (-2059.608) [-2058.772] (-2063.851) (-2064.007) -- 0:03:08
455000 -- (-2057.956) (-2059.221) [-2055.108] (-2060.242) * [-2055.944] (-2062.982) (-2050.306) (-2067.936) -- 0:03:08
Average standard deviation of split frequencies: 0.012819
455500 -- (-2060.978) (-2056.561) [-2051.471] (-2060.568) * (-2054.991) (-2058.348) (-2055.472) [-2054.711] -- 0:03:07
456000 -- (-2058.020) (-2064.105) [-2050.478] (-2055.771) * (-2051.572) [-2054.369] (-2057.510) (-2056.895) -- 0:03:07
456500 -- (-2061.217) (-2056.269) [-2048.344] (-2055.496) * (-2060.521) [-2052.679] (-2065.120) (-2055.088) -- 0:03:08
457000 -- (-2059.612) (-2050.365) [-2051.725] (-2060.300) * (-2052.772) (-2054.760) (-2057.495) [-2055.733] -- 0:03:07
457500 -- (-2053.796) [-2054.027] (-2053.832) (-2057.375) * (-2058.637) (-2056.010) [-2058.208] (-2059.732) -- 0:03:07
458000 -- (-2052.608) (-2057.567) (-2052.012) [-2060.629] * (-2051.690) (-2068.550) [-2058.182] (-2057.915) -- 0:03:06
458500 -- (-2055.748) (-2054.860) [-2054.321] (-2055.411) * (-2057.248) [-2053.027] (-2057.546) (-2058.828) -- 0:03:06
459000 -- (-2061.376) [-2053.900] (-2054.716) (-2058.976) * (-2061.968) (-2053.825) [-2054.805] (-2058.325) -- 0:03:06
459500 -- [-2058.519] (-2052.948) (-2061.951) (-2065.901) * (-2054.843) [-2058.295] (-2059.278) (-2064.786) -- 0:03:07
460000 -- (-2056.201) (-2061.202) (-2053.509) [-2058.986] * [-2053.639] (-2059.515) (-2057.470) (-2059.195) -- 0:03:06
Average standard deviation of split frequencies: 0.012280
460500 -- [-2051.893] (-2059.284) (-2053.740) (-2073.195) * [-2056.640] (-2056.889) (-2054.773) (-2059.903) -- 0:03:06
461000 -- (-2056.079) (-2067.876) (-2057.593) [-2056.225] * (-2054.851) [-2054.554] (-2066.609) (-2058.016) -- 0:03:05
461500 -- [-2059.439] (-2068.836) (-2056.693) (-2054.399) * [-2058.198] (-2058.079) (-2056.920) (-2063.959) -- 0:03:05
462000 -- (-2054.810) (-2052.859) (-2058.873) [-2054.614] * (-2059.905) [-2056.296] (-2061.788) (-2065.809) -- 0:03:05
462500 -- (-2053.759) [-2053.067] (-2057.550) (-2061.177) * (-2064.177) (-2061.222) (-2060.293) [-2059.265] -- 0:03:05
463000 -- (-2054.575) (-2063.803) (-2054.106) [-2056.367] * (-2051.445) (-2057.860) [-2063.269] (-2058.294) -- 0:03:05
463500 -- [-2059.878] (-2061.527) (-2053.270) (-2054.947) * [-2052.480] (-2058.917) (-2057.889) (-2062.622) -- 0:03:05
464000 -- (-2059.140) [-2060.236] (-2049.659) (-2054.415) * (-2059.718) (-2051.707) [-2063.118] (-2060.213) -- 0:03:04
464500 -- [-2054.217] (-2055.747) (-2057.692) (-2061.353) * (-2056.427) [-2057.769] (-2058.423) (-2065.892) -- 0:03:04
465000 -- [-2050.301] (-2059.694) (-2056.810) (-2058.197) * [-2057.822] (-2061.417) (-2060.893) (-2058.127) -- 0:03:05
Average standard deviation of split frequencies: 0.010723
465500 -- (-2055.677) [-2052.641] (-2059.634) (-2058.755) * (-2062.122) (-2062.095) [-2056.583] (-2061.098) -- 0:03:04
466000 -- (-2057.069) (-2059.148) [-2057.819] (-2054.253) * (-2062.179) (-2062.516) (-2057.837) [-2060.520] -- 0:03:04
466500 -- (-2056.325) (-2058.745) (-2066.153) [-2053.751] * (-2059.119) (-2060.950) (-2057.656) [-2055.162] -- 0:03:04
467000 -- (-2061.348) (-2059.988) (-2056.582) [-2052.238] * (-2056.106) (-2053.434) (-2054.050) [-2053.829] -- 0:03:03
467500 -- (-2058.216) (-2063.252) (-2057.474) [-2055.395] * [-2055.393] (-2060.271) (-2054.940) (-2062.954) -- 0:03:03
468000 -- (-2056.997) (-2058.087) (-2060.673) [-2062.076] * [-2055.903] (-2067.777) (-2054.007) (-2061.198) -- 0:03:04
468500 -- (-2057.913) (-2054.347) [-2056.719] (-2055.104) * [-2051.601] (-2050.977) (-2065.858) (-2054.787) -- 0:03:03
469000 -- (-2056.877) (-2061.759) [-2057.254] (-2057.383) * (-2055.923) (-2053.390) [-2052.670] (-2064.034) -- 0:03:03
469500 -- (-2057.579) (-2054.630) (-2058.667) [-2056.629] * [-2053.700] (-2061.031) (-2056.786) (-2060.613) -- 0:03:03
470000 -- (-2058.549) [-2059.292] (-2054.993) (-2062.622) * (-2049.652) [-2052.483] (-2051.550) (-2060.366) -- 0:03:02
Average standard deviation of split frequencies: 0.011017
470500 -- (-2060.378) (-2055.183) [-2058.920] (-2063.810) * [-2053.380] (-2060.830) (-2055.874) (-2061.454) -- 0:03:02
471000 -- (-2056.450) (-2053.920) [-2051.198] (-2051.845) * (-2059.572) (-2051.255) (-2055.271) [-2051.945] -- 0:03:03
471500 -- [-2053.520] (-2050.949) (-2058.053) (-2055.116) * (-2054.007) [-2051.743] (-2056.736) (-2055.052) -- 0:03:02
472000 -- (-2049.944) (-2060.186) (-2055.466) [-2053.925] * (-2061.627) (-2050.635) (-2049.532) [-2057.448] -- 0:03:02
472500 -- (-2051.131) (-2058.384) (-2060.366) [-2055.863] * (-2051.816) [-2054.864] (-2051.499) (-2054.688) -- 0:03:01
473000 -- [-2058.319] (-2059.052) (-2062.883) (-2054.308) * [-2054.814] (-2066.163) (-2054.325) (-2053.234) -- 0:03:01
473500 -- (-2063.800) (-2058.315) (-2056.197) [-2053.937] * (-2055.494) (-2065.470) (-2054.605) [-2051.723] -- 0:03:01
474000 -- [-2054.826] (-2056.170) (-2055.902) (-2055.386) * (-2061.301) (-2061.133) (-2058.458) [-2060.092] -- 0:03:01
474500 -- (-2055.770) (-2048.694) [-2054.414] (-2054.037) * (-2062.932) (-2060.079) [-2052.592] (-2060.284) -- 0:03:01
475000 -- (-2065.420) [-2055.711] (-2054.695) (-2061.621) * (-2058.424) [-2058.359] (-2057.745) (-2057.988) -- 0:03:01
Average standard deviation of split frequencies: 0.011686
475500 -- (-2051.079) (-2053.893) [-2059.809] (-2061.991) * (-2051.183) [-2048.713] (-2062.124) (-2057.371) -- 0:03:00
476000 -- (-2060.301) (-2064.045) (-2058.645) [-2053.258] * (-2058.087) (-2060.743) [-2054.950] (-2053.617) -- 0:03:00
476500 -- (-2057.094) (-2054.902) (-2057.465) [-2055.614] * (-2060.742) (-2059.770) [-2052.819] (-2058.745) -- 0:03:00
477000 -- [-2056.383] (-2058.274) (-2060.010) (-2062.591) * [-2052.894] (-2062.390) (-2055.461) (-2052.623) -- 0:03:00
477500 -- [-2055.965] (-2057.776) (-2057.597) (-2057.757) * (-2052.583) (-2050.212) [-2056.322] (-2059.403) -- 0:03:00
478000 -- [-2058.879] (-2058.950) (-2063.168) (-2059.038) * (-2063.543) (-2051.693) (-2057.798) [-2057.310] -- 0:03:00
478500 -- (-2057.687) (-2061.154) [-2059.509] (-2051.326) * (-2073.342) (-2057.978) [-2064.029] (-2052.744) -- 0:02:59
479000 -- [-2062.631] (-2053.572) (-2051.176) (-2055.645) * (-2063.454) (-2059.930) (-2062.589) [-2058.045] -- 0:02:59
479500 -- [-2054.574] (-2053.507) (-2059.912) (-2053.091) * [-2060.403] (-2059.906) (-2063.727) (-2054.441) -- 0:02:59
480000 -- (-2063.288) (-2055.297) [-2063.632] (-2057.831) * [-2053.413] (-2060.049) (-2053.369) (-2055.556) -- 0:02:59
Average standard deviation of split frequencies: 0.011180
480500 -- (-2062.134) [-2053.066] (-2054.175) (-2058.688) * (-2060.467) (-2058.360) (-2060.559) [-2054.838] -- 0:02:59
481000 -- (-2058.658) (-2055.637) [-2053.545] (-2055.867) * (-2054.065) [-2049.991] (-2058.381) (-2061.243) -- 0:02:59
481500 -- [-2052.782] (-2064.362) (-2055.970) (-2056.468) * (-2054.284) (-2052.639) [-2051.379] (-2064.175) -- 0:02:58
482000 -- (-2059.880) (-2058.761) [-2053.592] (-2058.765) * (-2061.561) [-2050.415] (-2057.754) (-2052.518) -- 0:02:58
482500 -- (-2060.854) [-2053.462] (-2057.886) (-2052.495) * (-2058.531) (-2055.598) [-2054.845] (-2053.759) -- 0:02:58
483000 -- (-2054.834) (-2056.074) (-2053.457) [-2054.492] * (-2061.139) [-2057.698] (-2056.386) (-2060.067) -- 0:02:58
483500 -- (-2057.961) [-2053.916] (-2058.002) (-2059.341) * [-2055.379] (-2059.749) (-2051.088) (-2058.969) -- 0:02:58
484000 -- (-2066.651) (-2053.987) (-2057.480) [-2060.187] * (-2054.283) (-2059.384) (-2052.174) [-2053.900] -- 0:02:58
484500 -- (-2062.467) [-2055.210] (-2059.780) (-2064.807) * (-2057.127) [-2058.070] (-2057.484) (-2056.685) -- 0:02:57
485000 -- [-2055.591] (-2052.672) (-2062.436) (-2070.404) * (-2056.793) (-2058.524) (-2055.325) [-2053.449] -- 0:02:57
Average standard deviation of split frequencies: 0.011640
485500 -- [-2052.319] (-2053.081) (-2064.282) (-2057.146) * (-2050.854) [-2052.870] (-2050.743) (-2059.817) -- 0:02:56
486000 -- (-2056.395) (-2057.757) [-2053.492] (-2052.468) * (-2056.275) [-2056.986] (-2057.259) (-2057.142) -- 0:02:57
486500 -- (-2054.777) (-2059.337) [-2054.999] (-2056.215) * (-2063.176) (-2050.941) [-2057.311] (-2065.728) -- 0:02:57
487000 -- (-2053.447) (-2055.249) [-2057.928] (-2069.745) * [-2059.342] (-2053.858) (-2060.592) (-2061.305) -- 0:02:56
487500 -- (-2061.485) (-2064.487) [-2068.984] (-2061.009) * (-2050.951) (-2051.081) (-2053.585) [-2057.635] -- 0:02:56
488000 -- [-2061.135] (-2058.837) (-2060.866) (-2065.227) * (-2065.175) [-2052.502] (-2063.542) (-2065.230) -- 0:02:56
488500 -- (-2057.214) (-2053.886) [-2055.522] (-2055.766) * (-2060.125) (-2056.030) (-2054.864) [-2058.186] -- 0:02:55
489000 -- (-2051.866) (-2058.946) (-2053.192) [-2052.493] * (-2055.158) [-2057.392] (-2062.397) (-2055.924) -- 0:02:56
489500 -- (-2054.597) (-2071.322) (-2055.343) [-2053.381] * [-2058.103] (-2055.946) (-2074.854) (-2060.331) -- 0:02:56
490000 -- (-2060.486) (-2053.220) (-2060.405) [-2054.841] * (-2063.889) [-2056.400] (-2065.111) (-2054.921) -- 0:02:55
Average standard deviation of split frequencies: 0.011721
490500 -- [-2059.110] (-2061.134) (-2050.289) (-2059.877) * (-2056.506) (-2059.552) [-2056.169] (-2057.919) -- 0:02:55
491000 -- (-2063.777) [-2052.521] (-2056.255) (-2060.864) * (-2055.440) [-2054.909] (-2061.331) (-2054.994) -- 0:02:55
491500 -- (-2053.770) (-2059.035) [-2051.987] (-2060.464) * (-2060.757) (-2052.316) (-2053.817) [-2057.933] -- 0:02:55
492000 -- (-2057.791) (-2052.936) (-2061.545) [-2052.015] * (-2053.674) [-2062.635] (-2051.603) (-2060.017) -- 0:02:55
492500 -- (-2056.878) (-2065.302) [-2054.299] (-2057.074) * [-2056.907] (-2060.328) (-2055.622) (-2066.091) -- 0:02:55
493000 -- (-2059.153) (-2055.812) (-2057.211) [-2052.022] * (-2057.601) (-2061.472) (-2054.804) [-2056.097] -- 0:02:54
493500 -- (-2057.161) [-2054.917] (-2054.610) (-2061.293) * (-2049.656) (-2052.802) [-2057.723] (-2054.828) -- 0:02:54
494000 -- (-2060.275) (-2059.379) (-2056.098) [-2051.550] * (-2052.630) (-2059.551) [-2060.474] (-2058.048) -- 0:02:54
494500 -- (-2050.658) [-2054.639] (-2055.461) (-2059.857) * [-2051.608] (-2049.826) (-2051.354) (-2059.954) -- 0:02:54
495000 -- (-2060.732) (-2052.155) [-2055.305] (-2057.960) * [-2056.119] (-2065.018) (-2054.750) (-2060.203) -- 0:02:54
Average standard deviation of split frequencies: 0.011215
495500 -- (-2057.274) (-2063.198) (-2053.210) [-2057.875] * (-2052.792) (-2062.129) [-2054.847] (-2057.274) -- 0:02:54
496000 -- [-2049.594] (-2060.783) (-2055.658) (-2057.831) * (-2067.121) (-2065.131) [-2061.483] (-2056.299) -- 0:02:53
496500 -- [-2055.949] (-2057.065) (-2061.504) (-2054.841) * (-2058.328) (-2054.100) (-2054.943) [-2060.420] -- 0:02:53
497000 -- (-2064.000) (-2057.676) (-2059.585) [-2055.338] * [-2054.785] (-2059.053) (-2067.351) (-2055.022) -- 0:02:53
497500 -- (-2060.907) (-2066.397) (-2054.899) [-2057.584] * [-2054.300] (-2055.552) (-2059.754) (-2059.805) -- 0:02:53
498000 -- (-2064.810) (-2057.656) (-2066.178) [-2060.481] * (-2055.149) (-2056.001) [-2058.557] (-2055.205) -- 0:02:53
498500 -- (-2049.358) (-2059.407) (-2057.774) [-2052.255] * (-2062.809) [-2057.354] (-2061.376) (-2050.815) -- 0:02:53
499000 -- [-2054.439] (-2065.540) (-2059.190) (-2057.036) * (-2054.693) [-2056.682] (-2056.142) (-2053.638) -- 0:02:52
499500 -- [-2051.664] (-2057.618) (-2060.087) (-2056.583) * (-2058.380) (-2057.594) (-2052.800) [-2059.603] -- 0:02:52
500000 -- (-2056.922) (-2058.390) [-2054.254] (-2054.691) * [-2052.177] (-2053.308) (-2065.491) (-2055.878) -- 0:02:52
Average standard deviation of split frequencies: 0.010922
500500 -- (-2064.958) (-2050.989) [-2051.984] (-2063.204) * (-2056.090) (-2053.278) [-2057.914] (-2052.547) -- 0:02:52
501000 -- (-2063.450) [-2053.116] (-2059.668) (-2057.565) * [-2057.212] (-2060.759) (-2052.281) (-2056.409) -- 0:02:52
501500 -- (-2059.613) [-2055.851] (-2053.027) (-2061.393) * (-2058.574) (-2069.163) [-2054.812] (-2057.912) -- 0:02:51
502000 -- (-2067.060) [-2056.181] (-2053.021) (-2054.495) * (-2058.487) (-2058.763) [-2055.310] (-2052.035) -- 0:02:51
502500 -- (-2063.159) (-2058.346) (-2053.166) [-2059.924] * [-2052.024] (-2059.272) (-2050.340) (-2057.317) -- 0:02:51
503000 -- (-2061.180) [-2051.151] (-2057.353) (-2062.318) * (-2056.466) [-2059.616] (-2056.007) (-2060.744) -- 0:02:50
503500 -- [-2060.646] (-2055.724) (-2058.240) (-2052.923) * [-2053.634] (-2054.417) (-2053.458) (-2068.368) -- 0:02:51
504000 -- (-2054.710) (-2063.927) [-2066.115] (-2059.347) * (-2055.118) (-2063.636) (-2051.547) [-2052.168] -- 0:02:51
504500 -- [-2061.131] (-2052.948) (-2061.525) (-2054.976) * (-2058.397) (-2058.609) [-2060.225] (-2058.645) -- 0:02:50
505000 -- (-2060.265) [-2053.007] (-2056.370) (-2058.214) * [-2060.151] (-2059.231) (-2055.767) (-2064.441) -- 0:02:50
Average standard deviation of split frequencies: 0.010621
505500 -- [-2057.419] (-2055.185) (-2061.678) (-2061.942) * [-2050.973] (-2059.354) (-2058.988) (-2055.799) -- 0:02:50
506000 -- [-2052.951] (-2054.276) (-2056.193) (-2057.895) * (-2054.490) [-2055.712] (-2068.533) (-2055.281) -- 0:02:49
506500 -- [-2051.732] (-2048.610) (-2060.486) (-2051.682) * (-2060.246) (-2055.694) [-2052.274] (-2052.239) -- 0:02:50
507000 -- (-2065.581) [-2056.113] (-2056.480) (-2055.062) * (-2050.930) (-2060.297) [-2058.450] (-2055.421) -- 0:02:50
507500 -- (-2057.622) (-2062.934) (-2049.891) [-2049.974] * (-2052.020) (-2059.311) [-2051.906] (-2066.519) -- 0:02:49
508000 -- (-2054.899) (-2058.722) (-2052.635) [-2054.391] * [-2061.267] (-2056.166) (-2061.144) (-2058.959) -- 0:02:49
508500 -- (-2053.967) (-2056.846) [-2058.263] (-2060.008) * (-2059.483) (-2058.876) [-2059.694] (-2061.737) -- 0:02:49
509000 -- (-2063.223) (-2052.890) [-2055.264] (-2060.088) * (-2056.585) (-2057.421) (-2058.988) [-2061.315] -- 0:02:48
509500 -- (-2060.036) (-2061.448) [-2061.812] (-2062.817) * (-2056.701) [-2058.661] (-2066.468) (-2059.383) -- 0:02:49
510000 -- (-2059.427) [-2058.596] (-2058.662) (-2063.130) * (-2053.393) (-2046.485) (-2067.292) [-2061.311] -- 0:02:49
Average standard deviation of split frequencies: 0.011631
510500 -- (-2072.409) [-2050.279] (-2056.233) (-2051.846) * (-2058.516) [-2057.413] (-2054.791) (-2058.662) -- 0:02:48
511000 -- (-2060.871) (-2055.022) [-2056.199] (-2056.293) * (-2056.450) (-2060.743) [-2056.996] (-2060.375) -- 0:02:48
511500 -- (-2053.842) (-2053.671) (-2056.653) [-2053.845] * (-2058.112) [-2053.709] (-2058.351) (-2052.230) -- 0:02:48
512000 -- (-2054.326) (-2057.841) (-2059.237) [-2054.174] * (-2052.689) (-2055.665) (-2052.195) [-2060.675] -- 0:02:48
512500 -- (-2062.727) [-2057.184] (-2058.742) (-2054.976) * (-2056.025) [-2059.045] (-2056.084) (-2061.638) -- 0:02:48
513000 -- (-2057.386) (-2058.325) [-2062.392] (-2054.184) * [-2057.458] (-2056.574) (-2057.306) (-2062.647) -- 0:02:48
513500 -- (-2057.471) (-2054.460) (-2049.482) [-2060.758] * [-2053.043] (-2054.659) (-2055.739) (-2061.143) -- 0:02:47
514000 -- (-2056.438) (-2052.296) [-2055.810] (-2061.125) * (-2056.257) (-2057.148) (-2057.592) [-2054.461] -- 0:02:47
514500 -- (-2055.327) [-2052.651] (-2057.116) (-2051.290) * (-2051.227) (-2055.348) [-2064.125] (-2058.986) -- 0:02:47
515000 -- (-2050.185) [-2059.641] (-2059.784) (-2055.710) * (-2054.724) [-2062.052] (-2070.658) (-2058.448) -- 0:02:47
Average standard deviation of split frequencies: 0.010597
515500 -- (-2056.192) (-2060.935) (-2057.360) [-2053.847] * (-2054.060) (-2058.568) (-2064.201) [-2061.286] -- 0:02:47
516000 -- (-2060.370) (-2065.038) (-2058.971) [-2057.944] * (-2058.312) [-2055.418] (-2066.831) (-2056.391) -- 0:02:46
516500 -- [-2057.680] (-2052.859) (-2055.198) (-2054.997) * (-2060.775) (-2060.572) (-2063.160) [-2056.406] -- 0:02:46
517000 -- (-2056.166) (-2052.813) (-2055.773) [-2051.086] * (-2058.542) [-2066.469] (-2072.720) (-2061.332) -- 0:02:46
517500 -- (-2057.349) [-2057.403] (-2052.922) (-2056.671) * [-2056.387] (-2060.886) (-2069.703) (-2059.604) -- 0:02:45
518000 -- (-2058.582) (-2059.212) (-2058.507) [-2053.136] * (-2058.276) [-2061.842] (-2059.717) (-2062.331) -- 0:02:46
518500 -- [-2053.029] (-2062.124) (-2058.431) (-2056.507) * [-2052.161] (-2061.320) (-2053.527) (-2056.370) -- 0:02:46
519000 -- (-2058.576) (-2059.408) (-2059.527) [-2053.646] * [-2053.289] (-2059.578) (-2055.244) (-2062.442) -- 0:02:45
519500 -- (-2057.491) (-2055.530) [-2058.171] (-2055.419) * (-2050.635) (-2055.631) (-2059.674) [-2053.078] -- 0:02:45
520000 -- (-2057.508) [-2056.403] (-2060.131) (-2059.399) * [-2054.342] (-2054.867) (-2053.566) (-2054.982) -- 0:02:45
Average standard deviation of split frequencies: 0.010865
520500 -- (-2054.079) (-2046.339) (-2056.537) [-2062.926] * [-2054.841] (-2055.545) (-2059.277) (-2058.711) -- 0:02:44
521000 -- [-2053.929] (-2054.552) (-2053.895) (-2053.763) * (-2054.678) (-2055.627) (-2056.649) [-2056.420] -- 0:02:45
521500 -- [-2057.057] (-2054.224) (-2053.254) (-2059.591) * (-2054.043) [-2059.299] (-2060.450) (-2051.401) -- 0:02:45
522000 -- (-2055.777) (-2056.906) [-2053.343] (-2060.327) * (-2051.052) [-2068.067] (-2066.031) (-2062.101) -- 0:02:44
522500 -- (-2059.982) (-2054.394) (-2051.008) [-2049.763] * (-2064.130) [-2054.912] (-2052.702) (-2057.248) -- 0:02:44
523000 -- (-2060.967) (-2052.549) [-2049.799] (-2054.788) * [-2056.993] (-2055.875) (-2055.127) (-2056.062) -- 0:02:44
523500 -- (-2053.545) (-2050.345) [-2055.393] (-2052.130) * [-2059.376] (-2062.381) (-2051.117) (-2050.571) -- 0:02:43
524000 -- (-2052.478) (-2056.662) [-2051.798] (-2052.885) * [-2052.192] (-2056.668) (-2060.977) (-2057.320) -- 0:02:44
524500 -- (-2057.056) (-2059.411) [-2051.300] (-2058.623) * (-2057.963) (-2059.543) [-2058.427] (-2057.021) -- 0:02:44
525000 -- (-2057.814) [-2055.186] (-2065.395) (-2052.383) * (-2052.070) (-2052.117) (-2053.961) [-2060.912] -- 0:02:43
Average standard deviation of split frequencies: 0.011830
525500 -- (-2051.854) [-2058.324] (-2066.504) (-2053.739) * (-2058.500) [-2055.031] (-2061.855) (-2061.428) -- 0:02:43
526000 -- (-2054.974) (-2059.251) (-2060.612) [-2053.599] * [-2060.280] (-2056.186) (-2054.904) (-2061.793) -- 0:02:43
526500 -- (-2057.542) (-2052.540) (-2062.105) [-2050.600] * (-2058.617) (-2061.218) [-2054.912] (-2054.050) -- 0:02:42
527000 -- (-2057.031) [-2057.677] (-2056.492) (-2054.185) * (-2055.460) (-2061.523) [-2052.474] (-2062.705) -- 0:02:43
527500 -- (-2054.809) (-2059.319) (-2055.056) [-2053.070] * [-2053.039] (-2056.071) (-2055.483) (-2059.699) -- 0:02:43
528000 -- [-2057.617] (-2056.424) (-2057.582) (-2053.100) * [-2053.721] (-2053.747) (-2050.038) (-2059.687) -- 0:02:42
528500 -- (-2055.053) [-2052.799] (-2052.659) (-2058.187) * (-2052.061) [-2050.632] (-2067.691) (-2062.003) -- 0:02:42
529000 -- (-2051.920) [-2053.228] (-2062.693) (-2058.017) * [-2054.586] (-2055.968) (-2062.267) (-2064.691) -- 0:02:42
529500 -- [-2058.721] (-2056.886) (-2060.631) (-2052.420) * (-2062.698) (-2052.542) (-2052.515) [-2057.216] -- 0:02:41
530000 -- [-2054.065] (-2062.570) (-2058.620) (-2063.217) * (-2050.405) [-2053.904] (-2060.620) (-2055.212) -- 0:02:42
Average standard deviation of split frequencies: 0.012081
530500 -- (-2051.930) [-2053.477] (-2064.059) (-2057.349) * (-2055.714) [-2055.640] (-2055.345) (-2055.608) -- 0:02:41
531000 -- (-2051.148) [-2057.045] (-2058.383) (-2057.748) * [-2052.109] (-2072.511) (-2055.784) (-2055.077) -- 0:02:41
531500 -- (-2059.065) (-2058.241) (-2057.139) [-2057.083] * (-2058.568) [-2054.388] (-2058.440) (-2052.886) -- 0:02:41
532000 -- (-2057.803) (-2063.809) (-2056.614) [-2056.207] * (-2054.145) (-2067.214) [-2056.162] (-2052.279) -- 0:02:40
532500 -- (-2063.414) (-2055.647) [-2053.174] (-2050.520) * [-2059.017] (-2055.041) (-2063.568) (-2061.311) -- 0:02:40
533000 -- (-2055.489) [-2055.905] (-2057.663) (-2050.433) * (-2062.630) [-2054.105] (-2059.679) (-2059.687) -- 0:02:41
533500 -- (-2078.426) (-2056.866) (-2062.904) [-2057.108] * (-2056.949) (-2060.739) (-2063.159) [-2052.709] -- 0:02:40
534000 -- (-2064.946) (-2055.354) (-2057.367) [-2059.237] * (-2055.597) (-2055.807) (-2057.931) [-2054.968] -- 0:02:40
534500 -- (-2062.772) (-2057.690) [-2060.083] (-2050.853) * (-2053.537) (-2059.007) [-2056.756] (-2060.960) -- 0:02:40
535000 -- (-2053.454) (-2059.000) [-2058.965] (-2057.309) * [-2051.740] (-2058.263) (-2060.143) (-2057.399) -- 0:02:39
Average standard deviation of split frequencies: 0.011961
535500 -- (-2066.705) (-2052.092) (-2058.721) [-2051.025] * (-2059.484) (-2059.567) [-2057.715] (-2055.352) -- 0:02:39
536000 -- [-2055.041] (-2062.799) (-2053.240) (-2058.701) * (-2053.818) (-2056.806) [-2055.658] (-2052.449) -- 0:02:40
536500 -- (-2056.446) (-2057.400) [-2053.500] (-2056.074) * (-2051.525) [-2061.966] (-2062.084) (-2057.792) -- 0:02:39
537000 -- (-2055.730) [-2056.934] (-2053.801) (-2059.169) * (-2065.815) (-2060.990) [-2058.038] (-2054.256) -- 0:02:39
537500 -- (-2056.513) (-2060.073) [-2051.353] (-2055.875) * (-2058.476) (-2058.493) (-2053.423) [-2056.578] -- 0:02:39
538000 -- (-2060.454) (-2065.384) [-2055.663] (-2056.847) * (-2054.049) (-2056.586) (-2058.768) [-2064.511] -- 0:02:38
538500 -- (-2058.509) (-2060.494) [-2053.714] (-2057.829) * [-2053.193] (-2055.844) (-2052.992) (-2064.645) -- 0:02:39
539000 -- (-2062.820) [-2068.767] (-2068.305) (-2060.373) * [-2051.422] (-2055.487) (-2055.937) (-2056.187) -- 0:02:39
539500 -- (-2054.153) [-2055.571] (-2063.839) (-2058.780) * (-2054.682) [-2055.484] (-2054.285) (-2055.673) -- 0:02:38
540000 -- (-2056.183) (-2065.893) [-2055.025] (-2060.024) * (-2054.750) (-2052.665) [-2051.739] (-2053.108) -- 0:02:38
Average standard deviation of split frequencies: 0.010986
540500 -- [-2062.255] (-2055.396) (-2056.675) (-2056.096) * (-2058.945) (-2057.112) [-2051.002] (-2059.351) -- 0:02:38
541000 -- (-2056.908) (-2059.785) [-2050.505] (-2055.780) * (-2056.757) [-2065.160] (-2054.264) (-2056.102) -- 0:02:37
541500 -- [-2056.253] (-2057.545) (-2054.073) (-2057.969) * (-2054.533) (-2057.004) [-2056.368] (-2059.489) -- 0:02:38
542000 -- [-2051.057] (-2063.875) (-2053.498) (-2054.868) * (-2056.734) (-2062.398) [-2053.415] (-2060.909) -- 0:02:38
542500 -- [-2053.606] (-2067.959) (-2053.316) (-2060.205) * (-2060.949) [-2053.198] (-2053.661) (-2053.259) -- 0:02:37
543000 -- [-2054.104] (-2064.544) (-2060.807) (-2056.259) * [-2052.823] (-2064.903) (-2059.524) (-2061.633) -- 0:02:37
543500 -- [-2060.378] (-2054.623) (-2053.448) (-2063.775) * (-2057.124) (-2053.372) [-2058.003] (-2058.366) -- 0:02:37
544000 -- (-2056.079) (-2053.012) (-2061.621) [-2062.927] * [-2052.227] (-2055.804) (-2049.052) (-2060.771) -- 0:02:36
544500 -- (-2054.152) (-2056.196) (-2060.720) [-2060.190] * (-2053.397) (-2057.674) [-2056.160] (-2064.790) -- 0:02:37
545000 -- (-2062.012) (-2056.823) (-2060.360) [-2053.713] * (-2056.175) (-2052.878) [-2051.573] (-2059.316) -- 0:02:36
Average standard deviation of split frequencies: 0.011397
545500 -- (-2058.589) (-2054.174) [-2060.427] (-2055.842) * [-2060.061] (-2059.180) (-2057.278) (-2060.487) -- 0:02:36
546000 -- [-2061.504] (-2058.720) (-2065.458) (-2062.982) * [-2049.732] (-2063.100) (-2056.829) (-2057.843) -- 0:02:36
546500 -- (-2054.470) [-2059.280] (-2051.300) (-2056.487) * (-2050.211) (-2057.987) [-2052.834] (-2053.424) -- 0:02:36
547000 -- (-2054.052) (-2061.199) (-2060.753) [-2052.287] * (-2052.806) [-2059.374] (-2060.680) (-2055.458) -- 0:02:35
547500 -- (-2060.919) (-2055.095) [-2048.949] (-2060.512) * (-2058.500) [-2058.232] (-2064.292) (-2059.962) -- 0:02:36
548000 -- (-2054.878) [-2052.696] (-2055.317) (-2057.911) * (-2060.174) (-2054.697) (-2051.096) [-2062.864] -- 0:02:35
548500 -- (-2062.301) (-2053.370) [-2061.496] (-2060.238) * (-2069.390) [-2052.524] (-2057.555) (-2060.085) -- 0:02:35
549000 -- (-2055.411) (-2053.411) (-2053.291) [-2059.899] * (-2067.844) (-2057.100) (-2050.771) [-2054.535] -- 0:02:35
549500 -- [-2054.632] (-2052.918) (-2055.516) (-2059.388) * (-2063.490) (-2058.016) [-2061.538] (-2056.194) -- 0:02:34
550000 -- (-2063.938) (-2065.018) (-2055.473) [-2055.400] * (-2056.584) (-2049.724) (-2051.690) [-2057.655] -- 0:02:34
Average standard deviation of split frequencies: 0.011985
550500 -- (-2055.645) [-2056.828] (-2053.144) (-2053.820) * (-2065.587) [-2056.809] (-2057.940) (-2053.447) -- 0:02:35
551000 -- (-2054.034) (-2065.946) [-2054.059] (-2048.665) * [-2052.206] (-2052.030) (-2055.821) (-2051.060) -- 0:02:34
551500 -- (-2053.433) (-2051.678) (-2051.825) [-2050.565] * (-2055.017) (-2051.662) (-2057.213) [-2055.711] -- 0:02:34
552000 -- (-2057.325) (-2059.848) [-2056.199] (-2054.236) * (-2062.658) (-2050.866) [-2055.685] (-2054.368) -- 0:02:34
552500 -- (-2054.663) (-2055.601) (-2055.379) [-2058.685] * [-2056.673] (-2058.225) (-2056.000) (-2050.453) -- 0:02:33
553000 -- (-2057.139) (-2066.186) (-2054.923) [-2058.477] * (-2069.807) [-2054.848] (-2064.697) (-2056.530) -- 0:02:33
553500 -- (-2062.335) (-2059.728) [-2054.481] (-2060.244) * [-2061.160] (-2057.446) (-2058.564) (-2065.032) -- 0:02:34
554000 -- (-2055.334) (-2059.566) [-2060.059] (-2058.625) * [-2064.077] (-2057.618) (-2056.151) (-2060.822) -- 0:02:33
554500 -- [-2052.497] (-2054.845) (-2055.537) (-2054.501) * (-2059.114) (-2052.427) (-2064.572) [-2056.387] -- 0:02:33
555000 -- (-2062.020) [-2054.642] (-2058.458) (-2059.342) * (-2058.956) (-2055.141) [-2059.462] (-2056.443) -- 0:02:33
Average standard deviation of split frequencies: 0.011870
555500 -- (-2057.127) (-2054.332) (-2060.442) [-2059.605] * (-2060.035) [-2068.009] (-2062.422) (-2056.383) -- 0:02:32
556000 -- (-2062.088) (-2055.012) [-2062.529] (-2055.449) * (-2052.674) [-2054.052] (-2062.715) (-2064.109) -- 0:02:32
556500 -- [-2054.702] (-2056.283) (-2055.266) (-2053.308) * (-2070.369) (-2055.333) [-2058.213] (-2059.203) -- 0:02:33
557000 -- (-2058.498) (-2058.666) [-2060.461] (-2054.418) * (-2060.291) [-2051.895] (-2051.602) (-2058.495) -- 0:02:32
557500 -- (-2058.250) (-2058.437) [-2051.771] (-2056.239) * (-2058.372) (-2055.285) [-2055.632] (-2052.945) -- 0:02:32
558000 -- (-2054.180) [-2049.314] (-2058.284) (-2058.622) * (-2061.895) (-2058.192) (-2066.093) [-2059.329] -- 0:02:32
558500 -- [-2051.609] (-2061.437) (-2058.079) (-2054.625) * (-2069.712) [-2056.109] (-2058.184) (-2061.043) -- 0:02:31
559000 -- [-2051.644] (-2053.901) (-2054.416) (-2055.824) * (-2071.321) (-2057.060) [-2058.981] (-2059.437) -- 0:02:31
559500 -- (-2053.078) (-2058.206) (-2061.434) [-2058.555] * (-2059.806) (-2057.014) (-2059.760) [-2051.545] -- 0:02:31
560000 -- (-2068.907) (-2053.942) (-2058.538) [-2052.726] * (-2059.046) [-2061.142] (-2059.943) (-2060.708) -- 0:02:31
Average standard deviation of split frequencies: 0.012612
560500 -- [-2050.947] (-2054.945) (-2056.280) (-2059.103) * (-2053.331) (-2056.852) (-2054.769) [-2054.935] -- 0:02:31
561000 -- [-2050.764] (-2050.829) (-2062.898) (-2057.501) * [-2054.770] (-2065.116) (-2053.085) (-2050.781) -- 0:02:31
561500 -- [-2055.739] (-2056.588) (-2057.997) (-2056.784) * [-2056.872] (-2059.964) (-2057.635) (-2054.041) -- 0:02:30
562000 -- (-2056.253) [-2060.181] (-2061.164) (-2063.572) * (-2051.298) (-2057.879) (-2055.618) [-2049.137] -- 0:02:30
562500 -- [-2053.974] (-2062.686) (-2055.932) (-2057.526) * (-2060.461) [-2058.672] (-2061.194) (-2063.260) -- 0:02:30
563000 -- (-2050.175) [-2060.259] (-2054.585) (-2054.765) * (-2061.645) (-2067.605) [-2057.802] (-2050.471) -- 0:02:30
563500 -- (-2056.177) [-2050.979] (-2052.267) (-2056.123) * (-2058.805) (-2051.325) [-2053.258] (-2057.922) -- 0:02:30
564000 -- (-2057.995) (-2051.509) [-2059.803] (-2055.607) * (-2058.723) [-2052.023] (-2059.202) (-2062.784) -- 0:02:29
564500 -- [-2057.468] (-2053.398) (-2056.347) (-2061.688) * (-2058.956) (-2059.548) (-2059.640) [-2053.653] -- 0:02:29
565000 -- [-2055.066] (-2053.672) (-2055.297) (-2059.047) * (-2053.137) (-2056.672) [-2050.481] (-2067.193) -- 0:02:30
Average standard deviation of split frequencies: 0.012826
565500 -- (-2061.435) (-2053.170) [-2062.600] (-2062.482) * (-2059.939) (-2059.626) (-2063.143) [-2054.198] -- 0:02:29
566000 -- [-2054.635] (-2057.313) (-2062.759) (-2055.482) * (-2057.997) (-2055.755) (-2054.522) [-2054.013] -- 0:02:29
566500 -- (-2063.170) [-2050.612] (-2062.541) (-2058.120) * (-2060.324) (-2065.079) (-2053.053) [-2054.466] -- 0:02:29
567000 -- (-2055.842) (-2054.054) (-2062.478) [-2052.964] * [-2057.829] (-2056.101) (-2054.675) (-2051.672) -- 0:02:28
567500 -- (-2060.683) (-2058.492) (-2054.288) [-2063.776] * [-2056.552] (-2059.958) (-2055.437) (-2052.803) -- 0:02:28
568000 -- [-2058.407] (-2063.348) (-2057.632) (-2054.101) * (-2053.881) (-2060.649) [-2055.117] (-2054.350) -- 0:02:29
568500 -- (-2058.114) [-2059.353] (-2053.655) (-2057.060) * [-2058.693] (-2060.753) (-2058.856) (-2068.008) -- 0:02:28
569000 -- (-2063.331) (-2059.237) [-2058.203] (-2049.815) * [-2054.362] (-2061.993) (-2058.418) (-2058.864) -- 0:02:28
569500 -- (-2066.830) (-2056.107) (-2053.775) [-2056.155] * (-2051.940) (-2056.727) (-2051.052) [-2053.777] -- 0:02:28
570000 -- (-2052.564) (-2057.604) (-2064.612) [-2058.517] * (-2059.176) [-2057.527] (-2065.372) (-2057.948) -- 0:02:27
Average standard deviation of split frequencies: 0.011400
570500 -- (-2055.883) [-2054.691] (-2067.738) (-2058.556) * (-2057.798) (-2060.090) (-2057.747) [-2051.367] -- 0:02:27
571000 -- (-2059.119) (-2055.131) [-2061.036] (-2059.549) * (-2051.386) [-2055.535] (-2061.600) (-2052.064) -- 0:02:28
571500 -- (-2054.748) (-2056.565) [-2055.867] (-2064.844) * (-2057.723) (-2057.442) (-2059.949) [-2055.456] -- 0:02:27
572000 -- (-2054.215) [-2060.123] (-2054.963) (-2059.908) * (-2054.180) (-2056.973) [-2055.234] (-2049.247) -- 0:02:27
572500 -- (-2053.506) (-2053.184) (-2056.855) [-2055.572] * [-2056.412] (-2063.522) (-2054.268) (-2053.566) -- 0:02:27
573000 -- (-2058.066) (-2052.932) [-2057.602] (-2060.944) * (-2056.921) (-2064.999) [-2054.095] (-2057.757) -- 0:02:26
573500 -- (-2057.281) (-2054.674) [-2055.558] (-2055.254) * [-2057.260] (-2056.810) (-2061.104) (-2056.311) -- 0:02:26
574000 -- (-2062.430) [-2058.492] (-2055.289) (-2060.299) * (-2056.450) [-2053.574] (-2054.446) (-2061.941) -- 0:02:26
574500 -- (-2056.612) (-2057.572) (-2055.577) [-2053.798] * (-2059.418) (-2056.096) [-2053.222] (-2059.524) -- 0:02:26
575000 -- [-2059.311] (-2055.282) (-2058.429) (-2058.860) * [-2053.630] (-2053.383) (-2055.932) (-2058.069) -- 0:02:26
Average standard deviation of split frequencies: 0.010476
575500 -- [-2055.213] (-2050.887) (-2056.238) (-2050.548) * (-2063.169) (-2056.802) [-2057.588] (-2061.469) -- 0:02:26
576000 -- (-2055.786) [-2054.888] (-2059.334) (-2052.385) * (-2056.218) (-2062.156) [-2058.766] (-2062.125) -- 0:02:25
576500 -- (-2060.498) (-2053.871) [-2055.305] (-2057.253) * (-2057.744) (-2063.391) (-2058.732) [-2053.326] -- 0:02:25
577000 -- (-2060.665) (-2053.719) (-2055.098) [-2056.910] * (-2065.708) (-2061.500) (-2058.380) [-2055.648] -- 0:02:25
577500 -- (-2053.590) [-2057.974] (-2057.354) (-2052.690) * [-2053.497] (-2066.514) (-2055.978) (-2053.537) -- 0:02:25
578000 -- (-2056.756) (-2054.855) [-2054.749] (-2051.936) * (-2060.541) (-2050.952) (-2057.782) [-2054.254] -- 0:02:25
578500 -- (-2056.104) (-2057.560) (-2059.666) [-2052.263] * (-2056.197) (-2061.257) (-2059.001) [-2050.513] -- 0:02:24
579000 -- [-2052.214] (-2057.222) (-2058.683) (-2070.079) * (-2055.732) (-2053.757) (-2055.970) [-2057.329] -- 0:02:24
579500 -- (-2053.909) (-2053.292) [-2053.837] (-2056.388) * (-2061.583) (-2058.462) [-2056.336] (-2053.679) -- 0:02:25
580000 -- (-2061.708) (-2052.681) (-2055.102) [-2054.376] * (-2060.827) [-2059.086] (-2059.524) (-2051.975) -- 0:02:24
Average standard deviation of split frequencies: 0.010229
580500 -- (-2056.147) (-2056.618) (-2053.536) [-2055.925] * [-2051.312] (-2054.236) (-2064.622) (-2059.547) -- 0:02:24
581000 -- (-2054.763) (-2063.840) [-2055.520] (-2056.529) * (-2053.799) (-2060.869) (-2059.482) [-2054.669] -- 0:02:24
581500 -- (-2059.686) (-2056.284) [-2053.470] (-2054.013) * [-2056.875] (-2055.457) (-2063.471) (-2057.952) -- 0:02:23
582000 -- (-2054.876) (-2054.787) (-2059.054) [-2054.644] * (-2065.607) (-2052.630) (-2059.378) [-2055.423] -- 0:02:23
582500 -- [-2049.643] (-2053.458) (-2057.800) (-2058.410) * (-2063.570) (-2056.000) [-2057.557] (-2056.554) -- 0:02:24
583000 -- (-2055.390) (-2055.417) (-2054.869) [-2055.500] * (-2066.670) (-2053.144) (-2057.357) [-2054.087] -- 0:02:23
583500 -- [-2052.542] (-2054.486) (-2058.726) (-2055.429) * (-2055.163) (-2056.554) [-2060.636] (-2058.153) -- 0:02:23
584000 -- (-2054.459) (-2059.871) (-2058.151) [-2057.337] * (-2060.743) [-2055.712] (-2065.233) (-2055.908) -- 0:02:23
584500 -- (-2057.940) [-2054.485] (-2057.192) (-2057.158) * (-2062.138) [-2054.714] (-2060.307) (-2056.401) -- 0:02:22
585000 -- [-2052.881] (-2058.543) (-2054.647) (-2061.213) * (-2066.404) (-2053.099) [-2055.655] (-2058.015) -- 0:02:22
Average standard deviation of split frequencies: 0.009010
585500 -- (-2063.351) [-2049.702] (-2055.696) (-2058.685) * (-2053.703) [-2061.491] (-2056.107) (-2052.420) -- 0:02:23
586000 -- [-2054.410] (-2055.603) (-2059.786) (-2055.987) * [-2060.372] (-2057.775) (-2052.229) (-2056.124) -- 0:02:22
586500 -- (-2056.273) (-2058.178) (-2059.854) [-2051.658] * (-2068.009) [-2059.094] (-2058.481) (-2053.961) -- 0:02:22
587000 -- [-2060.144] (-2052.574) (-2060.740) (-2051.882) * (-2059.957) (-2053.211) (-2058.353) [-2056.925] -- 0:02:22
587500 -- (-2057.922) (-2062.294) (-2050.078) [-2053.900] * [-2054.012] (-2057.376) (-2058.571) (-2061.684) -- 0:02:21
588000 -- (-2060.656) (-2063.563) [-2055.641] (-2057.010) * (-2059.653) (-2056.311) (-2054.792) [-2056.364] -- 0:02:21
588500 -- (-2061.911) (-2057.938) (-2058.335) [-2052.580] * (-2058.800) [-2058.265] (-2053.093) (-2050.602) -- 0:02:21
589000 -- (-2057.768) (-2054.461) [-2053.836] (-2054.083) * (-2055.996) (-2054.233) (-2058.172) [-2053.914] -- 0:02:21
589500 -- [-2055.177] (-2053.672) (-2061.684) (-2061.125) * (-2056.213) [-2051.743] (-2054.952) (-2053.722) -- 0:02:21
590000 -- (-2062.104) [-2056.548] (-2058.815) (-2058.813) * (-2051.776) [-2052.952] (-2063.812) (-2060.634) -- 0:02:21
Average standard deviation of split frequencies: 0.008460
590500 -- (-2061.782) (-2059.918) [-2060.436] (-2057.447) * [-2060.275] (-2056.040) (-2060.204) (-2057.073) -- 0:02:20
591000 -- (-2061.250) [-2056.025] (-2057.686) (-2059.403) * [-2053.183] (-2052.798) (-2065.508) (-2052.507) -- 0:02:21
591500 -- (-2055.740) [-2062.435] (-2068.135) (-2059.483) * [-2055.856] (-2053.801) (-2061.427) (-2054.131) -- 0:02:20
592000 -- (-2058.560) (-2058.198) [-2053.215] (-2056.253) * (-2051.843) (-2062.433) (-2055.115) [-2053.628] -- 0:02:20
592500 -- (-2052.732) (-2061.132) (-2054.253) [-2052.422] * (-2055.984) (-2055.258) (-2063.813) [-2053.504] -- 0:02:20
593000 -- (-2056.026) (-2058.980) [-2050.542] (-2064.195) * [-2054.153] (-2063.154) (-2057.857) (-2057.941) -- 0:02:20
593500 -- [-2054.735] (-2062.755) (-2050.976) (-2058.741) * (-2052.473) (-2058.668) [-2054.628] (-2056.335) -- 0:02:19
594000 -- [-2053.454] (-2058.499) (-2056.648) (-2055.930) * [-2053.861] (-2056.292) (-2061.889) (-2065.070) -- 0:02:20
594500 -- (-2058.897) [-2062.202] (-2050.513) (-2058.577) * (-2055.185) (-2060.317) (-2065.911) [-2053.864] -- 0:02:19
595000 -- (-2054.349) (-2056.466) [-2050.522] (-2052.143) * (-2049.632) [-2055.181] (-2061.095) (-2058.019) -- 0:02:19
Average standard deviation of split frequencies: 0.007593
595500 -- (-2056.703) (-2054.035) (-2052.753) [-2056.494] * [-2064.299] (-2055.505) (-2062.237) (-2056.210) -- 0:02:19
596000 -- (-2057.707) (-2054.162) [-2053.236] (-2065.136) * (-2061.222) [-2055.343] (-2058.422) (-2057.379) -- 0:02:18
596500 -- [-2052.698] (-2060.378) (-2062.419) (-2056.081) * (-2057.927) [-2053.266] (-2063.152) (-2060.299) -- 0:02:18
597000 -- (-2055.758) (-2056.434) (-2067.661) [-2058.127] * [-2054.428] (-2059.012) (-2063.326) (-2062.685) -- 0:02:19
597500 -- (-2055.046) (-2059.253) (-2064.260) [-2053.384] * (-2054.546) (-2055.528) [-2059.191] (-2062.178) -- 0:02:18
598000 -- [-2055.346] (-2070.244) (-2071.032) (-2050.676) * (-2058.972) (-2059.230) [-2054.633] (-2058.054) -- 0:02:18
598500 -- (-2053.060) [-2053.815] (-2057.466) (-2057.557) * (-2060.414) [-2056.881] (-2057.643) (-2051.307) -- 0:02:18
599000 -- [-2060.140] (-2053.070) (-2062.586) (-2058.512) * [-2055.661] (-2063.641) (-2057.987) (-2056.761) -- 0:02:17
599500 -- (-2065.735) [-2051.213] (-2069.543) (-2052.696) * (-2062.235) [-2054.140] (-2059.882) (-2066.966) -- 0:02:17
600000 -- (-2060.786) [-2058.164] (-2062.558) (-2060.195) * (-2054.670) [-2059.163] (-2059.679) (-2057.265) -- 0:02:18
Average standard deviation of split frequencies: 0.007377
600500 -- (-2052.854) (-2055.455) [-2055.943] (-2055.468) * [-2058.351] (-2060.304) (-2056.787) (-2058.780) -- 0:02:17
601000 -- (-2056.447) [-2055.122] (-2055.184) (-2054.482) * (-2062.008) (-2058.525) [-2061.375] (-2059.619) -- 0:02:17
601500 -- (-2055.878) (-2063.525) [-2053.889] (-2052.263) * (-2055.181) (-2060.630) [-2054.814] (-2060.184) -- 0:02:17
602000 -- (-2055.010) (-2061.387) (-2061.469) [-2053.202] * (-2056.984) (-2053.214) [-2054.327] (-2062.547) -- 0:02:16
602500 -- (-2057.967) (-2057.804) [-2055.816] (-2056.460) * (-2063.892) (-2056.605) (-2052.973) [-2056.099] -- 0:02:16
603000 -- [-2060.945] (-2052.043) (-2054.375) (-2058.328) * (-2056.989) (-2067.438) (-2059.818) [-2059.112] -- 0:02:16
603500 -- (-2052.809) [-2063.463] (-2055.080) (-2055.530) * [-2055.980] (-2061.303) (-2058.355) (-2052.500) -- 0:02:16
604000 -- [-2055.326] (-2066.502) (-2059.030) (-2058.164) * (-2057.199) (-2066.828) [-2052.269] (-2052.264) -- 0:02:16
604500 -- (-2063.767) (-2051.050) (-2059.395) [-2059.332] * (-2059.212) (-2058.830) (-2057.756) [-2053.870] -- 0:02:16
605000 -- (-2061.373) (-2053.903) [-2060.143] (-2060.171) * [-2057.697] (-2060.720) (-2059.043) (-2053.560) -- 0:02:15
Average standard deviation of split frequencies: 0.007157
605500 -- (-2061.755) (-2053.703) [-2051.391] (-2058.236) * [-2055.627] (-2060.535) (-2057.468) (-2060.613) -- 0:02:16
606000 -- (-2053.941) [-2058.917] (-2059.531) (-2057.580) * (-2062.980) (-2062.593) [-2058.760] (-2061.903) -- 0:02:15
606500 -- (-2056.684) (-2057.449) (-2058.732) [-2059.475] * (-2058.607) (-2065.023) (-2054.524) [-2051.757] -- 0:02:15
607000 -- (-2061.924) (-2058.289) [-2057.814] (-2051.857) * (-2057.480) (-2062.132) [-2056.666] (-2056.791) -- 0:02:15
607500 -- (-2058.242) (-2051.317) [-2052.194] (-2060.165) * [-2054.921] (-2058.319) (-2051.901) (-2052.275) -- 0:02:15
608000 -- (-2066.276) [-2051.906] (-2052.943) (-2057.829) * (-2058.234) (-2062.044) (-2050.560) [-2061.508] -- 0:02:14
608500 -- (-2067.205) [-2055.239] (-2054.883) (-2056.577) * (-2057.333) (-2057.049) [-2058.825] (-2055.895) -- 0:02:15
609000 -- (-2060.589) [-2057.169] (-2055.959) (-2054.423) * [-2059.686] (-2058.619) (-2054.160) (-2059.282) -- 0:02:14
609500 -- [-2062.395] (-2049.566) (-2049.966) (-2057.956) * (-2056.626) (-2057.740) (-2057.213) [-2053.396] -- 0:02:14
610000 -- (-2056.222) (-2059.339) [-2059.082] (-2058.094) * [-2048.616] (-2060.392) (-2069.248) (-2061.534) -- 0:02:14
Average standard deviation of split frequencies: 0.007102
610500 -- [-2058.297] (-2052.106) (-2053.820) (-2055.703) * [-2050.524] (-2066.885) (-2061.158) (-2052.967) -- 0:02:13
611000 -- (-2059.764) (-2059.476) (-2053.630) [-2055.121] * [-2049.374] (-2062.390) (-2066.732) (-2054.677) -- 0:02:13
611500 -- (-2051.030) [-2058.600] (-2063.914) (-2058.779) * (-2055.239) (-2066.478) [-2056.543] (-2059.294) -- 0:02:14
612000 -- (-2057.378) (-2054.434) (-2066.196) [-2052.358] * (-2060.890) (-2072.456) (-2064.700) [-2058.970] -- 0:02:13
612500 -- [-2060.442] (-2060.470) (-2058.329) (-2061.186) * [-2054.967] (-2058.353) (-2055.893) (-2061.189) -- 0:02:13
613000 -- (-2058.091) (-2055.374) [-2052.757] (-2055.581) * [-2060.853] (-2056.637) (-2059.636) (-2061.183) -- 0:02:13
613500 -- (-2057.898) (-2052.595) [-2061.102] (-2058.131) * (-2053.191) (-2057.871) [-2052.865] (-2052.495) -- 0:02:12
614000 -- [-2050.379] (-2059.106) (-2067.860) (-2061.422) * (-2065.272) (-2056.168) (-2062.141) [-2052.206] -- 0:02:12
614500 -- (-2056.212) (-2052.362) [-2058.128] (-2054.478) * (-2072.858) (-2057.287) (-2059.289) [-2049.570] -- 0:02:12
615000 -- [-2052.866] (-2061.990) (-2057.825) (-2051.039) * (-2059.022) [-2055.190] (-2066.636) (-2055.676) -- 0:02:12
Average standard deviation of split frequencies: 0.007040
615500 -- (-2052.390) [-2055.492] (-2066.762) (-2055.907) * [-2052.615] (-2057.874) (-2057.187) (-2055.755) -- 0:02:12
616000 -- [-2052.822] (-2060.001) (-2061.233) (-2054.188) * (-2056.687) (-2063.370) (-2057.203) [-2061.062] -- 0:02:12
616500 -- [-2054.587] (-2063.127) (-2063.208) (-2063.894) * (-2065.912) (-2053.861) [-2051.108] (-2060.803) -- 0:02:11
617000 -- [-2054.701] (-2060.093) (-2050.649) (-2060.938) * (-2055.753) [-2053.849] (-2055.068) (-2068.595) -- 0:02:11
617500 -- [-2049.043] (-2058.351) (-2059.682) (-2053.170) * (-2050.140) [-2051.667] (-2059.821) (-2068.085) -- 0:02:11
618000 -- (-2053.399) (-2054.979) [-2059.328] (-2059.195) * [-2052.261] (-2063.054) (-2055.174) (-2061.488) -- 0:02:11
618500 -- (-2056.951) [-2058.019] (-2054.046) (-2061.126) * (-2050.589) (-2054.309) [-2054.102] (-2061.978) -- 0:02:11
619000 -- (-2056.164) (-2058.880) [-2065.028] (-2051.305) * (-2058.643) (-2052.609) [-2055.884] (-2058.859) -- 0:02:11
619500 -- (-2059.387) (-2058.268) [-2053.862] (-2055.289) * (-2060.266) (-2059.716) [-2052.296] (-2063.631) -- 0:02:10
620000 -- (-2057.469) (-2065.045) (-2054.768) [-2055.748] * (-2055.654) (-2055.356) (-2064.007) [-2058.505] -- 0:02:10
Average standard deviation of split frequencies: 0.007443
620500 -- [-2051.813] (-2072.184) (-2052.248) (-2053.953) * (-2062.615) (-2055.515) [-2057.229] (-2053.272) -- 0:02:10
621000 -- [-2065.532] (-2073.193) (-2056.650) (-2051.384) * (-2056.978) [-2055.508] (-2053.943) (-2062.705) -- 0:02:10
621500 -- (-2053.328) (-2062.163) (-2057.790) [-2050.420] * (-2060.034) (-2053.256) (-2054.914) [-2056.982] -- 0:02:10
622000 -- [-2058.012] (-2055.623) (-2064.067) (-2064.424) * (-2055.483) (-2054.157) (-2054.379) [-2064.426] -- 0:02:10
622500 -- [-2062.767] (-2056.767) (-2063.591) (-2054.657) * (-2055.351) [-2058.545] (-2063.953) (-2063.901) -- 0:02:09
623000 -- [-2054.728] (-2060.583) (-2057.466) (-2055.818) * (-2065.467) (-2053.293) [-2057.393] (-2056.055) -- 0:02:09
623500 -- (-2056.471) (-2060.251) (-2061.262) [-2055.381] * [-2053.224] (-2050.989) (-2060.340) (-2062.089) -- 0:02:09
624000 -- (-2052.424) (-2058.123) (-2060.122) [-2051.213] * [-2053.765] (-2055.259) (-2061.147) (-2058.357) -- 0:02:09
624500 -- (-2065.757) (-2053.439) [-2059.996] (-2058.827) * [-2065.405] (-2055.931) (-2056.554) (-2058.747) -- 0:02:09
625000 -- [-2050.663] (-2064.264) (-2054.813) (-2055.173) * (-2056.238) [-2057.692] (-2059.479) (-2062.442) -- 0:02:09
Average standard deviation of split frequencies: 0.007079
625500 -- [-2061.733] (-2063.048) (-2052.841) (-2061.860) * (-2052.135) (-2055.719) [-2056.376] (-2059.994) -- 0:02:08
626000 -- (-2058.424) (-2057.533) (-2066.877) [-2070.686] * (-2071.453) (-2064.590) (-2054.026) [-2052.504] -- 0:02:08
626500 -- (-2056.373) (-2058.675) [-2059.735] (-2068.152) * (-2058.027) (-2054.084) (-2060.477) [-2048.678] -- 0:02:08
627000 -- [-2056.134] (-2057.640) (-2053.264) (-2067.657) * (-2063.912) [-2055.205] (-2059.921) (-2060.480) -- 0:02:08
627500 -- (-2055.064) (-2053.914) (-2054.842) [-2068.885] * (-2058.592) (-2064.912) (-2058.758) [-2057.539] -- 0:02:08
628000 -- [-2051.498] (-2057.236) (-2053.891) (-2059.609) * (-2056.589) (-2058.618) (-2062.870) [-2063.089] -- 0:02:07
628500 -- (-2052.391) (-2051.887) (-2054.070) [-2060.556] * [-2057.572] (-2061.369) (-2060.374) (-2060.499) -- 0:02:07
629000 -- (-2049.418) [-2056.108] (-2057.524) (-2060.138) * (-2061.514) (-2056.956) (-2054.868) [-2067.944] -- 0:02:07
629500 -- (-2054.124) (-2054.848) [-2048.096] (-2065.100) * (-2054.871) [-2055.825] (-2052.439) (-2056.506) -- 0:02:07
630000 -- (-2054.887) (-2055.586) (-2054.737) [-2057.076] * (-2058.781) [-2054.073] (-2056.624) (-2055.611) -- 0:02:07
Average standard deviation of split frequencies: 0.008222
630500 -- (-2059.832) (-2059.681) (-2069.015) [-2051.564] * [-2056.596] (-2064.761) (-2055.451) (-2062.922) -- 0:02:07
631000 -- [-2056.272] (-2058.114) (-2074.252) (-2055.759) * (-2053.184) (-2060.034) (-2051.229) [-2060.459] -- 0:02:06
631500 -- (-2055.145) [-2054.528] (-2072.556) (-2056.657) * [-2061.250] (-2060.740) (-2060.644) (-2058.832) -- 0:02:06
632000 -- [-2055.312] (-2060.068) (-2057.161) (-2060.776) * [-2052.557] (-2053.270) (-2067.668) (-2062.885) -- 0:02:06
632500 -- (-2051.102) (-2055.018) (-2055.012) [-2064.145] * (-2055.819) (-2054.705) [-2058.368] (-2060.615) -- 0:02:06
633000 -- [-2053.408] (-2056.694) (-2059.513) (-2053.649) * [-2056.018] (-2059.438) (-2056.187) (-2062.474) -- 0:02:06
633500 -- (-2054.552) [-2062.372] (-2058.043) (-2055.427) * [-2053.830] (-2058.382) (-2056.518) (-2056.847) -- 0:02:06
634000 -- [-2055.536] (-2061.292) (-2053.280) (-2055.011) * (-2056.115) (-2057.172) [-2057.571] (-2051.549) -- 0:02:05
634500 -- [-2056.502] (-2057.840) (-2053.796) (-2058.558) * (-2055.373) (-2054.428) (-2052.698) [-2054.686] -- 0:02:05
635000 -- [-2055.264] (-2055.991) (-2052.671) (-2055.705) * (-2057.853) (-2055.810) [-2055.001] (-2056.797) -- 0:02:05
Average standard deviation of split frequencies: 0.008153
635500 -- (-2055.738) (-2060.632) (-2055.355) [-2055.837] * (-2056.796) [-2059.183] (-2052.984) (-2053.156) -- 0:02:05
636000 -- (-2054.919) (-2060.331) (-2056.126) [-2056.475] * (-2060.188) [-2057.957] (-2053.798) (-2062.735) -- 0:02:05
636500 -- [-2056.623] (-2061.334) (-2061.807) (-2062.656) * [-2054.542] (-2057.711) (-2058.673) (-2062.445) -- 0:02:05
637000 -- (-2060.035) (-2064.856) (-2055.511) [-2055.026] * [-2058.696] (-2056.200) (-2062.119) (-2054.104) -- 0:02:04
637500 -- [-2048.498] (-2060.408) (-2058.997) (-2054.188) * (-2053.176) (-2053.139) (-2057.652) [-2053.708] -- 0:02:04
638000 -- (-2049.775) (-2065.145) (-2060.493) [-2053.597] * (-2061.340) (-2057.675) (-2055.921) [-2060.618] -- 0:02:04
638500 -- (-2058.969) [-2055.828] (-2055.486) (-2058.906) * (-2053.983) (-2059.241) (-2055.927) [-2069.268] -- 0:02:04
639000 -- (-2061.326) (-2065.168) (-2055.671) [-2063.728] * (-2059.093) (-2065.658) [-2059.711] (-2056.183) -- 0:02:04
639500 -- (-2054.145) (-2055.100) (-2054.053) [-2053.904] * (-2052.729) [-2064.976] (-2061.340) (-2058.718) -- 0:02:04
640000 -- [-2060.490] (-2061.571) (-2054.586) (-2058.561) * (-2052.100) [-2059.775] (-2058.532) (-2066.948) -- 0:02:03
Average standard deviation of split frequencies: 0.008682
640500 -- (-2057.916) (-2057.377) [-2059.554] (-2057.107) * (-2058.340) (-2065.954) [-2056.016] (-2060.980) -- 0:02:03
641000 -- [-2059.369] (-2056.406) (-2056.512) (-2055.610) * (-2058.840) (-2054.262) (-2061.882) [-2057.856] -- 0:02:03
641500 -- [-2057.866] (-2059.125) (-2061.198) (-2055.985) * [-2053.644] (-2053.729) (-2056.572) (-2066.638) -- 0:02:03
642000 -- (-2059.423) [-2055.509] (-2050.408) (-2054.914) * (-2054.357) (-2057.902) [-2056.881] (-2074.475) -- 0:02:03
642500 -- (-2055.808) [-2051.500] (-2053.217) (-2056.239) * (-2065.259) [-2050.671] (-2054.616) (-2062.441) -- 0:02:02
643000 -- [-2056.170] (-2054.394) (-2057.361) (-2050.810) * [-2062.519] (-2055.119) (-2058.808) (-2055.066) -- 0:02:02
643500 -- (-2054.660) (-2056.465) [-2058.474] (-2049.005) * (-2066.213) (-2055.487) [-2061.109] (-2060.761) -- 0:02:02
644000 -- [-2054.361] (-2059.174) (-2058.816) (-2056.435) * (-2059.644) (-2062.944) [-2060.948] (-2061.945) -- 0:02:02
644500 -- (-2065.456) [-2051.686] (-2057.482) (-2064.294) * [-2053.698] (-2068.804) (-2058.959) (-2064.183) -- 0:02:02
645000 -- (-2056.566) (-2049.283) (-2054.283) [-2054.245] * [-2056.060] (-2055.395) (-2062.297) (-2063.257) -- 0:02:02
Average standard deviation of split frequencies: 0.008757
645500 -- [-2055.736] (-2062.769) (-2058.827) (-2063.674) * (-2053.886) (-2055.064) (-2055.795) [-2060.730] -- 0:02:01
646000 -- [-2054.921] (-2067.689) (-2056.065) (-2061.695) * (-2051.373) [-2051.894] (-2058.933) (-2066.083) -- 0:02:01
646500 -- (-2056.186) (-2070.160) (-2048.984) [-2064.613] * [-2054.705] (-2059.976) (-2051.051) (-2059.272) -- 0:02:01
647000 -- [-2058.454] (-2062.616) (-2053.888) (-2057.580) * (-2054.106) (-2055.916) (-2059.697) [-2062.693] -- 0:02:01
647500 -- (-2052.411) (-2059.143) [-2055.668] (-2059.291) * (-2063.478) [-2054.926] (-2061.819) (-2059.764) -- 0:02:01
648000 -- (-2060.166) (-2063.593) (-2059.329) [-2059.348] * [-2050.461] (-2058.140) (-2061.401) (-2065.426) -- 0:02:01
648500 -- (-2059.910) [-2052.405] (-2058.914) (-2065.366) * (-2049.993) (-2055.625) (-2056.524) [-2055.727] -- 0:02:00
649000 -- (-2052.916) [-2057.184] (-2057.445) (-2055.204) * (-2055.828) (-2052.134) [-2055.995] (-2053.756) -- 0:02:00
649500 -- (-2062.535) (-2059.056) (-2051.018) [-2054.435] * (-2053.097) (-2058.433) [-2062.255] (-2062.452) -- 0:02:00
650000 -- (-2066.509) [-2051.158] (-2057.292) (-2055.381) * (-2064.192) (-2060.794) [-2051.551] (-2065.413) -- 0:02:00
Average standard deviation of split frequencies: 0.008839
650500 -- [-2056.938] (-2064.819) (-2053.080) (-2055.540) * (-2052.729) (-2055.639) (-2054.117) [-2061.200] -- 0:02:00
651000 -- (-2057.611) [-2056.748] (-2062.897) (-2061.473) * (-2056.610) [-2053.288] (-2058.944) (-2058.092) -- 0:02:00
651500 -- (-2056.517) [-2053.586] (-2061.787) (-2049.564) * (-2057.498) [-2055.489] (-2056.749) (-2057.857) -- 0:01:59
652000 -- (-2057.158) (-2057.805) [-2054.744] (-2051.788) * (-2058.318) (-2056.168) [-2048.642] (-2052.462) -- 0:01:59
652500 -- (-2052.731) (-2053.017) [-2062.270] (-2059.952) * (-2057.310) (-2059.857) [-2049.760] (-2051.458) -- 0:01:59
653000 -- (-2059.363) [-2053.173] (-2063.905) (-2060.612) * (-2052.402) (-2058.373) [-2053.880] (-2056.963) -- 0:01:59
653500 -- (-2055.459) (-2057.088) (-2056.682) [-2061.016] * [-2056.653] (-2060.799) (-2056.687) (-2065.537) -- 0:01:59
654000 -- [-2058.452] (-2061.803) (-2055.669) (-2058.767) * [-2057.407] (-2058.202) (-2059.183) (-2062.651) -- 0:01:59
654500 -- (-2059.748) (-2065.171) [-2050.517] (-2056.126) * [-2053.625] (-2057.387) (-2059.790) (-2061.402) -- 0:01:58
655000 -- (-2066.864) (-2072.315) (-2055.280) [-2053.352] * (-2058.824) [-2056.820] (-2054.873) (-2065.066) -- 0:01:58
Average standard deviation of split frequencies: 0.008911
655500 -- (-2055.792) (-2058.460) (-2056.168) [-2059.488] * (-2056.174) (-2054.683) (-2057.808) [-2061.276] -- 0:01:58
656000 -- (-2052.982) (-2056.506) [-2051.942] (-2055.275) * (-2056.757) [-2055.027] (-2059.491) (-2057.941) -- 0:01:58
656500 -- [-2052.344] (-2053.639) (-2054.735) (-2062.145) * (-2052.767) [-2056.785] (-2049.710) (-2058.595) -- 0:01:58
657000 -- [-2058.127] (-2055.937) (-2054.479) (-2058.594) * (-2066.361) (-2058.754) [-2054.958] (-2054.616) -- 0:01:57
657500 -- (-2050.194) (-2054.213) [-2053.224] (-2055.277) * (-2053.473) [-2054.526] (-2054.236) (-2064.145) -- 0:01:57
658000 -- [-2053.980] (-2063.772) (-2063.523) (-2057.340) * [-2061.613] (-2061.364) (-2063.030) (-2056.959) -- 0:01:57
658500 -- (-2058.352) (-2057.378) (-2062.545) [-2053.452] * (-2060.615) [-2054.600] (-2058.192) (-2054.011) -- 0:01:57
659000 -- (-2063.467) (-2063.001) (-2065.862) [-2054.347] * (-2062.439) (-2059.336) [-2062.986] (-2049.954) -- 0:01:57
659500 -- (-2063.602) (-2063.355) [-2067.462] (-2060.873) * (-2064.941) (-2063.342) [-2065.082] (-2056.489) -- 0:01:57
660000 -- (-2059.249) [-2054.010] (-2057.982) (-2050.868) * (-2056.381) [-2056.370] (-2056.859) (-2056.629) -- 0:01:56
Average standard deviation of split frequencies: 0.009561
660500 -- (-2054.721) (-2065.222) [-2059.543] (-2053.470) * (-2054.756) (-2055.984) (-2058.215) [-2059.939] -- 0:01:56
661000 -- [-2055.657] (-2058.069) (-2061.826) (-2054.668) * (-2052.888) (-2061.433) [-2058.785] (-2056.030) -- 0:01:56
661500 -- (-2060.400) [-2055.594] (-2056.764) (-2057.348) * (-2060.681) (-2057.047) [-2060.443] (-2053.098) -- 0:01:56
662000 -- (-2054.216) [-2054.637] (-2058.749) (-2056.584) * (-2060.684) (-2060.901) [-2058.627] (-2055.707) -- 0:01:56
662500 -- (-2051.669) [-2056.406] (-2065.681) (-2050.733) * (-2059.590) [-2056.498] (-2055.401) (-2056.053) -- 0:01:56
663000 -- (-2056.117) [-2050.731] (-2057.071) (-2057.620) * (-2054.309) (-2051.857) (-2061.085) [-2055.202] -- 0:01:55
663500 -- (-2062.660) (-2059.781) (-2054.027) [-2052.645] * (-2057.395) (-2065.555) (-2059.471) [-2055.595] -- 0:01:55
664000 -- (-2058.525) [-2054.114] (-2052.024) (-2054.993) * (-2052.640) (-2055.531) [-2065.839] (-2063.304) -- 0:01:55
664500 -- (-2054.226) (-2052.995) (-2052.734) [-2056.176] * [-2052.613] (-2069.308) (-2056.992) (-2068.016) -- 0:01:55
665000 -- (-2053.517) (-2061.001) (-2053.882) [-2052.106] * (-2050.279) [-2055.366] (-2065.279) (-2061.294) -- 0:01:55
Average standard deviation of split frequencies: 0.009768
665500 -- [-2052.046] (-2053.976) (-2056.134) (-2051.255) * (-2066.570) (-2057.319) [-2055.970] (-2054.450) -- 0:01:55
666000 -- (-2056.910) (-2060.177) (-2054.437) [-2058.049] * (-2056.609) (-2054.320) (-2056.801) [-2051.074] -- 0:01:54
666500 -- [-2054.535] (-2054.273) (-2064.236) (-2055.095) * [-2052.204] (-2058.701) (-2054.875) (-2053.991) -- 0:01:54
667000 -- (-2057.948) (-2058.383) (-2055.458) [-2054.952] * (-2057.078) (-2054.454) [-2056.596] (-2050.215) -- 0:01:54
667500 -- (-2053.873) [-2055.693] (-2063.747) (-2052.508) * (-2054.545) (-2060.594) (-2069.702) [-2052.865] -- 0:01:54
668000 -- (-2056.796) (-2069.199) [-2055.080] (-2057.973) * (-2057.813) (-2053.325) [-2055.315] (-2056.767) -- 0:01:54
668500 -- (-2052.142) (-2063.255) (-2057.092) [-2054.179] * [-2053.567] (-2050.480) (-2055.798) (-2065.692) -- 0:01:54
669000 -- (-2052.781) (-2058.001) [-2059.521] (-2056.635) * (-2052.194) (-2060.037) (-2054.657) [-2061.727] -- 0:01:53
669500 -- (-2060.315) (-2068.552) (-2059.322) [-2051.696] * [-2053.344] (-2059.704) (-2055.937) (-2053.293) -- 0:01:53
670000 -- (-2060.041) (-2055.873) [-2057.195] (-2057.427) * (-2055.860) [-2052.109] (-2056.070) (-2055.409) -- 0:01:53
Average standard deviation of split frequencies: 0.009840
670500 -- [-2053.600] (-2065.757) (-2055.577) (-2061.245) * [-2053.424] (-2058.880) (-2058.441) (-2055.023) -- 0:01:53
671000 -- (-2059.873) (-2056.575) (-2052.948) [-2059.429] * (-2052.328) (-2056.540) [-2048.837] (-2055.059) -- 0:01:53
671500 -- (-2065.393) (-2055.466) (-2055.526) [-2061.947] * (-2057.530) (-2054.088) (-2052.261) [-2056.611] -- 0:01:53
672000 -- (-2062.070) (-2055.742) [-2058.701] (-2065.912) * (-2059.416) (-2055.406) (-2055.916) [-2060.885] -- 0:01:52
672500 -- [-2059.529] (-2058.566) (-2056.081) (-2061.445) * (-2054.433) (-2056.641) (-2056.476) [-2053.184] -- 0:01:52
673000 -- (-2055.604) [-2058.982] (-2063.591) (-2054.457) * (-2056.739) (-2060.231) [-2052.170] (-2053.197) -- 0:01:52
673500 -- [-2051.304] (-2055.705) (-2067.541) (-2063.067) * (-2057.152) [-2051.879] (-2059.728) (-2054.775) -- 0:01:52
674000 -- (-2057.771) [-2053.018] (-2061.439) (-2056.724) * [-2060.819] (-2051.125) (-2055.434) (-2064.438) -- 0:01:52
674500 -- (-2057.058) [-2052.258] (-2065.456) (-2062.850) * (-2054.116) [-2063.521] (-2062.223) (-2057.938) -- 0:01:51
675000 -- (-2056.482) [-2054.455] (-2069.602) (-2060.736) * (-2058.912) (-2057.105) [-2051.405] (-2056.739) -- 0:01:51
Average standard deviation of split frequencies: 0.010321
675500 -- (-2060.851) [-2055.098] (-2063.502) (-2060.142) * [-2050.957] (-2060.735) (-2057.125) (-2054.555) -- 0:01:51
676000 -- [-2053.291] (-2053.216) (-2054.254) (-2054.801) * (-2060.636) [-2053.291] (-2063.203) (-2050.359) -- 0:01:51
676500 -- (-2061.058) (-2065.180) (-2061.008) [-2057.350] * (-2064.117) (-2055.739) (-2058.468) [-2051.790] -- 0:01:51
677000 -- (-2057.057) (-2052.010) [-2053.053] (-2054.009) * (-2055.255) [-2058.637] (-2058.088) (-2051.689) -- 0:01:51
677500 -- [-2056.870] (-2060.794) (-2053.957) (-2060.996) * (-2062.281) (-2058.053) [-2060.018] (-2054.178) -- 0:01:50
678000 -- (-2051.426) [-2057.155] (-2054.016) (-2058.929) * [-2056.985] (-2059.363) (-2054.578) (-2065.393) -- 0:01:50
678500 -- [-2061.261] (-2056.619) (-2059.079) (-2060.893) * (-2061.399) (-2060.899) [-2054.275] (-2060.179) -- 0:01:50
679000 -- [-2056.391] (-2064.325) (-2059.439) (-2056.738) * (-2062.831) (-2064.453) (-2063.358) [-2056.648] -- 0:01:50
679500 -- [-2053.342] (-2061.035) (-2058.291) (-2063.159) * (-2055.631) (-2053.518) (-2055.799) [-2057.008] -- 0:01:50
680000 -- [-2052.522] (-2058.073) (-2062.517) (-2057.505) * [-2054.914] (-2059.283) (-2063.877) (-2058.952) -- 0:01:50
Average standard deviation of split frequencies: 0.009973
680500 -- (-2054.793) [-2055.222] (-2055.928) (-2068.592) * (-2060.979) [-2053.304] (-2053.531) (-2056.396) -- 0:01:49
681000 -- [-2055.501] (-2050.719) (-2055.013) (-2068.688) * (-2053.898) (-2059.130) (-2058.757) [-2055.940] -- 0:01:49
681500 -- (-2054.687) (-2056.996) [-2060.303] (-2058.667) * [-2054.754] (-2050.914) (-2073.746) (-2057.927) -- 0:01:49
682000 -- (-2054.047) (-2058.421) [-2053.814] (-2060.285) * (-2057.847) (-2055.513) (-2061.727) [-2055.127] -- 0:01:49
682500 -- (-2059.614) (-2057.618) [-2051.826] (-2059.316) * (-2054.152) (-2052.793) (-2058.017) [-2052.771] -- 0:01:49
683000 -- (-2057.183) (-2067.369) [-2052.668] (-2060.302) * (-2056.102) [-2058.217] (-2062.177) (-2058.778) -- 0:01:49
683500 -- (-2057.637) [-2061.682] (-2053.955) (-2068.330) * [-2057.085] (-2061.030) (-2064.003) (-2053.144) -- 0:01:48
684000 -- [-2059.337] (-2059.134) (-2056.434) (-2055.200) * (-2055.210) (-2059.186) (-2061.342) [-2059.292] -- 0:01:48
684500 -- (-2057.632) [-2051.500] (-2051.698) (-2053.466) * (-2066.433) [-2058.233] (-2058.187) (-2062.413) -- 0:01:48
685000 -- [-2051.625] (-2058.352) (-2057.389) (-2059.352) * (-2058.420) (-2054.919) (-2054.568) [-2061.190] -- 0:01:48
Average standard deviation of split frequencies: 0.009208
685500 -- [-2053.474] (-2059.547) (-2055.305) (-2058.616) * (-2061.676) [-2060.803] (-2054.386) (-2056.406) -- 0:01:48
686000 -- (-2056.809) (-2053.831) [-2053.482] (-2059.878) * (-2057.488) [-2050.923] (-2058.491) (-2060.704) -- 0:01:48
686500 -- (-2056.381) [-2053.659] (-2056.310) (-2059.310) * (-2054.009) (-2051.193) [-2058.694] (-2062.602) -- 0:01:47
687000 -- (-2060.557) (-2054.813) (-2059.842) [-2058.369] * (-2056.064) [-2048.572] (-2058.178) (-2052.083) -- 0:01:47
687500 -- (-2053.587) (-2055.645) (-2063.769) [-2057.799] * [-2057.252] (-2057.909) (-2055.084) (-2056.666) -- 0:01:47
688000 -- (-2052.644) (-2057.430) (-2058.055) [-2058.902] * (-2061.919) (-2056.159) (-2054.990) [-2050.764] -- 0:01:47
688500 -- (-2056.549) [-2051.935] (-2059.978) (-2062.665) * (-2054.844) [-2052.997] (-2057.318) (-2051.479) -- 0:01:47
689000 -- [-2061.451] (-2059.239) (-2058.340) (-2058.546) * (-2058.612) (-2062.698) (-2055.794) [-2054.755] -- 0:01:46
689500 -- (-2059.249) [-2057.157] (-2055.851) (-2056.752) * (-2072.305) (-2054.004) (-2053.305) [-2053.241] -- 0:01:46
690000 -- [-2055.968] (-2056.427) (-2054.902) (-2054.783) * (-2060.612) (-2055.072) (-2060.102) [-2053.755] -- 0:01:46
Average standard deviation of split frequencies: 0.008600
690500 -- (-2051.237) [-2054.093] (-2055.165) (-2051.931) * [-2071.240] (-2057.756) (-2053.888) (-2053.839) -- 0:01:46
691000 -- (-2062.257) (-2065.161) (-2055.637) [-2053.562] * (-2057.262) (-2061.630) (-2055.873) [-2052.675] -- 0:01:46
691500 -- (-2055.717) (-2061.236) [-2058.028] (-2056.488) * (-2068.187) [-2054.779] (-2058.613) (-2056.110) -- 0:01:46
692000 -- [-2052.663] (-2062.253) (-2055.239) (-2053.686) * [-2055.796] (-2058.936) (-2060.396) (-2057.943) -- 0:01:45
692500 -- (-2052.407) (-2056.748) [-2058.806] (-2053.736) * (-2055.778) (-2055.388) (-2058.776) [-2059.359] -- 0:01:45
693000 -- (-2060.200) (-2064.375) [-2053.314] (-2053.063) * (-2061.065) (-2057.683) (-2059.211) [-2055.927] -- 0:01:45
693500 -- (-2060.871) (-2062.733) [-2049.305] (-2053.928) * [-2053.671] (-2059.672) (-2055.607) (-2065.296) -- 0:01:45
694000 -- (-2055.713) [-2055.088] (-2055.080) (-2058.998) * (-2049.579) (-2055.972) (-2061.449) [-2057.238] -- 0:01:45
694500 -- (-2065.728) (-2059.327) (-2054.244) [-2061.214] * [-2050.679] (-2060.252) (-2053.940) (-2061.721) -- 0:01:45
695000 -- [-2054.882] (-2057.611) (-2055.285) (-2050.872) * (-2053.224) (-2064.071) [-2056.685] (-2062.270) -- 0:01:44
Average standard deviation of split frequencies: 0.007586
695500 -- (-2054.430) (-2065.089) [-2051.231] (-2053.851) * (-2061.667) (-2060.515) [-2052.647] (-2060.972) -- 0:01:44
696000 -- (-2054.900) (-2055.165) (-2068.080) [-2051.456] * (-2057.771) (-2056.700) [-2057.391] (-2065.346) -- 0:01:44
696500 -- [-2051.988] (-2053.112) (-2055.669) (-2063.441) * (-2053.334) [-2051.038] (-2054.079) (-2065.365) -- 0:01:44
697000 -- (-2054.866) (-2049.834) (-2050.752) [-2053.786] * (-2056.301) (-2055.263) [-2056.698] (-2055.702) -- 0:01:44
697500 -- (-2072.891) (-2058.698) (-2059.856) [-2053.435] * [-2057.418] (-2065.318) (-2061.137) (-2063.787) -- 0:01:44
698000 -- (-2067.049) (-2053.995) (-2059.021) [-2061.676] * [-2058.150] (-2063.175) (-2057.084) (-2065.982) -- 0:01:43
698500 -- (-2059.854) [-2055.932] (-2057.154) (-2060.730) * (-2058.251) (-2060.942) (-2055.699) [-2051.944] -- 0:01:43
699000 -- [-2056.759] (-2051.231) (-2059.638) (-2054.190) * [-2056.701] (-2061.646) (-2054.465) (-2057.620) -- 0:01:43
699500 -- (-2057.447) (-2055.890) (-2059.257) [-2057.289] * [-2056.323] (-2050.899) (-2063.466) (-2054.635) -- 0:01:43
700000 -- [-2054.881] (-2054.638) (-2054.307) (-2055.565) * (-2060.588) (-2051.511) [-2060.722] (-2055.308) -- 0:01:43
Average standard deviation of split frequencies: 0.009015
700500 -- (-2058.062) (-2059.594) [-2063.772] (-2052.764) * (-2052.979) (-2062.111) [-2060.410] (-2056.908) -- 0:01:43
701000 -- [-2058.775] (-2053.529) (-2051.625) (-2050.753) * [-2051.637] (-2067.433) (-2063.066) (-2063.177) -- 0:01:42
701500 -- (-2055.192) [-2053.056] (-2057.047) (-2060.667) * (-2056.102) [-2057.287] (-2062.723) (-2065.340) -- 0:01:42
702000 -- [-2059.481] (-2060.190) (-2062.764) (-2057.858) * (-2059.437) (-2061.638) [-2058.420] (-2056.781) -- 0:01:42
702500 -- [-2051.310] (-2063.702) (-2057.542) (-2055.416) * (-2058.205) [-2056.878] (-2052.588) (-2061.140) -- 0:01:42
703000 -- [-2049.953] (-2060.698) (-2056.604) (-2059.954) * (-2056.825) [-2050.912] (-2056.717) (-2056.423) -- 0:01:42
703500 -- [-2052.925] (-2056.296) (-2056.227) (-2063.810) * (-2058.225) (-2056.055) [-2056.367] (-2056.705) -- 0:01:41
704000 -- (-2055.512) (-2057.714) (-2058.935) [-2052.880] * (-2055.802) (-2053.104) [-2053.886] (-2057.382) -- 0:01:41
704500 -- (-2059.303) [-2051.274] (-2055.005) (-2058.902) * (-2055.106) (-2058.177) [-2056.432] (-2058.389) -- 0:01:41
705000 -- (-2058.683) [-2055.055] (-2058.792) (-2051.795) * [-2053.797] (-2054.335) (-2053.222) (-2063.680) -- 0:01:41
Average standard deviation of split frequencies: 0.008146
705500 -- (-2056.049) (-2057.647) [-2055.853] (-2057.652) * [-2051.853] (-2060.580) (-2052.731) (-2063.663) -- 0:01:41
706000 -- (-2059.947) (-2061.749) (-2057.326) [-2057.023] * (-2070.623) (-2055.567) (-2055.348) [-2053.766] -- 0:01:41
706500 -- (-2057.046) (-2056.591) [-2054.195] (-2055.088) * (-2058.637) (-2056.161) (-2055.269) [-2054.822] -- 0:01:40
707000 -- (-2060.297) [-2051.570] (-2055.981) (-2057.594) * (-2059.903) (-2051.224) (-2051.648) [-2057.526] -- 0:01:40
707500 -- (-2058.184) (-2055.372) (-2056.878) [-2051.795] * [-2058.991] (-2056.579) (-2058.904) (-2058.186) -- 0:01:40
708000 -- [-2053.645] (-2068.072) (-2055.348) (-2058.434) * (-2055.795) (-2057.873) (-2059.407) [-2057.540] -- 0:01:40
708500 -- (-2055.877) (-2060.230) (-2056.964) [-2056.563] * [-2052.189] (-2059.497) (-2056.953) (-2068.424) -- 0:01:40
709000 -- (-2060.113) (-2053.944) [-2051.731] (-2074.432) * (-2052.385) (-2057.052) (-2052.145) [-2060.230] -- 0:01:40
709500 -- (-2062.975) (-2051.898) (-2052.377) [-2056.710] * (-2063.214) [-2056.188] (-2053.564) (-2060.017) -- 0:01:39
710000 -- (-2069.015) (-2062.196) [-2050.941] (-2065.633) * [-2058.453] (-2053.076) (-2055.666) (-2052.379) -- 0:01:39
Average standard deviation of split frequencies: 0.007960
710500 -- (-2063.215) [-2055.788] (-2054.860) (-2060.129) * (-2064.572) (-2056.566) [-2051.592] (-2056.850) -- 0:01:39
711000 -- [-2068.861] (-2053.536) (-2060.482) (-2055.912) * (-2055.361) (-2055.648) [-2049.875] (-2071.324) -- 0:01:39
711500 -- (-2059.873) [-2059.087] (-2056.255) (-2064.092) * [-2054.290] (-2052.668) (-2056.094) (-2061.736) -- 0:01:39
712000 -- (-2057.459) [-2050.487] (-2061.807) (-2063.869) * (-2057.615) (-2049.251) (-2061.774) [-2053.654] -- 0:01:39
712500 -- (-2052.656) (-2057.729) (-2061.258) [-2064.029] * (-2057.645) [-2055.244] (-2058.383) (-2061.809) -- 0:01:38
713000 -- (-2056.923) (-2061.680) (-2060.139) [-2050.136] * (-2058.589) [-2053.455] (-2051.126) (-2062.987) -- 0:01:38
713500 -- [-2055.557] (-2049.174) (-2056.210) (-2057.564) * (-2057.000) [-2061.058] (-2061.266) (-2063.812) -- 0:01:38
714000 -- (-2067.609) [-2061.296] (-2054.015) (-2063.879) * (-2060.091) [-2060.128] (-2059.908) (-2057.838) -- 0:01:38
714500 -- (-2063.503) (-2058.879) (-2058.100) [-2058.816] * (-2063.477) (-2053.002) [-2052.586] (-2055.301) -- 0:01:38
715000 -- (-2060.251) [-2052.189] (-2057.121) (-2060.025) * (-2055.705) [-2054.429] (-2060.763) (-2059.972) -- 0:01:38
Average standard deviation of split frequencies: 0.007242
715500 -- (-2051.210) [-2057.563] (-2058.154) (-2059.253) * (-2064.296) (-2054.778) [-2058.177] (-2060.030) -- 0:01:37
716000 -- [-2055.779] (-2063.195) (-2058.551) (-2058.926) * [-2055.978] (-2055.239) (-2057.886) (-2054.806) -- 0:01:37
716500 -- (-2060.583) (-2062.036) (-2055.675) [-2055.208] * [-2053.531] (-2057.185) (-2057.670) (-2062.959) -- 0:01:37
717000 -- [-2055.758] (-2062.393) (-2051.525) (-2058.025) * (-2058.802) [-2059.218] (-2062.811) (-2048.871) -- 0:01:37
717500 -- [-2057.904] (-2064.777) (-2054.189) (-2056.827) * [-2053.242] (-2055.706) (-2059.154) (-2059.633) -- 0:01:37
718000 -- (-2054.196) (-2059.681) (-2063.871) [-2057.633] * [-2064.387] (-2061.611) (-2065.220) (-2060.717) -- 0:01:37
718500 -- (-2053.456) [-2065.324] (-2059.321) (-2057.358) * (-2055.890) [-2052.858] (-2063.423) (-2052.400) -- 0:01:36
719000 -- (-2058.841) (-2055.992) [-2058.871] (-2056.806) * (-2054.227) (-2058.930) (-2057.225) [-2051.355] -- 0:01:36
719500 -- (-2055.484) (-2070.004) [-2057.949] (-2054.062) * (-2058.521) [-2055.265] (-2054.607) (-2055.291) -- 0:01:36
720000 -- [-2054.181] (-2056.678) (-2056.245) (-2052.954) * (-2061.362) (-2058.922) [-2059.713] (-2056.872) -- 0:01:36
Average standard deviation of split frequencies: 0.006541
720500 -- (-2055.791) (-2055.753) (-2066.970) [-2053.832] * [-2052.745] (-2060.861) (-2056.275) (-2055.391) -- 0:01:36
721000 -- (-2055.450) [-2054.245] (-2053.913) (-2052.219) * [-2056.902] (-2059.726) (-2053.827) (-2055.483) -- 0:01:35
721500 -- (-2062.307) [-2055.333] (-2057.081) (-2056.035) * (-2066.013) (-2061.569) (-2065.672) [-2066.441] -- 0:01:35
722000 -- (-2051.939) (-2049.017) (-2057.287) [-2057.513] * (-2057.117) (-2063.564) [-2058.470] (-2058.843) -- 0:01:35
722500 -- (-2053.562) (-2059.050) [-2056.034] (-2058.766) * (-2056.952) (-2055.057) [-2053.976] (-2058.565) -- 0:01:35
723000 -- (-2057.082) [-2054.648] (-2058.512) (-2059.905) * (-2052.998) (-2054.542) (-2068.214) [-2055.492] -- 0:01:35
723500 -- [-2060.619] (-2061.449) (-2064.303) (-2064.495) * (-2061.294) [-2054.806] (-2065.122) (-2057.235) -- 0:01:35
724000 -- (-2058.738) [-2054.747] (-2055.425) (-2065.803) * (-2060.964) [-2050.488] (-2056.006) (-2062.236) -- 0:01:34
724500 -- (-2054.980) [-2057.432] (-2055.188) (-2060.206) * (-2059.401) (-2055.470) (-2053.803) [-2056.278] -- 0:01:34
725000 -- (-2058.328) (-2062.825) [-2051.752] (-2053.584) * (-2060.723) (-2055.029) [-2057.828] (-2053.529) -- 0:01:34
Average standard deviation of split frequencies: 0.006363
725500 -- (-2055.534) (-2055.582) (-2057.592) [-2050.452] * (-2063.067) (-2056.791) [-2055.954] (-2053.171) -- 0:01:34
726000 -- (-2056.356) (-2057.433) (-2055.091) [-2050.050] * [-2056.811] (-2066.815) (-2060.702) (-2057.755) -- 0:01:34
726500 -- [-2059.523] (-2054.330) (-2064.926) (-2061.565) * (-2061.398) (-2056.149) (-2050.965) [-2056.020] -- 0:01:34
727000 -- (-2065.415) (-2050.974) (-2055.486) [-2055.561] * (-2065.549) [-2054.588] (-2057.364) (-2060.056) -- 0:01:33
727500 -- (-2068.060) (-2055.553) [-2056.480] (-2056.098) * (-2058.071) [-2060.805] (-2062.832) (-2052.373) -- 0:01:33
728000 -- (-2050.161) [-2057.886] (-2057.969) (-2050.297) * (-2059.105) [-2052.761] (-2055.035) (-2051.491) -- 0:01:33
728500 -- [-2052.234] (-2057.957) (-2058.952) (-2057.689) * (-2058.306) [-2061.242] (-2055.414) (-2056.552) -- 0:01:33
729000 -- (-2058.917) (-2057.774) [-2051.348] (-2059.636) * (-2057.817) [-2054.993] (-2053.935) (-2061.089) -- 0:01:33
729500 -- (-2053.824) (-2060.647) [-2055.537] (-2051.313) * (-2060.349) (-2060.382) [-2055.467] (-2057.464) -- 0:01:33
730000 -- [-2053.233] (-2055.110) (-2059.662) (-2054.034) * (-2062.911) [-2052.139] (-2053.502) (-2061.739) -- 0:01:32
Average standard deviation of split frequencies: 0.006323
730500 -- (-2053.688) [-2051.687] (-2058.288) (-2055.599) * [-2061.005] (-2055.366) (-2062.769) (-2057.352) -- 0:01:32
731000 -- (-2052.498) (-2059.231) (-2054.434) [-2055.396] * (-2060.958) [-2061.189] (-2058.667) (-2054.394) -- 0:01:32
731500 -- (-2054.241) (-2059.189) (-2057.872) [-2057.487] * (-2057.228) [-2052.816] (-2066.784) (-2059.099) -- 0:01:32
732000 -- (-2060.722) (-2057.113) [-2058.763] (-2054.577) * (-2061.749) (-2061.596) (-2052.490) [-2052.904] -- 0:01:32
732500 -- (-2054.971) [-2060.309] (-2052.303) (-2053.162) * (-2056.559) (-2063.015) (-2057.927) [-2052.148] -- 0:01:32
733000 -- (-2056.153) (-2063.155) (-2060.375) [-2053.793] * (-2068.378) (-2061.416) [-2056.264] (-2056.827) -- 0:01:31
733500 -- (-2056.308) (-2060.566) (-2055.555) [-2063.987] * (-2062.778) (-2063.697) (-2059.552) [-2054.645] -- 0:01:31
734000 -- (-2060.716) (-2058.167) [-2053.252] (-2054.023) * [-2055.319] (-2059.763) (-2063.440) (-2061.152) -- 0:01:31
734500 -- [-2060.019] (-2060.308) (-2053.463) (-2056.431) * (-2054.476) (-2054.717) [-2054.057] (-2067.864) -- 0:01:31
735000 -- (-2059.717) [-2053.486] (-2054.296) (-2051.338) * (-2059.433) (-2061.988) [-2059.075] (-2053.975) -- 0:01:31
Average standard deviation of split frequencies: 0.005893
735500 -- (-2061.559) (-2056.909) [-2054.707] (-2049.403) * [-2060.264] (-2060.117) (-2059.181) (-2056.882) -- 0:01:30
736000 -- [-2052.660] (-2052.133) (-2056.934) (-2057.459) * (-2053.527) [-2054.251] (-2062.348) (-2056.095) -- 0:01:30
736500 -- (-2057.998) (-2049.026) [-2054.300] (-2052.208) * (-2061.720) (-2052.883) (-2059.094) [-2057.874] -- 0:01:30
737000 -- (-2059.932) (-2056.208) (-2053.142) [-2053.563] * (-2061.368) (-2055.398) (-2054.050) [-2052.149] -- 0:01:30
737500 -- [-2056.146] (-2063.857) (-2052.214) (-2057.884) * (-2054.746) [-2055.111] (-2056.235) (-2053.398) -- 0:01:30
738000 -- [-2060.300] (-2054.297) (-2056.500) (-2054.191) * (-2056.578) (-2055.343) [-2055.979] (-2060.575) -- 0:01:30
738500 -- (-2053.241) (-2061.075) (-2059.792) [-2057.859] * [-2063.209] (-2061.158) (-2058.176) (-2062.732) -- 0:01:29
739000 -- [-2052.199] (-2066.103) (-2061.198) (-2053.179) * (-2060.848) (-2058.775) (-2054.263) [-2055.829] -- 0:01:29
739500 -- [-2048.184] (-2065.098) (-2056.821) (-2053.121) * (-2053.408) (-2054.630) [-2054.335] (-2059.513) -- 0:01:29
740000 -- (-2050.937) (-2055.006) (-2055.949) [-2053.409] * (-2052.617) (-2053.704) [-2052.552] (-2055.362) -- 0:01:29
Average standard deviation of split frequencies: 0.005983
740500 -- (-2054.137) [-2049.834] (-2059.278) (-2058.211) * (-2053.287) (-2057.168) [-2053.080] (-2054.890) -- 0:01:29
741000 -- (-2057.231) (-2050.907) (-2052.508) [-2054.824] * (-2059.791) (-2053.994) [-2054.382] (-2056.423) -- 0:01:29
741500 -- (-2053.644) [-2053.325] (-2052.511) (-2057.839) * (-2057.899) (-2057.111) [-2053.064] (-2052.568) -- 0:01:28
742000 -- (-2062.017) (-2055.257) (-2053.904) [-2055.520] * (-2058.983) [-2056.187] (-2053.603) (-2056.210) -- 0:01:28
742500 -- (-2063.896) (-2054.467) [-2052.738] (-2071.278) * (-2063.869) [-2052.332] (-2059.324) (-2053.257) -- 0:01:28
743000 -- (-2056.190) (-2061.472) [-2056.259] (-2064.923) * [-2051.606] (-2057.617) (-2057.355) (-2060.588) -- 0:01:28
743500 -- (-2059.595) [-2065.606] (-2059.784) (-2060.478) * (-2051.509) (-2056.405) [-2054.619] (-2053.278) -- 0:01:28
744000 -- (-2057.306) [-2050.586] (-2057.407) (-2060.850) * (-2057.214) [-2054.503] (-2054.446) (-2058.616) -- 0:01:28
744500 -- (-2054.825) [-2058.925] (-2055.626) (-2057.441) * (-2054.705) (-2059.584) [-2064.414] (-2056.970) -- 0:01:27
745000 -- (-2058.228) (-2060.767) [-2049.823] (-2048.887) * (-2058.244) [-2058.319] (-2055.370) (-2065.018) -- 0:01:27
Average standard deviation of split frequencies: 0.005434
745500 -- (-2068.514) (-2056.435) [-2053.147] (-2052.683) * (-2065.156) (-2056.667) [-2062.549] (-2069.729) -- 0:01:27
746000 -- (-2063.893) [-2056.259] (-2058.605) (-2050.824) * (-2063.559) (-2056.814) [-2055.969] (-2067.107) -- 0:01:27
746500 -- [-2054.774] (-2056.590) (-2052.309) (-2049.234) * (-2057.855) (-2060.341) (-2059.063) [-2053.996] -- 0:01:27
747000 -- (-2060.210) (-2057.067) (-2049.806) [-2051.874] * (-2057.130) (-2052.304) (-2055.572) [-2053.274] -- 0:01:27
747500 -- (-2060.097) (-2054.984) [-2054.247] (-2048.659) * (-2057.744) (-2053.428) [-2050.984] (-2059.017) -- 0:01:26
748000 -- [-2057.835] (-2055.888) (-2050.657) (-2057.380) * [-2055.938] (-2055.345) (-2059.744) (-2058.835) -- 0:01:26
748500 -- (-2054.994) (-2052.138) (-2053.180) [-2059.344] * (-2066.620) (-2056.515) [-2054.062] (-2060.775) -- 0:01:26
749000 -- [-2052.868] (-2056.588) (-2061.079) (-2057.311) * (-2062.757) [-2059.694] (-2053.770) (-2051.478) -- 0:01:26
749500 -- (-2057.538) [-2062.635] (-2056.499) (-2055.702) * [-2052.613] (-2056.378) (-2055.668) (-2054.123) -- 0:01:26
750000 -- [-2054.657] (-2063.873) (-2057.899) (-2053.768) * (-2051.849) (-2061.874) [-2058.044] (-2067.529) -- 0:01:26
Average standard deviation of split frequencies: 0.005903
750500 -- (-2053.560) (-2057.762) [-2054.292] (-2067.910) * (-2061.051) (-2060.601) (-2053.981) [-2053.887] -- 0:01:25
751000 -- (-2054.857) (-2057.119) [-2058.629] (-2059.520) * [-2054.037] (-2054.556) (-2052.080) (-2056.695) -- 0:01:25
751500 -- (-2057.513) [-2058.622] (-2057.125) (-2068.200) * [-2058.704] (-2055.454) (-2055.417) (-2058.415) -- 0:01:25
752000 -- (-2052.623) (-2055.197) [-2054.195] (-2060.377) * (-2061.348) (-2059.966) (-2050.979) [-2057.896] -- 0:01:25
752500 -- (-2058.151) (-2056.192) [-2058.930] (-2057.552) * (-2058.209) (-2059.224) (-2060.394) [-2059.987] -- 0:01:25
753000 -- (-2062.961) (-2061.219) [-2061.486] (-2062.246) * (-2060.288) [-2053.937] (-2057.283) (-2060.608) -- 0:01:24
753500 -- (-2060.261) (-2060.216) (-2065.754) [-2057.936] * (-2061.391) (-2054.532) (-2058.745) [-2055.074] -- 0:01:24
754000 -- (-2051.681) (-2055.973) (-2051.065) [-2055.653] * (-2060.337) (-2057.050) [-2056.536] (-2060.446) -- 0:01:24
754500 -- [-2056.524] (-2060.641) (-2062.075) (-2060.139) * [-2054.976] (-2053.834) (-2062.733) (-2059.436) -- 0:01:24
755000 -- [-2059.463] (-2056.390) (-2054.547) (-2060.813) * (-2056.158) [-2051.173] (-2056.402) (-2051.293) -- 0:01:24
Average standard deviation of split frequencies: 0.006236
755500 -- (-2050.986) (-2056.655) [-2059.293] (-2052.748) * (-2056.784) (-2061.936) [-2050.397] (-2054.854) -- 0:01:24
756000 -- (-2053.199) (-2056.485) [-2051.504] (-2054.465) * (-2060.932) (-2060.965) (-2052.153) [-2057.807] -- 0:01:23
756500 -- (-2056.339) (-2055.256) [-2051.099] (-2052.324) * [-2059.358] (-2055.655) (-2052.236) (-2059.949) -- 0:01:23
757000 -- (-2052.315) [-2055.184] (-2051.891) (-2052.108) * (-2051.077) [-2057.922] (-2056.318) (-2053.305) -- 0:01:23
757500 -- (-2051.613) (-2055.364) [-2050.525] (-2061.689) * (-2053.173) (-2060.248) [-2048.596] (-2062.810) -- 0:01:23
758000 -- (-2057.512) (-2055.828) [-2051.786] (-2063.076) * (-2054.304) (-2063.627) (-2056.496) [-2060.597] -- 0:01:23
758500 -- [-2051.241] (-2060.217) (-2060.983) (-2062.945) * [-2056.419] (-2052.444) (-2060.880) (-2057.827) -- 0:01:23
759000 -- (-2057.580) (-2055.607) [-2053.494] (-2056.964) * [-2055.622] (-2059.108) (-2053.057) (-2067.728) -- 0:01:22
759500 -- (-2065.755) (-2057.438) [-2054.658] (-2060.492) * (-2049.037) [-2057.477] (-2060.986) (-2060.070) -- 0:01:22
760000 -- [-2049.335] (-2057.457) (-2054.607) (-2063.194) * (-2057.945) (-2059.260) [-2056.063] (-2057.014) -- 0:01:22
Average standard deviation of split frequencies: 0.005701
760500 -- (-2056.566) (-2066.882) (-2057.709) [-2061.215] * (-2060.587) [-2055.466] (-2058.431) (-2052.622) -- 0:01:22
761000 -- (-2058.185) [-2056.654] (-2062.008) (-2052.741) * (-2053.725) (-2058.379) (-2057.957) [-2056.355] -- 0:01:22
761500 -- [-2054.010] (-2055.155) (-2057.193) (-2062.478) * (-2056.189) [-2053.187] (-2059.006) (-2051.137) -- 0:01:22
762000 -- (-2068.493) [-2058.294] (-2060.370) (-2061.466) * [-2057.367] (-2060.636) (-2056.311) (-2052.433) -- 0:01:21
762500 -- (-2059.268) [-2057.452] (-2060.457) (-2060.701) * (-2056.704) (-2058.796) [-2059.614] (-2062.589) -- 0:01:21
763000 -- (-2055.934) (-2060.518) (-2059.172) [-2053.683] * (-2058.726) [-2058.583] (-2057.272) (-2067.242) -- 0:01:21
763500 -- (-2051.819) [-2061.872] (-2055.388) (-2059.931) * (-2055.118) [-2052.910] (-2059.717) (-2056.435) -- 0:01:21
764000 -- [-2051.105] (-2060.482) (-2068.342) (-2052.483) * [-2050.427] (-2053.325) (-2059.775) (-2059.015) -- 0:01:21
764500 -- (-2062.789) (-2058.856) (-2053.848) [-2055.811] * (-2059.835) [-2060.155] (-2063.714) (-2051.037) -- 0:01:21
765000 -- [-2054.302] (-2055.599) (-2055.704) (-2057.437) * (-2057.013) [-2059.419] (-2062.797) (-2054.889) -- 0:01:20
Average standard deviation of split frequencies: 0.005539
765500 -- [-2053.982] (-2054.872) (-2061.828) (-2063.724) * [-2055.741] (-2055.969) (-2050.378) (-2058.017) -- 0:01:20
766000 -- [-2056.284] (-2055.984) (-2060.832) (-2056.895) * (-2061.055) (-2056.318) (-2052.710) [-2053.854] -- 0:01:20
766500 -- [-2056.588] (-2051.610) (-2060.611) (-2056.081) * [-2056.694] (-2062.313) (-2056.155) (-2055.298) -- 0:01:20
767000 -- [-2058.770] (-2060.288) (-2062.864) (-2053.794) * (-2059.358) (-2053.631) [-2051.657] (-2058.339) -- 0:01:20
767500 -- [-2051.474] (-2058.049) (-2058.920) (-2053.834) * (-2058.613) [-2058.455] (-2058.322) (-2063.175) -- 0:01:19
768000 -- (-2054.413) (-2063.556) (-2065.783) [-2056.593] * (-2055.955) (-2051.194) (-2057.242) [-2057.809] -- 0:01:19
768500 -- (-2059.810) (-2066.435) [-2052.998] (-2060.909) * [-2057.617] (-2059.035) (-2051.809) (-2054.561) -- 0:01:19
769000 -- (-2062.885) (-2055.017) (-2063.205) [-2049.974] * [-2055.137] (-2058.383) (-2061.182) (-2054.861) -- 0:01:19
769500 -- (-2064.804) (-2057.108) [-2056.899] (-2051.467) * (-2057.686) [-2052.211] (-2058.474) (-2052.263) -- 0:01:19
770000 -- [-2055.763] (-2055.219) (-2052.573) (-2053.285) * (-2051.785) [-2055.104] (-2058.865) (-2052.738) -- 0:01:19
Average standard deviation of split frequencies: 0.005750
770500 -- (-2057.640) (-2057.110) [-2052.618] (-2057.544) * [-2053.274] (-2058.305) (-2057.625) (-2054.294) -- 0:01:18
771000 -- (-2053.653) (-2064.931) [-2051.380] (-2055.206) * [-2052.560] (-2058.078) (-2060.823) (-2060.746) -- 0:01:18
771500 -- (-2049.816) (-2059.807) [-2056.087] (-2059.285) * (-2049.589) (-2058.696) (-2057.582) [-2055.013] -- 0:01:18
772000 -- [-2056.654] (-2052.288) (-2059.555) (-2058.008) * (-2061.331) (-2062.910) (-2057.763) [-2051.745] -- 0:01:18
772500 -- [-2065.672] (-2054.374) (-2057.305) (-2055.338) * (-2059.495) [-2061.680] (-2066.490) (-2056.037) -- 0:01:18
773000 -- [-2057.348] (-2060.315) (-2051.949) (-2059.387) * (-2059.293) (-2059.090) [-2058.121] (-2057.602) -- 0:01:18
773500 -- (-2067.686) (-2058.254) (-2055.256) [-2057.888] * (-2053.939) (-2054.654) (-2051.955) [-2056.661] -- 0:01:17
774000 -- (-2060.833) (-2056.302) [-2057.759] (-2059.449) * (-2070.262) (-2058.915) (-2064.661) [-2050.677] -- 0:01:17
774500 -- [-2054.446] (-2053.306) (-2057.718) (-2062.789) * (-2057.322) (-2053.738) [-2048.065] (-2058.611) -- 0:01:17
775000 -- (-2049.232) [-2051.018] (-2060.280) (-2054.292) * (-2066.383) (-2059.762) (-2050.033) [-2055.442] -- 0:01:17
Average standard deviation of split frequencies: 0.006075
775500 -- [-2048.119] (-2060.544) (-2056.211) (-2055.013) * [-2058.443] (-2062.647) (-2062.543) (-2061.380) -- 0:01:17
776000 -- [-2050.401] (-2054.386) (-2059.579) (-2059.744) * (-2060.029) (-2056.057) (-2057.114) [-2055.265] -- 0:01:17
776500 -- (-2055.272) (-2061.934) (-2064.193) [-2055.156] * (-2059.517) [-2055.031] (-2054.487) (-2050.450) -- 0:01:16
777000 -- (-2054.460) (-2057.989) [-2060.899] (-2057.908) * (-2062.317) (-2053.978) (-2052.310) [-2053.719] -- 0:01:16
777500 -- (-2053.769) [-2058.404] (-2059.353) (-2061.065) * (-2068.018) (-2062.398) [-2051.735] (-2053.182) -- 0:01:16
778000 -- (-2060.413) (-2057.294) [-2058.745] (-2062.319) * (-2056.919) (-2060.694) [-2051.299] (-2053.565) -- 0:01:16
778500 -- (-2066.563) (-2058.896) [-2054.742] (-2065.914) * [-2056.712] (-2056.288) (-2052.500) (-2062.396) -- 0:01:16
779000 -- (-2061.788) (-2054.653) (-2062.334) [-2055.070] * (-2063.871) (-2056.409) (-2059.866) [-2056.680] -- 0:01:16
779500 -- [-2054.166] (-2053.792) (-2059.700) (-2054.999) * (-2061.675) (-2053.143) [-2059.005] (-2056.530) -- 0:01:15
780000 -- (-2060.305) (-2052.865) (-2056.027) [-2052.597] * (-2061.432) (-2055.926) [-2049.870] (-2055.541) -- 0:01:15
Average standard deviation of split frequencies: 0.005193
780500 -- (-2057.415) (-2056.163) [-2049.985] (-2052.684) * (-2051.584) [-2052.294] (-2051.642) (-2060.931) -- 0:01:15
781000 -- (-2054.985) [-2050.405] (-2055.179) (-2058.787) * (-2061.086) [-2054.346] (-2050.673) (-2062.329) -- 0:01:15
781500 -- [-2052.321] (-2055.787) (-2056.683) (-2056.107) * (-2054.491) (-2056.553) [-2057.693] (-2057.865) -- 0:01:15
782000 -- [-2054.859] (-2057.304) (-2052.563) (-2057.207) * (-2055.527) (-2064.207) (-2058.829) [-2054.272] -- 0:01:14
782500 -- (-2057.517) [-2055.026] (-2058.178) (-2053.167) * (-2052.481) [-2058.930] (-2059.221) (-2062.923) -- 0:01:14
783000 -- (-2056.361) [-2054.255] (-2057.466) (-2064.335) * [-2058.548] (-2054.279) (-2057.308) (-2061.452) -- 0:01:14
783500 -- [-2049.098] (-2057.579) (-2057.806) (-2051.947) * (-2057.976) [-2052.736] (-2058.279) (-2057.695) -- 0:01:14
784000 -- (-2061.153) (-2058.962) (-2054.928) [-2053.699] * [-2064.851] (-2054.117) (-2057.096) (-2068.994) -- 0:01:14
784500 -- (-2062.704) [-2058.678] (-2055.899) (-2057.072) * (-2067.235) [-2054.385] (-2053.727) (-2066.295) -- 0:01:14
785000 -- (-2055.196) (-2057.210) (-2056.656) [-2052.314] * (-2068.366) (-2054.954) [-2056.880] (-2068.241) -- 0:01:13
Average standard deviation of split frequencies: 0.005998
785500 -- (-2057.062) (-2059.564) (-2059.303) [-2055.720] * (-2063.192) [-2053.345] (-2065.108) (-2060.629) -- 0:01:13
786000 -- (-2054.354) (-2067.749) [-2057.274] (-2050.824) * (-2062.376) (-2063.610) [-2060.339] (-2057.161) -- 0:01:13
786500 -- (-2055.760) [-2061.459] (-2059.639) (-2055.032) * (-2061.796) [-2058.139] (-2055.504) (-2062.366) -- 0:01:13
787000 -- (-2053.884) (-2060.409) (-2057.356) [-2053.470] * (-2058.663) [-2059.406] (-2060.295) (-2058.061) -- 0:01:13
787500 -- (-2048.886) (-2060.061) (-2058.838) [-2056.159] * [-2061.884] (-2056.051) (-2054.468) (-2051.724) -- 0:01:13
788000 -- [-2058.266] (-2060.612) (-2053.087) (-2065.847) * [-2059.793] (-2056.067) (-2053.058) (-2066.564) -- 0:01:12
788500 -- (-2055.916) (-2053.915) (-2052.543) [-2057.572] * (-2055.365) [-2051.251] (-2060.967) (-2053.470) -- 0:01:12
789000 -- (-2067.166) (-2065.874) (-2061.406) [-2057.293] * (-2050.891) [-2053.485] (-2058.001) (-2056.345) -- 0:01:12
789500 -- (-2058.612) [-2054.823] (-2061.543) (-2055.237) * (-2056.522) [-2058.453] (-2059.506) (-2072.959) -- 0:01:12
790000 -- (-2060.836) (-2056.498) (-2057.053) [-2065.188] * (-2049.310) [-2054.599] (-2052.990) (-2060.061) -- 0:01:12
Average standard deviation of split frequencies: 0.005366
790500 -- (-2052.555) [-2052.941] (-2060.260) (-2066.004) * (-2050.426) (-2060.197) (-2058.541) [-2054.046] -- 0:01:12
791000 -- (-2061.365) (-2057.888) (-2057.585) [-2071.346] * (-2055.462) (-2051.211) (-2051.978) [-2049.710] -- 0:01:11
791500 -- (-2059.383) [-2055.859] (-2063.188) (-2062.984) * (-2060.825) [-2055.228] (-2052.308) (-2053.179) -- 0:01:11
792000 -- (-2060.151) (-2055.114) (-2058.976) [-2062.945] * (-2054.810) [-2052.778] (-2053.957) (-2056.894) -- 0:01:11
792500 -- (-2053.368) (-2055.324) [-2054.530] (-2072.512) * (-2056.992) (-2057.108) (-2052.567) [-2061.347] -- 0:01:11
793000 -- (-2054.990) [-2054.402] (-2060.484) (-2064.698) * (-2052.642) (-2053.732) [-2050.783] (-2055.876) -- 0:01:11
793500 -- (-2057.211) (-2066.846) [-2053.752] (-2066.282) * [-2051.198] (-2056.090) (-2056.123) (-2066.150) -- 0:01:11
794000 -- [-2060.334] (-2055.655) (-2053.755) (-2058.995) * (-2057.997) (-2065.686) [-2053.828] (-2060.804) -- 0:01:10
794500 -- (-2053.383) (-2054.599) [-2053.978] (-2060.295) * (-2058.425) (-2064.218) (-2055.711) [-2055.922] -- 0:01:10
795000 -- (-2057.891) (-2057.695) (-2054.875) [-2061.152] * (-2053.658) (-2057.476) [-2053.458] (-2055.054) -- 0:01:10
Average standard deviation of split frequencies: 0.005685
795500 -- (-2058.126) (-2065.209) (-2058.957) [-2066.420] * (-2055.368) [-2057.038] (-2055.096) (-2061.563) -- 0:01:10
796000 -- (-2056.730) (-2056.182) (-2049.930) [-2050.847] * [-2053.806] (-2056.495) (-2053.055) (-2056.408) -- 0:01:10
796500 -- (-2057.959) (-2055.508) [-2056.289] (-2057.423) * [-2053.068] (-2056.263) (-2052.779) (-2062.869) -- 0:01:10
797000 -- (-2056.233) [-2055.234] (-2059.235) (-2059.928) * (-2052.372) (-2057.157) (-2060.804) [-2058.483] -- 0:01:09
797500 -- [-2057.018] (-2053.877) (-2064.110) (-2057.304) * (-2058.558) (-2050.928) [-2053.921] (-2062.543) -- 0:01:09
798000 -- [-2055.081] (-2049.290) (-2065.683) (-2053.098) * [-2052.556] (-2061.403) (-2054.440) (-2057.411) -- 0:01:09
798500 -- (-2053.222) [-2056.182] (-2057.957) (-2057.578) * [-2052.153] (-2050.378) (-2053.541) (-2059.213) -- 0:01:09
799000 -- (-2062.111) (-2057.553) [-2050.682] (-2057.230) * (-2061.014) (-2061.452) (-2058.480) [-2054.357] -- 0:01:09
799500 -- (-2060.421) [-2056.471] (-2056.548) (-2056.217) * (-2053.304) (-2056.196) (-2054.892) [-2051.910] -- 0:01:08
800000 -- [-2056.496] (-2061.445) (-2056.547) (-2067.954) * (-2050.881) [-2055.228] (-2059.284) (-2056.720) -- 0:01:08
Average standard deviation of split frequencies: 0.005770
800500 -- (-2051.046) [-2055.155] (-2051.532) (-2059.966) * [-2062.200] (-2057.346) (-2058.908) (-2061.861) -- 0:01:08
801000 -- [-2054.221] (-2059.147) (-2056.024) (-2055.392) * (-2063.569) (-2057.999) [-2059.892] (-2051.977) -- 0:01:08
801500 -- (-2058.685) (-2059.586) (-2056.839) [-2054.351] * (-2056.514) (-2056.458) [-2065.905] (-2051.865) -- 0:01:08
802000 -- (-2054.695) (-2057.173) [-2059.498] (-2061.573) * (-2055.786) [-2054.652] (-2068.182) (-2057.936) -- 0:01:08
802500 -- (-2056.770) [-2061.910] (-2057.195) (-2054.464) * (-2055.986) (-2058.142) (-2058.416) [-2060.817] -- 0:01:07
803000 -- [-2057.911] (-2061.644) (-2062.405) (-2055.034) * (-2059.347) (-2056.663) (-2062.346) [-2053.680] -- 0:01:07
803500 -- (-2061.195) (-2063.335) (-2059.582) [-2052.632] * [-2051.719] (-2057.045) (-2062.121) (-2051.742) -- 0:01:07
804000 -- (-2057.848) [-2057.608] (-2053.262) (-2055.165) * (-2065.700) [-2054.418] (-2055.729) (-2051.497) -- 0:01:07
804500 -- (-2056.260) (-2065.166) [-2053.908] (-2058.028) * (-2054.632) [-2056.082] (-2057.173) (-2053.593) -- 0:01:07
805000 -- (-2056.478) (-2057.940) [-2054.631] (-2069.365) * [-2057.695] (-2059.878) (-2056.952) (-2054.730) -- 0:01:07
Average standard deviation of split frequencies: 0.005732
805500 -- [-2053.960] (-2051.460) (-2059.207) (-2057.287) * (-2055.327) [-2054.536] (-2059.934) (-2058.324) -- 0:01:06
806000 -- (-2060.044) (-2053.587) (-2055.996) [-2054.185] * (-2052.546) (-2056.949) (-2060.885) [-2055.974] -- 0:01:06
806500 -- (-2059.934) [-2054.019] (-2069.721) (-2056.905) * [-2058.443] (-2061.077) (-2059.451) (-2053.622) -- 0:01:06
807000 -- [-2053.967] (-2056.838) (-2059.752) (-2055.985) * [-2061.182] (-2055.294) (-2060.733) (-2053.974) -- 0:01:06
807500 -- (-2067.140) (-2061.334) [-2057.859] (-2058.362) * (-2058.377) (-2053.198) [-2060.054] (-2067.113) -- 0:01:06
808000 -- (-2065.742) (-2057.718) (-2059.633) [-2059.308] * [-2059.614] (-2058.136) (-2053.919) (-2056.928) -- 0:01:06
808500 -- (-2058.429) (-2053.093) [-2057.584] (-2058.330) * (-2058.503) [-2052.699] (-2052.832) (-2052.122) -- 0:01:05
809000 -- [-2052.966] (-2052.434) (-2055.791) (-2053.559) * (-2063.619) [-2056.482] (-2053.208) (-2055.957) -- 0:01:05
809500 -- (-2052.883) (-2057.341) (-2061.693) [-2051.378] * (-2066.536) (-2052.665) (-2064.693) [-2057.226] -- 0:01:05
810000 -- (-2056.752) (-2061.110) (-2058.577) [-2057.769] * (-2066.676) (-2062.526) [-2060.146] (-2057.321) -- 0:01:05
Average standard deviation of split frequencies: 0.005350
810500 -- (-2060.741) (-2057.703) (-2057.893) [-2054.781] * [-2064.737] (-2059.898) (-2059.288) (-2057.625) -- 0:01:05
811000 -- (-2059.136) (-2064.539) [-2049.582] (-2057.734) * (-2067.804) (-2057.610) (-2055.654) [-2052.163] -- 0:01:05
811500 -- (-2055.754) (-2058.208) [-2056.585] (-2051.812) * (-2057.540) (-2057.337) [-2052.526] (-2056.159) -- 0:01:04
812000 -- [-2055.677] (-2054.266) (-2054.339) (-2052.459) * (-2056.264) (-2055.063) [-2057.748] (-2064.091) -- 0:01:04
812500 -- [-2052.674] (-2057.555) (-2055.389) (-2053.185) * (-2056.692) (-2054.652) [-2054.101] (-2064.508) -- 0:01:04
813000 -- (-2051.380) [-2055.190] (-2053.149) (-2054.332) * (-2060.322) (-2055.175) (-2060.141) [-2057.851] -- 0:01:04
813500 -- (-2059.212) (-2057.587) (-2057.349) [-2058.268] * (-2064.775) [-2054.842] (-2059.880) (-2053.895) -- 0:01:04
814000 -- [-2058.436] (-2063.704) (-2051.731) (-2052.168) * (-2063.322) (-2062.156) [-2058.235] (-2065.521) -- 0:01:03
814500 -- (-2068.597) (-2047.929) (-2056.561) [-2056.039] * [-2053.988] (-2064.417) (-2059.936) (-2055.843) -- 0:01:03
815000 -- (-2057.613) [-2051.180] (-2065.511) (-2064.418) * (-2058.569) [-2062.514] (-2055.874) (-2051.757) -- 0:01:03
Average standard deviation of split frequencies: 0.004737
815500 -- (-2053.169) (-2061.116) (-2062.769) [-2058.523] * (-2054.828) (-2070.529) (-2053.465) [-2059.088] -- 0:01:03
816000 -- (-2056.902) (-2052.481) (-2054.849) [-2052.549] * (-2053.740) (-2057.977) (-2053.275) [-2053.742] -- 0:01:03
816500 -- [-2055.470] (-2057.096) (-2062.787) (-2062.630) * (-2053.013) (-2060.430) (-2060.519) [-2052.647] -- 0:01:03
817000 -- (-2059.126) [-2055.275] (-2061.303) (-2056.583) * [-2055.198] (-2067.870) (-2058.884) (-2057.106) -- 0:01:02
817500 -- (-2064.331) [-2052.040] (-2051.097) (-2054.637) * (-2051.353) (-2061.116) [-2058.570] (-2065.502) -- 0:01:02
818000 -- (-2051.568) [-2050.886] (-2059.226) (-2052.835) * (-2054.594) (-2054.207) [-2061.503] (-2057.745) -- 0:01:02
818500 -- (-2052.741) (-2054.471) [-2062.285] (-2062.290) * (-2064.864) [-2055.349] (-2059.121) (-2060.169) -- 0:01:02
819000 -- (-2054.276) [-2060.146] (-2063.447) (-2050.348) * (-2059.398) (-2057.190) [-2057.026] (-2063.665) -- 0:01:02
819500 -- (-2061.832) [-2059.357] (-2050.936) (-2058.520) * (-2058.343) (-2050.190) (-2056.183) [-2066.881] -- 0:01:02
820000 -- (-2063.748) (-2053.482) (-2053.795) [-2057.182] * (-2056.510) (-2053.729) (-2060.535) [-2054.914] -- 0:01:01
Average standard deviation of split frequencies: 0.005055
820500 -- [-2063.717] (-2053.234) (-2057.289) (-2051.707) * (-2057.570) (-2051.640) [-2055.709] (-2064.889) -- 0:01:01
821000 -- (-2061.994) (-2059.047) [-2058.482] (-2055.123) * (-2063.717) [-2058.184] (-2054.755) (-2051.305) -- 0:01:01
821500 -- (-2051.429) (-2058.924) [-2055.943] (-2061.690) * (-2056.951) (-2065.754) [-2056.045] (-2055.646) -- 0:01:01
822000 -- (-2056.935) (-2057.300) (-2052.963) [-2054.589] * [-2061.022] (-2057.716) (-2057.031) (-2054.381) -- 0:01:01
822500 -- (-2052.276) (-2056.315) [-2053.801] (-2058.366) * (-2054.078) (-2061.157) [-2058.922] (-2059.157) -- 0:01:01
823000 -- (-2055.918) (-2053.399) (-2056.220) [-2058.315] * (-2057.632) (-2063.669) [-2057.907] (-2058.038) -- 0:01:00
823500 -- (-2061.466) (-2051.116) [-2059.103] (-2057.510) * [-2056.234] (-2052.183) (-2056.580) (-2055.670) -- 0:01:00
824000 -- (-2064.244) (-2066.447) (-2056.540) [-2060.926] * (-2057.084) [-2061.138] (-2054.017) (-2055.426) -- 0:01:00
824500 -- (-2063.803) (-2058.451) [-2051.441] (-2063.945) * (-2063.640) (-2060.800) (-2051.760) [-2051.866] -- 0:01:00
825000 -- [-2053.834] (-2058.683) (-2056.663) (-2057.508) * (-2064.165) (-2050.847) [-2051.415] (-2058.017) -- 0:01:00
Average standard deviation of split frequencies: 0.004794
825500 -- (-2052.043) (-2060.439) (-2065.216) [-2051.663] * (-2068.581) (-2054.158) [-2059.872] (-2062.082) -- 0:01:00
826000 -- (-2056.382) [-2057.143] (-2061.590) (-2055.719) * (-2060.464) (-2055.864) (-2063.726) [-2057.087] -- 0:00:59
826500 -- [-2047.394] (-2054.346) (-2057.834) (-2056.924) * (-2060.120) [-2056.021] (-2065.123) (-2057.051) -- 0:00:59
827000 -- [-2059.011] (-2060.608) (-2055.268) (-2059.224) * (-2061.314) [-2055.171] (-2062.790) (-2060.360) -- 0:00:59
827500 -- (-2057.109) [-2053.918] (-2059.086) (-2054.812) * (-2065.433) (-2058.089) (-2061.724) [-2049.890] -- 0:00:59
828000 -- (-2057.135) [-2055.343] (-2057.292) (-2062.239) * (-2060.866) (-2065.005) [-2056.544] (-2061.702) -- 0:00:59
828500 -- (-2056.590) (-2069.635) [-2056.612] (-2058.802) * (-2063.780) [-2054.855] (-2056.061) (-2056.797) -- 0:00:58
829000 -- [-2062.073] (-2062.571) (-2056.953) (-2055.382) * (-2053.351) (-2059.767) (-2050.427) [-2067.526] -- 0:00:58
829500 -- (-2060.660) (-2063.568) (-2048.902) [-2056.160] * (-2054.508) (-2057.526) (-2059.542) [-2060.418] -- 0:00:58
830000 -- (-2052.179) [-2056.903] (-2062.310) (-2056.779) * (-2053.260) (-2048.296) [-2059.952] (-2054.904) -- 0:00:58
Average standard deviation of split frequencies: 0.004994
830500 -- (-2061.946) (-2056.151) (-2057.757) [-2052.327] * [-2058.466] (-2053.512) (-2054.767) (-2061.456) -- 0:00:58
831000 -- (-2052.711) (-2060.071) [-2048.848] (-2056.571) * (-2060.662) (-2056.486) (-2056.743) [-2055.563] -- 0:00:58
831500 -- (-2053.413) [-2052.380] (-2054.713) (-2053.671) * [-2058.076] (-2065.448) (-2061.380) (-2056.847) -- 0:00:57
832000 -- (-2060.100) [-2056.453] (-2058.305) (-2055.470) * (-2058.842) (-2059.229) [-2052.074] (-2058.222) -- 0:00:57
832500 -- (-2055.759) (-2055.251) (-2056.435) [-2054.018] * (-2053.031) (-2057.563) (-2061.156) [-2050.636] -- 0:00:57
833000 -- (-2061.547) (-2057.931) (-2055.623) [-2051.015] * [-2055.064] (-2051.138) (-2060.467) (-2057.240) -- 0:00:57
833500 -- [-2055.364] (-2052.956) (-2055.524) (-2054.535) * (-2060.145) (-2057.851) (-2057.716) [-2051.907] -- 0:00:57
834000 -- (-2060.206) [-2055.332] (-2064.911) (-2065.473) * [-2060.093] (-2062.306) (-2056.637) (-2054.238) -- 0:00:57
834500 -- (-2057.444) (-2065.391) (-2056.102) [-2054.238] * (-2052.287) (-2060.843) [-2052.243] (-2060.997) -- 0:00:56
835000 -- (-2060.128) (-2056.952) (-2068.660) [-2053.741] * (-2057.265) (-2053.210) [-2051.905] (-2060.021) -- 0:00:56
Average standard deviation of split frequencies: 0.005300
835500 -- (-2057.501) (-2054.201) (-2064.075) [-2056.916] * (-2057.281) (-2059.342) [-2058.832] (-2062.148) -- 0:00:56
836000 -- (-2055.602) [-2056.817] (-2057.994) (-2058.714) * (-2058.449) (-2057.307) (-2058.506) [-2051.745] -- 0:00:56
836500 -- (-2053.489) (-2061.529) (-2058.766) [-2055.728] * (-2051.145) (-2059.360) [-2055.371] (-2055.826) -- 0:00:56
837000 -- (-2063.169) (-2059.328) [-2059.770] (-2055.219) * (-2057.990) [-2053.954] (-2053.623) (-2061.645) -- 0:00:56
837500 -- (-2062.203) [-2061.433] (-2058.424) (-2060.656) * [-2056.854] (-2054.515) (-2059.301) (-2057.285) -- 0:00:55
838000 -- [-2053.697] (-2061.072) (-2063.067) (-2064.614) * (-2055.808) (-2050.657) (-2053.500) [-2056.131] -- 0:00:55
838500 -- (-2056.373) (-2052.499) [-2051.866] (-2058.261) * (-2054.709) (-2058.618) (-2053.063) [-2064.621] -- 0:00:55
839000 -- (-2062.900) (-2065.976) [-2056.606] (-2061.121) * (-2051.057) (-2056.926) (-2058.335) [-2062.990] -- 0:00:55
839500 -- [-2057.897] (-2055.491) (-2057.210) (-2057.845) * [-2057.466] (-2055.939) (-2052.609) (-2066.178) -- 0:00:55
840000 -- (-2059.235) [-2052.695] (-2063.262) (-2053.827) * (-2059.625) [-2057.379] (-2057.012) (-2063.760) -- 0:00:55
Average standard deviation of split frequencies: 0.005159
840500 -- (-2057.297) [-2058.856] (-2060.464) (-2054.003) * (-2057.674) (-2067.879) (-2054.125) [-2063.859] -- 0:00:54
841000 -- [-2062.671] (-2054.689) (-2054.295) (-2052.851) * (-2048.666) (-2059.160) [-2050.071] (-2060.409) -- 0:00:54
841500 -- (-2059.676) (-2056.321) (-2056.108) [-2059.215] * [-2052.888] (-2056.743) (-2056.699) (-2061.170) -- 0:00:54
842000 -- (-2065.242) (-2055.551) [-2050.435] (-2052.406) * (-2062.954) [-2055.359] (-2061.365) (-2060.201) -- 0:00:54
842500 -- (-2056.166) [-2051.872] (-2058.737) (-2054.949) * (-2056.435) (-2057.461) (-2062.663) [-2051.518] -- 0:00:54
843000 -- (-2060.661) (-2058.338) [-2055.712] (-2059.749) * [-2052.470] (-2057.542) (-2062.054) (-2053.035) -- 0:00:54
843500 -- [-2056.314] (-2055.163) (-2057.196) (-2062.962) * [-2052.060] (-2056.662) (-2061.248) (-2061.624) -- 0:00:53
844000 -- [-2055.407] (-2054.025) (-2052.536) (-2061.053) * [-2056.241] (-2056.583) (-2054.623) (-2053.147) -- 0:00:53
844500 -- (-2055.438) (-2054.678) [-2057.279] (-2060.576) * (-2050.452) (-2062.528) (-2061.130) [-2052.893] -- 0:00:53
845000 -- (-2066.017) [-2055.753] (-2055.409) (-2057.331) * (-2059.498) (-2058.893) [-2057.973] (-2058.673) -- 0:00:53
Average standard deviation of split frequencies: 0.005238
845500 -- (-2054.468) [-2056.693] (-2062.129) (-2058.059) * (-2055.890) (-2051.943) [-2053.426] (-2054.963) -- 0:00:53
846000 -- (-2058.514) (-2061.392) [-2057.320] (-2063.496) * (-2057.868) [-2061.804] (-2059.326) (-2053.511) -- 0:00:52
846500 -- [-2057.127] (-2066.081) (-2059.984) (-2058.243) * [-2056.691] (-2060.928) (-2056.208) (-2058.208) -- 0:00:52
847000 -- (-2061.632) (-2055.467) [-2052.351] (-2061.138) * (-2054.809) (-2061.103) (-2055.668) [-2061.874] -- 0:00:52
847500 -- (-2057.861) (-2058.763) (-2059.260) [-2057.198] * [-2049.828] (-2052.306) (-2055.699) (-2057.662) -- 0:00:52
848000 -- (-2055.440) (-2061.412) [-2059.844] (-2060.246) * (-2055.563) (-2062.802) [-2052.356] (-2061.891) -- 0:00:52
848500 -- (-2065.062) [-2059.527] (-2058.692) (-2056.918) * (-2052.757) (-2059.568) (-2052.500) [-2053.690] -- 0:00:52
849000 -- (-2060.284) (-2053.963) [-2048.804] (-2056.482) * (-2059.146) (-2059.342) (-2056.093) [-2051.290] -- 0:00:51
849500 -- (-2055.467) (-2050.707) (-2053.571) [-2052.261] * [-2052.583] (-2055.723) (-2047.742) (-2060.467) -- 0:00:51
850000 -- (-2062.831) [-2054.692] (-2051.857) (-2056.453) * (-2054.010) [-2060.331] (-2060.345) (-2054.048) -- 0:00:51
Average standard deviation of split frequencies: 0.003990
850500 -- (-2063.350) (-2053.580) (-2058.436) [-2053.184] * [-2063.774] (-2058.442) (-2062.921) (-2061.236) -- 0:00:51
851000 -- [-2053.114] (-2053.442) (-2060.240) (-2054.319) * (-2060.410) [-2061.572] (-2054.320) (-2064.320) -- 0:00:51
851500 -- (-2057.770) (-2056.452) (-2055.878) [-2058.242] * (-2055.247) [-2058.533] (-2065.208) (-2060.116) -- 0:00:51
852000 -- [-2054.664] (-2053.897) (-2055.334) (-2055.400) * [-2050.092] (-2051.648) (-2055.005) (-2065.806) -- 0:00:50
852500 -- [-2061.994] (-2055.913) (-2053.752) (-2055.948) * (-2057.505) (-2059.225) [-2052.197] (-2055.231) -- 0:00:50
853000 -- (-2056.587) (-2052.442) (-2055.358) [-2055.684] * [-2053.955] (-2057.014) (-2060.883) (-2054.011) -- 0:00:50
853500 -- [-2052.777] (-2054.188) (-2054.214) (-2054.804) * (-2058.081) (-2061.612) (-2060.175) [-2054.906] -- 0:00:50
854000 -- (-2064.919) (-2061.670) [-2058.491] (-2063.300) * (-2063.347) [-2048.351] (-2060.472) (-2053.151) -- 0:00:50
854500 -- [-2059.976] (-2059.367) (-2053.783) (-2059.202) * (-2057.156) (-2059.681) (-2060.535) [-2053.292] -- 0:00:50
855000 -- [-2050.044] (-2057.151) (-2052.061) (-2053.008) * (-2063.028) (-2053.639) [-2055.628] (-2056.592) -- 0:00:49
Average standard deviation of split frequencies: 0.004185
855500 -- (-2052.124) (-2059.882) [-2053.082] (-2053.428) * (-2054.610) (-2058.715) (-2062.315) [-2058.584] -- 0:00:49
856000 -- (-2067.408) (-2056.703) [-2052.736] (-2056.596) * (-2054.266) [-2053.381] (-2054.765) (-2055.908) -- 0:00:49
856500 -- (-2054.598) (-2057.525) (-2056.375) [-2053.152] * [-2057.491] (-2053.560) (-2052.194) (-2057.526) -- 0:00:49
857000 -- [-2056.851] (-2063.460) (-2055.359) (-2065.484) * (-2061.003) [-2056.421] (-2052.302) (-2054.049) -- 0:00:49
857500 -- (-2057.719) [-2053.313] (-2055.580) (-2065.984) * (-2062.496) [-2048.554] (-2058.639) (-2055.121) -- 0:00:49
858000 -- (-2058.635) [-2054.951] (-2067.205) (-2054.225) * [-2057.245] (-2061.578) (-2057.859) (-2057.839) -- 0:00:48
858500 -- (-2063.037) [-2055.813] (-2056.359) (-2058.581) * (-2054.534) (-2054.808) (-2063.017) [-2057.278] -- 0:00:48
859000 -- (-2053.279) [-2055.876] (-2054.613) (-2053.816) * [-2057.404] (-2060.005) (-2057.074) (-2066.005) -- 0:00:48
859500 -- [-2058.448] (-2065.001) (-2052.270) (-2054.837) * (-2061.318) (-2057.127) (-2058.057) [-2057.954] -- 0:00:48
860000 -- (-2057.841) [-2056.224] (-2056.320) (-2061.617) * (-2057.402) (-2058.058) (-2060.539) [-2054.155] -- 0:00:48
Average standard deviation of split frequencies: 0.004163
860500 -- (-2054.354) (-2055.461) (-2055.329) [-2058.471] * (-2053.948) (-2064.629) [-2053.243] (-2049.498) -- 0:00:47
861000 -- (-2055.263) [-2057.535] (-2054.766) (-2054.347) * (-2060.659) [-2053.203] (-2053.297) (-2056.029) -- 0:00:47
861500 -- (-2058.475) [-2058.001] (-2055.156) (-2059.221) * [-2056.888] (-2057.222) (-2056.677) (-2057.210) -- 0:00:47
862000 -- (-2057.998) (-2062.987) [-2056.191] (-2055.477) * [-2050.028] (-2056.829) (-2060.680) (-2054.242) -- 0:00:47
862500 -- [-2051.946] (-2058.413) (-2052.418) (-2059.909) * [-2053.230] (-2053.517) (-2062.313) (-2062.367) -- 0:00:47
863000 -- (-2060.801) (-2060.633) [-2049.101] (-2059.411) * (-2067.974) (-2054.092) (-2057.019) [-2057.566] -- 0:00:47
863500 -- (-2054.449) (-2060.602) [-2053.373] (-2057.659) * (-2054.608) (-2062.260) (-2054.071) [-2052.755] -- 0:00:46
864000 -- [-2053.033] (-2055.787) (-2056.729) (-2060.360) * [-2055.483] (-2057.153) (-2053.166) (-2069.169) -- 0:00:46
864500 -- (-2058.041) [-2052.068] (-2057.980) (-2059.034) * (-2061.304) [-2058.208] (-2057.301) (-2051.112) -- 0:00:46
865000 -- (-2058.146) (-2059.744) (-2059.228) [-2057.353] * [-2053.961] (-2069.527) (-2061.278) (-2056.074) -- 0:00:46
Average standard deviation of split frequencies: 0.003702
865500 -- (-2058.585) [-2055.642] (-2059.014) (-2054.874) * (-2063.163) (-2059.069) (-2055.075) [-2055.144] -- 0:00:46
866000 -- (-2059.616) (-2057.409) [-2054.758] (-2055.103) * (-2064.639) (-2051.990) [-2055.283] (-2056.810) -- 0:00:46
866500 -- [-2051.947] (-2059.243) (-2063.361) (-2052.210) * [-2055.038] (-2055.243) (-2055.985) (-2060.890) -- 0:00:45
867000 -- [-2057.681] (-2058.558) (-2055.751) (-2057.335) * (-2059.149) (-2059.224) (-2062.986) [-2053.971] -- 0:00:45
867500 -- (-2052.660) (-2050.305) [-2059.316] (-2056.604) * (-2061.108) (-2052.012) (-2063.932) [-2058.496] -- 0:00:45
868000 -- (-2056.303) [-2052.065] (-2056.655) (-2058.995) * (-2060.905) [-2051.678] (-2059.176) (-2057.431) -- 0:00:45
868500 -- (-2054.790) (-2066.155) (-2057.310) [-2053.674] * (-2060.774) (-2056.197) (-2056.806) [-2055.772] -- 0:00:45
869000 -- (-2057.319) (-2068.297) [-2060.079] (-2056.151) * (-2053.303) (-2056.813) (-2058.250) [-2056.103] -- 0:00:45
869500 -- (-2054.304) [-2053.312] (-2059.523) (-2054.347) * (-2057.490) [-2053.155] (-2055.917) (-2055.063) -- 0:00:44
870000 -- [-2055.383] (-2068.156) (-2060.219) (-2059.454) * (-2055.755) [-2064.358] (-2065.015) (-2058.429) -- 0:00:44
Average standard deviation of split frequencies: 0.003465
870500 -- (-2053.852) [-2051.451] (-2061.736) (-2051.277) * [-2058.228] (-2066.381) (-2055.267) (-2057.840) -- 0:00:44
871000 -- (-2058.300) [-2056.197] (-2059.168) (-2061.339) * [-2058.755] (-2054.873) (-2061.598) (-2052.664) -- 0:00:44
871500 -- [-2056.484] (-2058.613) (-2061.002) (-2061.948) * (-2061.952) (-2053.903) (-2064.660) [-2055.552] -- 0:00:44
872000 -- (-2059.474) [-2055.766] (-2056.797) (-2053.678) * [-2062.739] (-2053.029) (-2057.926) (-2057.227) -- 0:00:44
872500 -- (-2055.704) (-2065.365) [-2057.619] (-2054.987) * (-2055.161) [-2056.096] (-2060.722) (-2064.393) -- 0:00:43
873000 -- (-2061.111) [-2057.219] (-2060.977) (-2054.147) * (-2056.986) (-2062.445) (-2054.966) [-2059.908] -- 0:00:43
873500 -- (-2056.308) (-2055.664) (-2059.115) [-2063.258] * [-2050.183] (-2061.877) (-2050.718) (-2057.174) -- 0:00:43
874000 -- (-2060.432) (-2071.895) [-2053.600] (-2059.638) * (-2055.818) (-2060.886) [-2053.384] (-2058.560) -- 0:00:43
874500 -- (-2052.571) (-2061.365) [-2049.893] (-2056.184) * (-2063.303) (-2054.027) (-2062.666) [-2055.399] -- 0:00:43
875000 -- (-2057.370) (-2054.471) [-2061.224] (-2055.249) * [-2055.739] (-2058.386) (-2049.571) (-2055.124) -- 0:00:43
Average standard deviation of split frequencies: 0.003014
875500 -- (-2054.154) (-2052.608) [-2052.512] (-2058.848) * (-2055.660) (-2051.826) (-2055.816) [-2052.219] -- 0:00:42
876000 -- [-2057.583] (-2052.943) (-2062.323) (-2057.545) * (-2065.721) (-2055.920) [-2051.977] (-2058.364) -- 0:00:42
876500 -- (-2053.746) (-2058.076) [-2052.832] (-2055.930) * [-2051.496] (-2058.703) (-2061.204) (-2053.757) -- 0:00:42
877000 -- (-2065.088) (-2058.993) (-2049.773) [-2058.069] * (-2051.000) (-2059.276) (-2061.709) [-2058.549] -- 0:00:42
877500 -- (-2057.246) (-2066.362) (-2062.455) [-2056.757] * (-2057.961) [-2061.029] (-2052.716) (-2054.810) -- 0:00:42
878000 -- (-2057.149) (-2066.041) (-2058.309) [-2061.803] * (-2056.586) (-2055.691) [-2048.737] (-2066.068) -- 0:00:41
878500 -- [-2059.225] (-2055.071) (-2060.606) (-2057.374) * (-2059.353) (-2056.413) [-2057.741] (-2060.219) -- 0:00:41
879000 -- (-2055.627) (-2055.880) (-2054.726) [-2053.361] * [-2051.820] (-2053.350) (-2054.072) (-2052.893) -- 0:00:41
879500 -- [-2054.371] (-2056.812) (-2056.715) (-2056.702) * (-2051.206) [-2053.397] (-2051.405) (-2056.433) -- 0:00:41
880000 -- [-2052.848] (-2054.168) (-2057.770) (-2054.753) * [-2056.239] (-2051.554) (-2055.939) (-2062.671) -- 0:00:41
Average standard deviation of split frequencies: 0.002676
880500 -- (-2055.974) (-2060.800) [-2055.430] (-2062.305) * [-2052.661] (-2063.872) (-2059.723) (-2058.452) -- 0:00:41
881000 -- (-2062.812) (-2061.182) [-2058.603] (-2062.214) * (-2057.169) (-2055.691) [-2057.901] (-2063.912) -- 0:00:40
881500 -- (-2066.342) (-2054.244) [-2054.828] (-2053.965) * (-2057.172) [-2055.922] (-2060.968) (-2063.219) -- 0:00:40
882000 -- (-2057.664) [-2054.858] (-2053.055) (-2053.528) * (-2051.751) (-2058.358) [-2060.863] (-2058.482) -- 0:00:40
882500 -- [-2054.052] (-2060.452) (-2059.072) (-2057.484) * (-2054.973) (-2056.683) [-2053.299] (-2051.869) -- 0:00:40
883000 -- (-2058.256) [-2054.980] (-2061.907) (-2055.720) * (-2056.337) (-2053.757) (-2063.535) [-2052.851] -- 0:00:40
883500 -- (-2053.347) [-2059.302] (-2056.095) (-2064.114) * (-2056.462) [-2051.801] (-2058.085) (-2057.783) -- 0:00:40
884000 -- (-2056.611) (-2063.599) (-2053.728) [-2054.340] * (-2072.287) (-2057.327) (-2054.451) [-2055.151] -- 0:00:39
884500 -- (-2056.191) (-2057.749) (-2055.060) [-2054.037] * (-2056.322) (-2050.475) [-2056.718] (-2061.071) -- 0:00:39
885000 -- (-2060.437) [-2056.774] (-2053.373) (-2052.519) * (-2066.724) (-2057.690) [-2059.335] (-2059.029) -- 0:00:39
Average standard deviation of split frequencies: 0.002554
885500 -- (-2066.831) [-2054.017] (-2056.155) (-2060.004) * (-2055.856) (-2054.691) (-2067.037) [-2053.423] -- 0:00:39
886000 -- [-2054.683] (-2055.398) (-2059.939) (-2060.937) * [-2052.940] (-2058.478) (-2064.393) (-2055.930) -- 0:00:39
886500 -- [-2053.525] (-2053.490) (-2064.904) (-2058.966) * (-2054.713) (-2054.729) (-2057.839) [-2058.270] -- 0:00:39
887000 -- (-2058.302) [-2056.581] (-2062.375) (-2055.049) * (-2051.739) (-2056.890) [-2059.075] (-2061.789) -- 0:00:38
887500 -- (-2053.467) (-2058.441) [-2058.730] (-2071.546) * (-2057.652) [-2055.347] (-2059.842) (-2055.542) -- 0:00:38
888000 -- (-2057.182) (-2054.570) [-2054.146] (-2060.601) * (-2052.961) (-2060.014) (-2062.728) [-2049.510] -- 0:00:38
888500 -- (-2057.643) (-2055.639) [-2051.433] (-2055.915) * [-2051.797] (-2065.906) (-2052.872) (-2061.043) -- 0:00:38
889000 -- (-2058.450) (-2057.610) [-2052.556] (-2061.660) * [-2052.661] (-2059.306) (-2061.632) (-2059.120) -- 0:00:38
889500 -- (-2053.109) [-2057.583] (-2061.837) (-2057.535) * (-2059.497) (-2061.388) (-2058.446) [-2059.536] -- 0:00:38
890000 -- (-2053.913) (-2061.567) (-2054.672) [-2059.460] * (-2052.822) (-2057.796) (-2056.297) [-2053.209] -- 0:00:37
Average standard deviation of split frequencies: 0.002541
890500 -- (-2054.032) [-2056.112] (-2054.395) (-2061.146) * [-2053.530] (-2057.407) (-2059.792) (-2056.039) -- 0:00:37
891000 -- (-2057.476) (-2055.961) [-2054.442] (-2064.687) * (-2054.023) (-2053.686) (-2062.591) [-2059.508] -- 0:00:37
891500 -- (-2054.241) (-2061.536) [-2052.978] (-2058.859) * (-2056.737) [-2052.151] (-2052.485) (-2048.743) -- 0:00:37
892000 -- (-2055.944) [-2058.907] (-2056.035) (-2057.925) * (-2059.322) (-2062.382) [-2052.354] (-2053.411) -- 0:00:37
892500 -- (-2058.249) (-2060.049) [-2047.685] (-2059.881) * [-2054.903] (-2052.392) (-2053.977) (-2053.638) -- 0:00:36
893000 -- (-2059.939) (-2058.198) (-2051.325) [-2062.585] * [-2056.964] (-2059.441) (-2063.084) (-2054.869) -- 0:00:36
893500 -- (-2054.561) [-2055.700] (-2062.081) (-2053.080) * [-2058.685] (-2053.223) (-2058.278) (-2054.769) -- 0:00:36
894000 -- (-2061.367) [-2057.743] (-2061.992) (-2055.307) * (-2066.360) [-2052.147] (-2058.607) (-2059.287) -- 0:00:36
894500 -- [-2054.024] (-2059.043) (-2055.952) (-2053.246) * (-2064.969) (-2057.253) [-2054.815] (-2051.634) -- 0:00:36
895000 -- (-2057.682) (-2055.810) [-2051.183] (-2060.626) * (-2067.229) (-2055.604) (-2055.634) [-2060.703] -- 0:00:36
Average standard deviation of split frequencies: 0.002841
895500 -- (-2059.335) (-2055.781) [-2055.658] (-2060.029) * (-2064.878) (-2061.646) [-2054.280] (-2061.705) -- 0:00:35
896000 -- (-2058.629) (-2060.471) [-2051.687] (-2059.752) * (-2059.743) (-2056.703) (-2067.517) [-2054.522] -- 0:00:35
896500 -- (-2061.961) (-2056.029) [-2062.350] (-2063.146) * (-2060.474) (-2056.995) [-2054.465] (-2057.512) -- 0:00:35
897000 -- (-2060.938) (-2052.927) [-2057.637] (-2053.809) * (-2059.015) (-2050.605) [-2060.893] (-2059.532) -- 0:00:35
897500 -- (-2063.074) [-2056.531] (-2057.268) (-2054.674) * (-2053.982) (-2057.112) [-2062.522] (-2059.815) -- 0:00:35
898000 -- (-2063.861) (-2061.730) (-2058.277) [-2054.942] * (-2056.504) [-2051.135] (-2056.178) (-2056.431) -- 0:00:35
898500 -- [-2059.279] (-2055.498) (-2056.687) (-2061.927) * [-2052.353] (-2059.918) (-2065.720) (-2063.118) -- 0:00:34
899000 -- (-2058.831) [-2051.135] (-2058.499) (-2059.971) * (-2056.754) [-2052.587] (-2054.118) (-2059.279) -- 0:00:34
899500 -- (-2064.217) [-2052.300] (-2053.431) (-2054.573) * (-2055.742) [-2055.162] (-2054.591) (-2059.296) -- 0:00:34
900000 -- (-2055.119) [-2053.197] (-2061.119) (-2062.459) * (-2058.218) (-2052.927) (-2055.519) [-2056.247] -- 0:00:34
Average standard deviation of split frequencies: 0.002931
900500 -- (-2057.917) (-2051.080) (-2066.287) [-2053.694] * (-2060.843) (-2056.198) (-2058.353) [-2056.882] -- 0:00:34
901000 -- (-2056.967) [-2059.756] (-2061.140) (-2051.995) * (-2059.671) (-2052.602) (-2057.294) [-2052.981] -- 0:00:34
901500 -- (-2061.724) (-2062.997) (-2063.651) [-2061.197] * (-2065.958) (-2055.708) (-2054.544) [-2060.600] -- 0:00:33
902000 -- (-2059.403) [-2061.435] (-2061.032) (-2056.492) * [-2050.174] (-2058.092) (-2054.451) (-2062.576) -- 0:00:33
902500 -- (-2054.973) (-2066.918) [-2060.230] (-2059.686) * [-2050.028] (-2058.110) (-2053.322) (-2057.556) -- 0:00:33
903000 -- (-2061.127) (-2057.318) [-2057.754] (-2056.131) * (-2059.477) (-2060.814) (-2067.131) [-2057.204] -- 0:00:33
903500 -- (-2062.402) (-2061.655) (-2056.792) [-2049.673] * (-2053.849) (-2056.959) (-2052.453) [-2052.429] -- 0:00:33
904000 -- (-2058.089) [-2060.820] (-2057.754) (-2057.729) * (-2055.305) (-2051.276) [-2060.591] (-2060.553) -- 0:00:33
904500 -- (-2055.265) (-2056.973) [-2058.163] (-2057.553) * (-2067.375) (-2057.817) (-2057.182) [-2052.507] -- 0:00:32
905000 -- [-2057.816] (-2067.963) (-2054.438) (-2067.967) * (-2057.997) [-2055.862] (-2059.436) (-2054.742) -- 0:00:32
Average standard deviation of split frequencies: 0.003018
905500 -- [-2059.283] (-2068.028) (-2055.562) (-2061.668) * (-2058.266) (-2066.396) (-2065.062) [-2054.857] -- 0:00:32
906000 -- (-2057.340) (-2065.844) [-2054.659] (-2058.099) * (-2051.094) (-2056.306) [-2059.660] (-2062.601) -- 0:00:32
906500 -- (-2053.289) (-2064.089) [-2055.813] (-2061.008) * (-2058.450) (-2061.354) [-2052.592] (-2059.172) -- 0:00:32
907000 -- (-2054.575) (-2063.211) [-2058.886] (-2063.869) * (-2053.849) [-2058.082] (-2054.000) (-2055.694) -- 0:00:31
907500 -- (-2057.235) (-2067.173) (-2055.729) [-2055.933] * (-2051.685) (-2054.472) [-2059.297] (-2062.679) -- 0:00:31
908000 -- (-2054.896) (-2052.778) [-2050.246] (-2052.243) * [-2052.513] (-2050.965) (-2062.998) (-2058.230) -- 0:00:31
908500 -- [-2057.704] (-2054.411) (-2059.354) (-2062.631) * [-2055.093] (-2055.018) (-2064.651) (-2052.599) -- 0:00:31
909000 -- (-2056.280) (-2060.102) [-2062.071] (-2058.230) * (-2058.911) (-2054.678) (-2060.227) [-2057.286] -- 0:00:31
909500 -- (-2055.577) (-2057.868) (-2060.797) [-2058.043] * [-2054.210] (-2062.486) (-2055.814) (-2062.918) -- 0:00:31
910000 -- (-2048.765) [-2053.965] (-2052.545) (-2055.087) * [-2053.528] (-2054.433) (-2070.639) (-2067.831) -- 0:00:30
Average standard deviation of split frequencies: 0.002795
910500 -- (-2051.588) (-2060.134) [-2050.340] (-2054.973) * [-2055.496] (-2055.013) (-2055.532) (-2065.846) -- 0:00:30
911000 -- [-2051.765] (-2055.448) (-2061.027) (-2054.715) * (-2059.993) [-2056.980] (-2056.325) (-2065.197) -- 0:00:30
911500 -- (-2055.936) (-2065.545) [-2062.143] (-2059.789) * (-2062.160) [-2058.472] (-2057.325) (-2062.731) -- 0:00:30
912000 -- (-2054.260) [-2053.893] (-2052.693) (-2057.871) * (-2061.869) (-2056.181) (-2058.069) [-2059.403] -- 0:00:30
912500 -- (-2057.737) (-2060.020) (-2053.389) [-2051.067] * (-2065.114) [-2052.216] (-2053.348) (-2062.212) -- 0:00:30
913000 -- (-2057.590) (-2058.687) [-2057.246] (-2054.228) * (-2065.034) (-2063.345) [-2063.840] (-2062.282) -- 0:00:29
913500 -- (-2053.728) [-2060.493] (-2056.862) (-2054.608) * (-2055.638) (-2061.540) [-2054.065] (-2056.291) -- 0:00:29
914000 -- (-2063.745) (-2067.733) (-2056.944) [-2052.347] * (-2055.923) (-2050.694) [-2054.336] (-2054.970) -- 0:00:29
914500 -- (-2059.573) (-2052.485) [-2052.466] (-2050.102) * (-2057.106) [-2053.028] (-2055.319) (-2057.852) -- 0:00:29
915000 -- (-2053.168) [-2057.029] (-2055.187) (-2059.057) * (-2051.511) (-2056.051) (-2060.910) [-2059.260] -- 0:00:29
Average standard deviation of split frequencies: 0.003294
915500 -- [-2056.289] (-2055.645) (-2063.356) (-2056.581) * (-2053.080) (-2057.071) [-2050.275] (-2057.759) -- 0:00:29
916000 -- (-2058.041) (-2053.790) (-2063.969) [-2057.546] * (-2058.134) (-2060.535) [-2055.469] (-2058.764) -- 0:00:28
916500 -- (-2052.490) (-2061.494) [-2054.513] (-2054.555) * (-2055.531) (-2055.207) (-2057.697) [-2062.287] -- 0:00:28
917000 -- (-2062.106) (-2058.936) (-2060.641) [-2054.225] * (-2054.598) [-2054.528] (-2054.726) (-2073.479) -- 0:00:28
917500 -- (-2056.601) (-2064.076) [-2052.306] (-2059.417) * (-2062.005) (-2059.630) [-2057.712] (-2069.127) -- 0:00:28
918000 -- (-2056.310) [-2064.669] (-2054.276) (-2050.491) * (-2054.881) (-2059.983) (-2048.636) [-2056.184] -- 0:00:28
918500 -- (-2055.865) [-2053.202] (-2056.582) (-2052.856) * (-2054.214) (-2054.277) [-2064.379] (-2056.570) -- 0:00:28
919000 -- (-2059.023) (-2054.546) [-2052.541] (-2058.558) * (-2058.423) [-2051.604] (-2055.199) (-2053.323) -- 0:00:27
919500 -- (-2060.939) (-2055.276) (-2050.683) [-2053.929] * [-2056.113] (-2055.126) (-2061.668) (-2058.716) -- 0:00:27
920000 -- (-2053.482) (-2057.132) (-2060.379) [-2052.778] * (-2052.884) (-2061.328) (-2057.380) [-2052.449] -- 0:00:27
Average standard deviation of split frequencies: 0.002970
920500 -- (-2051.941) [-2054.112] (-2057.379) (-2055.171) * (-2059.957) (-2061.943) [-2051.296] (-2064.863) -- 0:00:27
921000 -- (-2053.160) [-2061.056] (-2060.010) (-2058.740) * (-2063.372) (-2059.309) [-2064.227] (-2055.924) -- 0:00:27
921500 -- (-2055.925) (-2054.316) (-2055.996) [-2057.599] * (-2055.067) [-2051.682] (-2055.008) (-2061.445) -- 0:00:27
922000 -- (-2054.824) [-2052.345] (-2060.993) (-2056.841) * (-2055.948) (-2060.625) [-2060.942] (-2056.216) -- 0:00:26
922500 -- [-2053.232] (-2059.350) (-2064.071) (-2058.614) * (-2064.615) (-2053.661) [-2064.162] (-2051.185) -- 0:00:26
923000 -- (-2053.950) (-2054.413) (-2059.042) [-2059.070] * (-2058.311) (-2054.978) [-2056.090] (-2058.242) -- 0:00:26
923500 -- (-2068.502) [-2060.391] (-2064.998) (-2059.105) * (-2058.527) (-2054.634) [-2058.878] (-2059.686) -- 0:00:26
924000 -- (-2066.967) (-2055.766) [-2056.527] (-2068.077) * (-2070.986) (-2060.132) (-2060.518) [-2061.288] -- 0:00:26
924500 -- [-2056.433] (-2068.889) (-2052.340) (-2058.440) * [-2055.156] (-2051.724) (-2064.994) (-2066.936) -- 0:00:25
925000 -- (-2060.809) (-2059.450) [-2056.141] (-2059.009) * (-2058.847) (-2055.535) [-2056.089] (-2056.684) -- 0:00:25
Average standard deviation of split frequencies: 0.003564
925500 -- (-2055.329) [-2054.521] (-2053.477) (-2048.337) * (-2051.653) [-2057.112] (-2062.339) (-2065.376) -- 0:00:25
926000 -- (-2060.937) [-2053.087] (-2054.604) (-2053.875) * [-2051.160] (-2058.646) (-2058.623) (-2063.129) -- 0:00:25
926500 -- (-2050.277) (-2057.518) [-2054.447] (-2066.703) * [-2054.278] (-2063.072) (-2055.198) (-2051.283) -- 0:00:25
927000 -- (-2057.456) (-2065.452) (-2061.744) [-2065.242] * [-2056.980] (-2052.663) (-2055.943) (-2056.100) -- 0:00:25
927500 -- (-2058.544) [-2050.189] (-2057.939) (-2056.832) * (-2058.642) (-2058.731) (-2058.970) [-2056.292] -- 0:00:24
928000 -- (-2059.575) (-2063.763) (-2061.076) [-2054.919] * (-2057.874) [-2056.452] (-2060.023) (-2057.548) -- 0:00:24
928500 -- (-2057.445) [-2057.456] (-2055.265) (-2060.376) * (-2063.831) [-2049.330] (-2058.096) (-2056.931) -- 0:00:24
929000 -- (-2057.113) (-2058.033) (-2051.823) [-2058.528] * (-2066.541) [-2052.173] (-2059.936) (-2050.488) -- 0:00:24
929500 -- (-2052.745) [-2052.124] (-2055.219) (-2061.679) * (-2065.634) (-2059.590) [-2056.373] (-2062.780) -- 0:00:24
930000 -- [-2057.110] (-2053.317) (-2052.077) (-2059.403) * [-2061.508] (-2058.673) (-2061.834) (-2051.580) -- 0:00:24
Average standard deviation of split frequencies: 0.002735
930500 -- (-2057.871) (-2055.820) (-2057.471) [-2056.348] * (-2068.035) (-2057.529) (-2069.806) [-2052.798] -- 0:00:23
931000 -- [-2052.400] (-2056.124) (-2056.665) (-2054.455) * (-2057.659) [-2055.677] (-2057.005) (-2055.619) -- 0:00:23
931500 -- (-2055.609) (-2055.854) (-2059.305) [-2050.307] * (-2053.427) (-2054.838) [-2055.402] (-2052.194) -- 0:00:23
932000 -- [-2051.088] (-2062.233) (-2064.718) (-2056.041) * (-2052.719) (-2056.223) (-2055.982) [-2051.641] -- 0:00:23
932500 -- [-2054.511] (-2055.306) (-2061.939) (-2055.595) * [-2058.107] (-2055.079) (-2057.463) (-2053.050) -- 0:00:23
933000 -- (-2055.435) [-2054.115] (-2053.915) (-2060.557) * (-2061.435) (-2056.655) [-2048.591] (-2055.342) -- 0:00:22
933500 -- (-2051.140) [-2058.088] (-2062.071) (-2054.212) * [-2054.285] (-2058.485) (-2053.765) (-2056.546) -- 0:00:22
934000 -- (-2051.870) [-2055.520] (-2056.731) (-2060.791) * (-2069.576) [-2055.508] (-2054.799) (-2059.470) -- 0:00:22
934500 -- (-2059.163) [-2051.566] (-2059.112) (-2063.970) * (-2056.427) (-2055.275) [-2052.045] (-2055.796) -- 0:00:22
935000 -- [-2054.188] (-2056.336) (-2053.557) (-2056.344) * (-2057.540) (-2051.831) (-2055.020) [-2053.851] -- 0:00:22
Average standard deviation of split frequencies: 0.002317
935500 -- (-2055.070) [-2057.508] (-2054.641) (-2053.183) * [-2050.624] (-2063.840) (-2056.936) (-2056.936) -- 0:00:22
936000 -- (-2056.216) (-2052.167) (-2055.645) [-2055.811] * (-2054.396) (-2059.500) (-2052.767) [-2057.762] -- 0:00:22
936500 -- (-2056.114) (-2061.620) [-2051.869] (-2053.688) * [-2054.066] (-2051.679) (-2060.430) (-2057.323) -- 0:00:21
937000 -- [-2055.228] (-2062.382) (-2057.157) (-2060.320) * (-2054.668) [-2052.289] (-2053.445) (-2061.153) -- 0:00:21
937500 -- (-2054.108) (-2059.499) (-2049.517) [-2058.347] * (-2059.266) [-2052.666] (-2060.034) (-2059.513) -- 0:00:21
938000 -- [-2054.798] (-2054.440) (-2052.793) (-2060.434) * [-2056.526] (-2053.941) (-2056.053) (-2056.516) -- 0:00:21
938500 -- [-2049.996] (-2063.534) (-2058.618) (-2068.493) * (-2055.900) [-2055.902] (-2057.825) (-2062.176) -- 0:00:21
939000 -- (-2065.129) [-2054.461] (-2053.564) (-2058.483) * [-2060.861] (-2055.127) (-2054.853) (-2057.209) -- 0:00:20
939500 -- (-2061.342) (-2061.628) [-2055.515] (-2056.209) * (-2058.474) (-2053.920) (-2058.359) [-2051.608] -- 0:00:20
940000 -- (-2065.861) (-2062.103) (-2056.304) [-2059.481] * (-2062.600) [-2054.732] (-2055.483) (-2058.787) -- 0:00:20
Average standard deviation of split frequencies: 0.002305
940500 -- (-2056.005) [-2055.247] (-2053.745) (-2058.444) * (-2054.177) [-2054.639] (-2063.605) (-2053.097) -- 0:00:20
941000 -- (-2058.171) (-2060.437) [-2057.404] (-2059.660) * (-2060.633) (-2052.223) [-2052.311] (-2056.034) -- 0:00:20
941500 -- (-2058.511) (-2051.361) [-2054.978] (-2056.610) * (-2064.446) [-2050.741] (-2052.888) (-2061.582) -- 0:00:20
942000 -- [-2056.867] (-2058.460) (-2059.695) (-2057.670) * (-2063.786) (-2056.417) (-2057.843) [-2057.284] -- 0:00:19
942500 -- [-2050.353] (-2053.739) (-2063.274) (-2062.337) * (-2052.605) [-2061.094] (-2060.122) (-2059.297) -- 0:00:19
943000 -- [-2050.271] (-2055.946) (-2053.360) (-2063.221) * [-2053.996] (-2054.090) (-2063.386) (-2062.777) -- 0:00:19
943500 -- [-2054.484] (-2059.092) (-2057.000) (-2058.045) * (-2060.201) (-2061.696) (-2054.922) [-2059.452] -- 0:00:19
944000 -- [-2051.113] (-2050.977) (-2055.954) (-2054.932) * [-2053.697] (-2051.937) (-2064.604) (-2060.446) -- 0:00:19
944500 -- (-2062.287) (-2055.232) [-2058.257] (-2053.627) * (-2054.007) (-2053.301) (-2058.482) [-2064.680] -- 0:00:19
945000 -- (-2059.663) (-2065.163) (-2057.783) [-2051.146] * (-2064.625) (-2059.329) [-2051.414] (-2060.520) -- 0:00:18
Average standard deviation of split frequencies: 0.001993
945500 -- (-2055.362) (-2058.566) (-2054.901) [-2054.569] * (-2061.644) (-2062.555) (-2055.772) [-2057.184] -- 0:00:18
946000 -- (-2063.708) (-2051.117) [-2053.981] (-2055.273) * (-2056.592) [-2055.310] (-2061.595) (-2051.435) -- 0:00:18
946500 -- (-2060.697) [-2054.448] (-2059.963) (-2055.410) * (-2053.686) [-2057.864] (-2062.267) (-2059.939) -- 0:00:18
947000 -- (-2053.536) (-2060.591) [-2055.579] (-2053.122) * [-2056.063] (-2051.439) (-2062.872) (-2051.628) -- 0:00:18
947500 -- (-2058.374) (-2060.700) (-2052.691) [-2051.256] * (-2055.894) (-2053.630) (-2050.828) [-2058.935] -- 0:00:18
948000 -- (-2057.301) (-2053.345) (-2057.255) [-2051.794] * (-2058.667) [-2055.511] (-2054.507) (-2058.946) -- 0:00:17
948500 -- (-2054.694) (-2054.946) (-2060.139) [-2056.980] * [-2050.178] (-2052.163) (-2064.715) (-2054.350) -- 0:00:17
949000 -- (-2055.235) [-2057.787] (-2058.897) (-2062.776) * [-2053.694] (-2050.608) (-2055.239) (-2057.108) -- 0:00:17
949500 -- (-2059.974) (-2049.943) [-2061.109] (-2063.606) * (-2061.290) (-2057.243) (-2057.737) [-2054.644] -- 0:00:17
950000 -- [-2053.786] (-2053.346) (-2057.026) (-2062.239) * (-2054.292) (-2065.738) (-2052.753) [-2049.924] -- 0:00:17
Average standard deviation of split frequencies: 0.002182
950500 -- [-2054.321] (-2051.947) (-2056.498) (-2051.901) * [-2055.231] (-2058.621) (-2059.860) (-2054.328) -- 0:00:16
951000 -- (-2054.394) (-2064.617) (-2060.920) [-2056.471] * (-2050.958) [-2056.411] (-2067.679) (-2058.131) -- 0:00:16
951500 -- (-2054.805) [-2051.150] (-2056.620) (-2062.584) * (-2055.706) (-2052.866) (-2057.964) [-2055.090] -- 0:00:16
952000 -- (-2055.395) (-2055.793) [-2052.428] (-2055.547) * (-2052.902) (-2059.944) [-2057.853] (-2052.690) -- 0:00:16
952500 -- (-2059.281) (-2060.769) (-2056.751) [-2054.187] * (-2053.417) (-2057.990) [-2051.489] (-2062.967) -- 0:00:16
953000 -- (-2058.747) (-2061.541) [-2059.950] (-2054.397) * (-2061.676) (-2068.017) (-2065.011) [-2055.703] -- 0:00:16
953500 -- (-2059.529) (-2058.581) (-2057.022) [-2052.614] * [-2055.768] (-2063.233) (-2062.956) (-2059.378) -- 0:00:15
954000 -- (-2053.743) (-2065.429) (-2055.479) [-2058.082] * (-2058.180) [-2056.694] (-2056.288) (-2056.291) -- 0:00:15
954500 -- (-2054.048) [-2057.840] (-2055.742) (-2058.886) * (-2057.170) (-2058.731) [-2060.077] (-2063.679) -- 0:00:15
955000 -- [-2051.549] (-2058.461) (-2060.614) (-2054.424) * (-2052.246) (-2050.461) [-2051.550] (-2062.661) -- 0:00:15
Average standard deviation of split frequencies: 0.002466
955500 -- (-2057.384) (-2053.268) (-2052.887) [-2054.667] * (-2060.319) [-2052.351] (-2055.532) (-2058.822) -- 0:00:15
956000 -- (-2055.202) (-2060.635) (-2061.992) [-2054.929] * (-2059.064) [-2047.619] (-2051.609) (-2070.659) -- 0:00:15
956500 -- (-2051.676) (-2057.109) (-2055.730) [-2054.055] * (-2057.871) (-2057.585) [-2053.165] (-2060.318) -- 0:00:14
957000 -- [-2057.955] (-2051.239) (-2055.995) (-2051.550) * [-2055.186] (-2050.585) (-2060.483) (-2062.352) -- 0:00:14
957500 -- [-2052.065] (-2060.505) (-2054.484) (-2056.830) * (-2053.467) (-2058.858) [-2055.151] (-2055.175) -- 0:00:14
958000 -- (-2058.487) [-2057.037] (-2058.842) (-2056.981) * (-2054.009) (-2055.714) (-2060.790) [-2056.937] -- 0:00:14
958500 -- (-2054.518) (-2054.986) (-2059.873) [-2057.995] * (-2054.094) (-2055.690) (-2059.793) [-2055.692] -- 0:00:14
959000 -- (-2056.723) (-2069.593) [-2057.855] (-2052.595) * (-2055.741) (-2057.158) [-2059.764] (-2057.338) -- 0:00:14
959500 -- [-2052.276] (-2068.840) (-2054.457) (-2052.305) * (-2060.442) [-2056.279] (-2063.589) (-2062.957) -- 0:00:13
960000 -- (-2059.677) [-2057.488] (-2058.967) (-2061.708) * (-2053.943) [-2056.106] (-2066.418) (-2061.032) -- 0:00:13
Average standard deviation of split frequencies: 0.002552
960500 -- (-2054.377) [-2057.928] (-2061.617) (-2057.896) * [-2058.014] (-2060.032) (-2054.759) (-2062.354) -- 0:00:13
961000 -- (-2057.289) (-2060.092) [-2056.548] (-2052.315) * [-2058.099] (-2053.861) (-2056.469) (-2056.275) -- 0:00:13
961500 -- [-2057.637] (-2058.423) (-2051.831) (-2056.618) * (-2060.242) (-2062.804) [-2051.453] (-2055.174) -- 0:00:13
962000 -- [-2052.451] (-2059.737) (-2058.786) (-2052.509) * [-2057.558] (-2059.900) (-2054.698) (-2057.579) -- 0:00:13
962500 -- (-2055.322) (-2056.535) [-2050.672] (-2063.550) * (-2055.682) [-2066.124] (-2056.522) (-2061.944) -- 0:00:12
963000 -- (-2055.475) [-2051.702] (-2058.685) (-2058.876) * [-2056.592] (-2056.680) (-2051.870) (-2057.863) -- 0:00:12
963500 -- (-2060.059) [-2050.014] (-2058.279) (-2060.261) * (-2060.860) (-2056.908) [-2052.238] (-2056.282) -- 0:00:12
964000 -- (-2051.706) (-2058.681) [-2054.071] (-2058.780) * (-2057.629) (-2064.840) [-2060.151] (-2058.219) -- 0:00:12
964500 -- [-2051.704] (-2055.078) (-2054.020) (-2058.608) * (-2054.639) (-2052.659) [-2060.393] (-2061.837) -- 0:00:12
965000 -- (-2061.779) (-2063.312) [-2054.732] (-2057.791) * (-2070.716) (-2056.134) (-2060.207) [-2062.363] -- 0:00:12
Average standard deviation of split frequencies: 0.002928
965500 -- (-2055.318) [-2056.340] (-2057.152) (-2053.514) * (-2056.285) [-2055.232] (-2057.519) (-2055.747) -- 0:00:11
966000 -- (-2059.882) (-2057.723) [-2058.307] (-2060.214) * (-2058.027) [-2057.302] (-2058.309) (-2050.830) -- 0:00:11
966500 -- (-2059.659) (-2051.970) (-2056.974) [-2054.153] * (-2056.194) (-2056.276) [-2053.075] (-2052.906) -- 0:00:11
967000 -- (-2062.797) (-2051.372) (-2054.616) [-2054.004] * (-2056.054) (-2059.300) (-2053.333) [-2053.402] -- 0:00:11
967500 -- (-2063.311) (-2063.447) [-2053.931] (-2051.097) * (-2059.116) (-2056.770) (-2055.625) [-2056.899] -- 0:00:11
968000 -- (-2053.729) (-2059.360) [-2054.653] (-2055.237) * (-2065.109) (-2056.400) [-2055.372] (-2064.015) -- 0:00:11
968500 -- (-2055.982) [-2059.808] (-2061.902) (-2054.854) * (-2058.850) (-2056.599) [-2052.624] (-2061.823) -- 0:00:10
969000 -- (-2057.180) (-2054.663) [-2049.662] (-2070.973) * (-2057.849) [-2054.826] (-2055.276) (-2055.972) -- 0:00:10
969500 -- (-2057.174) [-2050.012] (-2054.113) (-2065.216) * (-2061.953) [-2052.458] (-2054.166) (-2055.087) -- 0:00:10
970000 -- (-2057.646) (-2054.826) [-2056.115] (-2064.796) * (-2058.963) (-2060.437) [-2054.422] (-2070.652) -- 0:00:10
Average standard deviation of split frequencies: 0.003205
970500 -- (-2057.071) (-2056.828) [-2058.869] (-2056.672) * (-2058.459) (-2057.564) (-2058.795) [-2059.874] -- 0:00:10
971000 -- (-2057.702) (-2056.388) [-2058.451] (-2063.500) * (-2063.580) (-2057.619) [-2056.166] (-2060.524) -- 0:00:09
971500 -- (-2057.987) (-2054.645) [-2053.845] (-2050.248) * (-2054.986) (-2058.125) [-2053.730] (-2056.421) -- 0:00:09
972000 -- (-2054.544) (-2054.176) (-2055.298) [-2050.024] * [-2057.466] (-2060.118) (-2055.488) (-2056.767) -- 0:00:09
972500 -- (-2054.630) (-2065.736) [-2053.191] (-2067.580) * (-2052.252) (-2052.357) [-2054.626] (-2059.378) -- 0:00:09
973000 -- (-2055.294) (-2058.458) (-2056.784) [-2056.225] * [-2050.660] (-2058.017) (-2059.498) (-2055.958) -- 0:00:09
973500 -- (-2058.645) (-2055.341) (-2054.901) [-2052.377] * (-2057.542) (-2056.286) [-2056.812] (-2056.681) -- 0:00:09
974000 -- (-2066.675) (-2053.402) [-2055.260] (-2064.471) * (-2055.213) [-2053.445] (-2059.363) (-2058.671) -- 0:00:08
974500 -- [-2056.785] (-2054.052) (-2054.994) (-2055.108) * (-2053.273) [-2054.170] (-2059.643) (-2065.954) -- 0:00:08
975000 -- (-2061.673) (-2055.206) [-2050.163] (-2054.870) * (-2059.559) (-2053.998) [-2052.702] (-2059.204) -- 0:00:08
Average standard deviation of split frequencies: 0.002415
975500 -- (-2068.411) [-2057.231] (-2056.884) (-2055.930) * (-2057.729) (-2055.768) [-2063.023] (-2056.670) -- 0:00:08
976000 -- (-2052.296) [-2054.735] (-2057.766) (-2061.305) * (-2058.801) (-2056.963) [-2062.907] (-2065.166) -- 0:00:08
976500 -- (-2060.811) [-2057.671] (-2059.212) (-2053.279) * [-2059.198] (-2057.836) (-2051.316) (-2059.750) -- 0:00:08
977000 -- (-2070.870) [-2056.878] (-2057.671) (-2053.414) * (-2058.989) (-2056.720) [-2053.554] (-2057.479) -- 0:00:07
977500 -- (-2065.204) [-2058.783] (-2064.794) (-2059.747) * (-2054.054) (-2057.048) (-2056.984) [-2053.821] -- 0:00:07
978000 -- [-2059.447] (-2056.477) (-2059.055) (-2058.022) * (-2060.784) [-2056.613] (-2061.168) (-2056.450) -- 0:00:07
978500 -- (-2062.681) (-2058.732) [-2051.010] (-2056.310) * (-2052.026) [-2052.106] (-2058.235) (-2058.428) -- 0:00:07
979000 -- (-2069.586) (-2072.352) (-2057.577) [-2057.112] * (-2052.740) (-2054.903) (-2060.639) [-2053.301] -- 0:00:07
979500 -- (-2058.406) (-2058.831) [-2050.579] (-2064.832) * (-2056.437) (-2053.208) (-2053.405) [-2063.148] -- 0:00:07
980000 -- (-2057.420) [-2061.005] (-2055.900) (-2058.251) * (-2060.916) [-2061.737] (-2056.545) (-2058.295) -- 0:00:06
Average standard deviation of split frequencies: 0.001827
980500 -- [-2059.751] (-2060.002) (-2066.293) (-2059.029) * (-2066.116) (-2057.234) (-2052.343) [-2054.888] -- 0:00:06
981000 -- [-2056.283] (-2063.130) (-2055.628) (-2060.297) * (-2059.738) (-2052.889) (-2052.322) [-2054.466] -- 0:00:06
981500 -- (-2056.558) (-2055.342) (-2059.310) [-2067.924] * [-2056.930] (-2064.062) (-2056.522) (-2060.504) -- 0:00:06
982000 -- (-2056.639) (-2059.874) [-2057.392] (-2056.804) * [-2055.487] (-2054.668) (-2060.131) (-2058.640) -- 0:00:06
982500 -- (-2053.823) (-2061.305) (-2058.937) [-2057.171] * (-2061.184) (-2058.240) [-2061.097] (-2063.436) -- 0:00:06
983000 -- (-2058.249) (-2065.499) [-2067.934] (-2060.447) * (-2059.777) (-2061.242) (-2055.515) [-2059.105] -- 0:00:05
983500 -- (-2058.104) (-2061.770) [-2064.507] (-2064.688) * (-2053.699) (-2057.151) (-2061.715) [-2055.571] -- 0:00:05
984000 -- (-2065.512) (-2053.065) (-2063.035) [-2050.183] * (-2063.174) (-2059.405) [-2053.496] (-2056.004) -- 0:00:05
984500 -- (-2059.131) [-2049.712] (-2062.620) (-2055.821) * (-2057.547) (-2057.591) [-2056.567] (-2061.265) -- 0:00:05
985000 -- (-2056.959) (-2052.109) [-2059.931] (-2055.653) * [-2052.770] (-2056.804) (-2056.280) (-2068.551) -- 0:00:05
Average standard deviation of split frequencies: 0.001626
985500 -- (-2062.249) (-2051.310) (-2059.058) [-2051.754] * (-2059.255) (-2053.292) (-2055.069) [-2051.499] -- 0:00:04
986000 -- (-2053.811) [-2056.784] (-2056.274) (-2056.743) * (-2051.758) (-2057.290) (-2068.623) [-2055.683] -- 0:00:04
986500 -- [-2055.792] (-2062.712) (-2063.890) (-2062.463) * (-2050.668) (-2057.920) (-2058.896) [-2058.393] -- 0:00:04
987000 -- (-2058.011) (-2060.662) [-2053.857] (-2056.976) * (-2054.101) (-2064.448) (-2063.396) [-2052.938] -- 0:00:04
987500 -- [-2056.126] (-2060.544) (-2062.742) (-2058.764) * (-2056.782) (-2061.416) (-2056.471) [-2046.889] -- 0:00:04
988000 -- (-2054.094) (-2062.466) (-2059.414) [-2059.590] * (-2060.617) (-2055.268) [-2056.957] (-2053.826) -- 0:00:04
988500 -- (-2052.237) (-2068.883) [-2050.146] (-2057.271) * (-2053.837) (-2059.801) [-2052.524] (-2056.494) -- 0:00:03
989000 -- (-2059.106) (-2060.720) (-2051.657) [-2055.314] * (-2055.695) (-2055.352) [-2053.777] (-2056.133) -- 0:00:03
989500 -- (-2063.728) (-2057.390) (-2059.535) [-2055.833] * (-2054.164) [-2055.330] (-2056.595) (-2054.961) -- 0:00:03
990000 -- (-2059.248) (-2056.785) (-2058.936) [-2054.315] * (-2056.573) (-2058.122) (-2055.221) [-2052.815] -- 0:00:03
Average standard deviation of split frequencies: 0.002284
990500 -- (-2052.534) (-2058.351) [-2056.889] (-2058.275) * (-2055.471) (-2057.176) [-2056.716] (-2056.829) -- 0:00:03
991000 -- (-2049.004) (-2057.820) (-2060.836) [-2054.135] * [-2058.386] (-2058.026) (-2057.160) (-2058.361) -- 0:00:03
991500 -- (-2065.386) [-2053.834] (-2058.834) (-2059.789) * (-2056.764) (-2056.705) [-2057.133] (-2054.158) -- 0:00:02
992000 -- (-2063.024) (-2053.535) (-2060.021) [-2055.664] * (-2062.099) (-2059.345) [-2057.512] (-2056.944) -- 0:00:02
992500 -- [-2053.347] (-2061.740) (-2054.493) (-2064.297) * [-2056.929] (-2051.162) (-2066.114) (-2054.760) -- 0:00:02
993000 -- [-2053.124] (-2056.066) (-2052.497) (-2056.700) * (-2049.707) (-2056.710) (-2058.816) [-2058.513] -- 0:00:02
993500 -- (-2062.661) (-2055.896) [-2052.830] (-2059.434) * (-2061.265) (-2049.118) (-2050.433) [-2059.957] -- 0:00:02
994000 -- (-2059.899) (-2059.559) (-2054.440) [-2051.572] * (-2056.203) [-2054.974] (-2060.937) (-2055.893) -- 0:00:02
994500 -- (-2054.005) (-2055.336) [-2051.427] (-2048.824) * (-2054.711) (-2055.001) (-2064.279) [-2051.002] -- 0:00:01
995000 -- [-2049.771] (-2059.330) (-2062.929) (-2061.312) * [-2056.836] (-2061.522) (-2062.829) (-2055.878) -- 0:00:01
Average standard deviation of split frequencies: 0.002366
995500 -- (-2055.608) [-2055.029] (-2059.336) (-2053.401) * (-2057.536) [-2057.744] (-2060.665) (-2055.736) -- 0:00:01
996000 -- (-2058.675) [-2051.542] (-2054.283) (-2056.792) * [-2052.036] (-2052.701) (-2059.177) (-2053.595) -- 0:00:01
996500 -- (-2062.063) [-2057.360] (-2048.636) (-2066.420) * (-2057.399) (-2066.303) (-2063.261) [-2055.510] -- 0:00:01
997000 -- (-2057.238) [-2050.283] (-2058.456) (-2059.592) * [-2053.789] (-2063.042) (-2061.136) (-2056.793) -- 0:00:01
997500 -- (-2053.776) [-2053.558] (-2059.583) (-2054.300) * (-2056.327) [-2055.428] (-2058.897) (-2057.392) -- 0:00:00
998000 -- (-2056.596) (-2054.477) (-2060.021) [-2054.367] * (-2051.579) (-2056.701) [-2058.690] (-2055.948) -- 0:00:00
998500 -- (-2055.124) [-2052.499] (-2060.015) (-2055.914) * [-2057.657] (-2062.249) (-2061.943) (-2054.025) -- 0:00:00
999000 -- (-2058.949) (-2053.769) (-2055.877) [-2054.272] * [-2057.035] (-2055.425) (-2054.609) (-2062.058) -- 0:00:00
999500 -- (-2060.357) (-2065.065) (-2060.351) [-2060.729] * [-2066.297] (-2058.075) (-2062.860) (-2058.315) -- 0:00:00
1000000 -- (-2051.841) [-2055.758] (-2056.734) (-2059.735) * (-2059.755) (-2054.597) (-2059.225) [-2058.186] -- 0:00:00
Average standard deviation of split frequencies: 0.003392
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -2051.840916 -- 17.332163
Chain 1 -- -2051.840914 -- 17.332163
Chain 2 -- -2055.758177 -- 17.986648
Chain 2 -- -2055.758175 -- 17.986648
Chain 3 -- -2056.733755 -- 18.396830
Chain 3 -- -2056.733755 -- 18.396830
Chain 4 -- -2059.735245 -- 17.230595
Chain 4 -- -2059.735247 -- 17.230595
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -2059.754590 -- 15.934938
Chain 1 -- -2059.754588 -- 15.934938
Chain 2 -- -2054.596766 -- 15.736479
Chain 2 -- -2054.596773 -- 15.736479
Chain 3 -- -2059.225334 -- 18.267482
Chain 3 -- -2059.225338 -- 18.267482
Chain 4 -- -2058.185520 -- 16.151268
Chain 4 -- -2058.185524 -- 16.151268
Analysis completed in 5 mins 44 seconds
Analysis used 343.60 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -2046.03
Likelihood of best state for "cold" chain of run 2 was -2046.03
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
52.0 % ( 36 %) Dirichlet(Revmat{all})
67.5 % ( 50 %) Slider(Revmat{all})
25.7 % ( 19 %) Dirichlet(Pi{all})
27.2 % ( 29 %) Slider(Pi{all})
34.7 % ( 21 %) Multiplier(Alpha{1,2})
45.5 % ( 24 %) Multiplier(Alpha{3})
56.0 % ( 16 %) Slider(Pinvar{all})
8.7 % ( 10 %) ExtSPR(Tau{all},V{all})
2.3 % ( 8 %) ExtTBR(Tau{all},V{all})
9.8 % ( 12 %) NNI(Tau{all},V{all})
14.3 % ( 20 %) ParsSPR(Tau{all},V{all})
26.2 % ( 25 %) Multiplier(V{all})
34.2 % ( 38 %) Nodeslider(V{all})
25.6 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
52.1 % ( 33 %) Dirichlet(Revmat{all})
66.0 % ( 52 %) Slider(Revmat{all})
26.0 % ( 27 %) Dirichlet(Pi{all})
27.3 % ( 23 %) Slider(Pi{all})
34.7 % ( 25 %) Multiplier(Alpha{1,2})
46.0 % ( 23 %) Multiplier(Alpha{3})
55.6 % ( 42 %) Slider(Pinvar{all})
8.7 % ( 13 %) ExtSPR(Tau{all},V{all})
2.3 % ( 2 %) ExtTBR(Tau{all},V{all})
9.9 % ( 12 %) NNI(Tau{all},V{all})
14.4 % ( 13 %) ParsSPR(Tau{all},V{all})
26.3 % ( 29 %) Multiplier(V{all})
34.2 % ( 34 %) Nodeslider(V{all})
25.7 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.65 0.52
2 | 165923 0.83 0.68
3 | 167232 166917 0.84
4 | 166947 166414 166567
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.65 0.51
2 | 166879 0.83 0.67
3 | 166239 166827 0.84
4 | 166424 166924 166707
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -2054.02
| 2 1 1|
| 1 2 |
| 1 2 |
|2 2 1 1 2 11 |
| 1 2*2 2 1 1 1 1 11 2 2 |
| 1 2 12 2 *112 212 1 2 1 1 |
| * 21 2 1* * 1 12 2 22 1 221 21 2 |
| 1 12 1 1 1 1 2 1 2 2 1 21 2 |
| 2 2 1 2 1 1 22 2|
| 2 1 1 2 |
| 2 1 2 2 1 2 1 |
|1 2 1 21 1 2 1 2 1 |
| 2 1 2 |
| 12 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2057.87
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2051.99 -2064.76
2 -2051.93 -2065.32
--------------------------------------
TOTAL -2051.96 -2065.08
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.624931 0.007924 0.468754 0.811508 0.617244 1277.15 1389.08 1.000
r(A<->C){all} 0.173457 0.001248 0.108964 0.242416 0.171935 896.39 949.45 1.000
r(A<->G){all} 0.216278 0.001805 0.135484 0.301119 0.213160 926.45 1086.97 1.000
r(A<->T){all} 0.115345 0.001702 0.038856 0.195234 0.112325 724.99 766.11 1.000
r(C<->G){all} 0.086550 0.000461 0.044450 0.127274 0.085082 1061.47 1096.41 1.000
r(C<->T){all} 0.290430 0.002433 0.195889 0.382359 0.287095 863.67 881.71 1.000
r(G<->T){all} 0.117941 0.001145 0.055895 0.185885 0.115437 858.90 947.12 1.001
pi(A){all} 0.210129 0.000211 0.183291 0.239217 0.209791 948.26 1077.01 1.000
pi(C){all} 0.335873 0.000261 0.306860 0.369988 0.335670 1299.01 1327.29 1.000
pi(G){all} 0.278728 0.000237 0.248555 0.307870 0.278633 1126.76 1196.18 1.000
pi(T){all} 0.175270 0.000179 0.148824 0.200635 0.175173 991.34 994.98 1.000
alpha{1,2} 0.178047 0.002400 0.089423 0.287474 0.175109 1132.01 1133.32 1.000
alpha{3} 2.072347 0.611477 0.764466 3.656266 1.947823 1258.38 1367.97 1.000
pinvar{all} 0.355198 0.008805 0.154051 0.517182 0.368988 1004.61 1067.87 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
Key to taxon bipartitions (saved to file "/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-------------
1 -- .******
2 -- .*.....
3 -- ..*....
4 -- ...*...
5 -- ....*..
6 -- .....*.
7 -- ......*
8 -- .....**
9 -- .**....
10 -- ...****
11 -- ...**..
12 -- ....***
-------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
8 3002 1.000000 0.000000 1.000000 1.000000 2
9 3002 1.000000 0.000000 1.000000 1.000000 2
10 2998 0.998668 0.001884 0.997335 1.000000 2
11 1962 0.653564 0.008480 0.647568 0.659560 2
12 812 0.270486 0.006595 0.265823 0.275150 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.020189 0.000063 0.005701 0.034690 0.019001 1.000 2
length{all}[2] 0.022764 0.000058 0.009525 0.038021 0.022073 1.000 2
length{all}[3] 0.016926 0.000044 0.004553 0.029230 0.016085 1.000 2
length{all}[4] 0.059234 0.000220 0.031017 0.087929 0.057770 1.000 2
length{all}[5] 0.043408 0.000159 0.021107 0.068722 0.042198 1.000 2
length{all}[6] 0.123899 0.001132 0.064310 0.190409 0.119953 1.000 2
length{all}[7] 0.160824 0.001510 0.091731 0.237363 0.157007 1.000 2
length{all}[8] 0.107725 0.000966 0.049245 0.167648 0.105254 1.000 2
length{all}[9] 0.019704 0.000062 0.005853 0.034860 0.018613 1.001 2
length{all}[10] 0.037105 0.000195 0.010265 0.064756 0.035427 1.000 2
length{all}[11] 0.015270 0.000093 0.000007 0.033586 0.013899 1.000 2
length{all}[12] 0.010070 0.000049 0.000039 0.022620 0.008552 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.003392
Maximum standard deviation of split frequencies = 0.008480
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------ C2 (2)
|----------------------100----------------------+
| \------------------------ C3 (3)
+
| /------------------------ C4 (4)
| /-----------65----------+
| | \------------------------ C5 (5)
\----------100----------+
| /------------------------ C6 (6)
\----------100----------+
\------------------------ C7 (7)
Phylogram (based on average branch lengths):
/----- C1 (1)
|
| /----- C2 (2)
|----+
| \--- C3 (3)
+
| /-------------- C4 (4)
| /--+
| | \---------- C5 (5)
\--------+
| /----------------------------- C6 (6)
\------------------------+
\-------------------------------------- C7 (7)
|-----------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (4 trees sampled):
90 % credible set contains 2 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 7 ls = 759
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Sites with gaps or missing data are removed.
63 ambiguity characters in seq. 1
63 ambiguity characters in seq. 2
63 ambiguity characters in seq. 3
60 ambiguity characters in seq. 4
75 ambiguity characters in seq. 5
48 ambiguity characters in seq. 6
84 ambiguity characters in seq. 7
33 sites are removed. 17 18 25 26 27 28 29 203 204 205 222 223 224 225 226 227 228 233 234 235 236 242 243 244 245 246 247 248 249 250 251 252 253
Sequences read..
Counting site patterns.. 0:00
154 patterns at 220 / 220 sites (100.0%), 0:00
Counting codons..
168 bytes for distance
150304 bytes for conP
20944 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (2, 3), ((4, 5), (6, 7))); MP score: 179
375760 bytes for conP, adjusted
0.036670 0.035527 0.034351 0.045947 0.047142 0.019296 0.069193 0.082489 0.159807 0.187672 0.225280 0.300000 1.300000
ntime & nrate & np: 11 2 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 13
lnL0 = -1997.857002
Iterating by ming2
Initial: fx= 1997.857002
x= 0.03667 0.03553 0.03435 0.04595 0.04714 0.01930 0.06919 0.08249 0.15981 0.18767 0.22528 0.30000 1.30000
1 h-m-p 0.0000 0.0011 238.5977 +++YYYC 1985.323710 3 0.0006 24 | 0/13
2 h-m-p 0.0004 0.0023 355.5161 +YYC 1956.849127 2 0.0014 43 | 0/13
3 h-m-p 0.0002 0.0008 574.6021 +YYYYCCCCC 1928.180660 8 0.0006 72 | 0/13
4 h-m-p 0.0000 0.0001 2290.7305 +CYCCC 1911.969788 4 0.0001 96 | 0/13
5 h-m-p 0.0000 0.0002 442.8047 ++ 1904.023842 m 0.0002 112 | 0/13
6 h-m-p 0.0000 0.0000 1082.2478
h-m-p: 8.25823445e-20 4.12911723e-19 1.08224778e+03 1904.023842
.. | 0/13
7 h-m-p 0.0000 0.0009 1188.1176 +CCCCC 1895.066886 4 0.0000 150 | 0/13
8 h-m-p 0.0002 0.0008 244.5914 +YYCCCC 1876.219053 5 0.0006 175 | 0/13
9 h-m-p 0.0001 0.0004 248.6414 +YYCCCC 1871.065726 5 0.0002 200 | 0/13
10 h-m-p 0.0001 0.0003 601.7925 +YYCYCCC 1851.118800 6 0.0003 226 | 0/13
11 h-m-p 0.0000 0.0000 6941.2766 ++ 1837.449192 m 0.0000 242 | 0/13
12 h-m-p 0.0000 0.0000 622.2971
h-m-p: 1.44495716e-20 7.22478580e-20 6.22297132e+02 1837.449192
.. | 0/13
13 h-m-p 0.0000 0.0010 2884.5246 YYCCCC 1823.267866 5 0.0000 279 | 0/13
14 h-m-p 0.0002 0.0009 229.2901 YCCCCC 1813.000754 5 0.0005 304 | 0/13
15 h-m-p 0.0001 0.0007 235.5122 CYCCCC 1808.070280 5 0.0002 329 | 0/13
16 h-m-p 0.0002 0.0011 56.4767 YYYC 1807.764078 3 0.0002 348 | 0/13
17 h-m-p 0.0005 0.0076 22.9128 CC 1807.610916 1 0.0007 366 | 0/13
18 h-m-p 0.0005 0.0189 29.2772 YCC 1807.540198 2 0.0003 385 | 0/13
19 h-m-p 0.0014 0.0218 7.4004 YC 1807.523862 1 0.0007 402 | 0/13
20 h-m-p 0.0009 0.0117 5.7522 YC 1807.518300 1 0.0004 419 | 0/13
21 h-m-p 0.0009 0.0800 2.8366 CC 1807.511810 1 0.0012 437 | 0/13
22 h-m-p 0.0007 0.0365 5.2712 YC 1807.506883 1 0.0005 454 | 0/13
23 h-m-p 0.0009 0.0871 2.8323 +YCC 1807.447999 2 0.0066 474 | 0/13
24 h-m-p 0.0006 0.0348 33.2280 ++YCC 1806.763473 2 0.0064 495 | 0/13
25 h-m-p 0.0264 0.1322 2.0228 CCC 1806.665958 2 0.0095 515 | 0/13
26 h-m-p 0.0025 0.0579 7.7900 +YCCCC 1805.659504 4 0.0200 539 | 0/13
27 h-m-p 1.3912 8.0000 0.1120 YC 1805.475873 1 0.6991 556 | 0/13
28 h-m-p 1.6000 8.0000 0.0098 YC 1805.459534 1 0.8377 586 | 0/13
29 h-m-p 1.6000 8.0000 0.0016 CC 1805.455568 1 1.4000 617 | 0/13
30 h-m-p 1.6000 8.0000 0.0005 ++ 1805.442959 m 8.0000 646 | 0/13
31 h-m-p 0.8314 8.0000 0.0051 CC 1805.437961 1 1.2529 677 | 0/13
32 h-m-p 1.6000 8.0000 0.0031 YC 1805.437472 1 0.9763 707 | 0/13
33 h-m-p 1.6000 8.0000 0.0003 Y 1805.437462 0 0.9895 736 | 0/13
34 h-m-p 1.6000 8.0000 0.0000 Y 1805.437461 0 1.0715 765 | 0/13
35 h-m-p 1.6000 8.0000 0.0000 Y 1805.437461 0 0.9034 794 | 0/13
36 h-m-p 1.6000 8.0000 0.0000 Y 1805.437461 0 1.2032 823 | 0/13
37 h-m-p 1.6000 8.0000 0.0000 Y 1805.437461 0 1.6000 852 | 0/13
38 h-m-p 1.6000 8.0000 0.0000 C 1805.437461 0 1.3902 881 | 0/13
39 h-m-p 1.6000 8.0000 0.0000 ------Y 1805.437461 0 0.0001 916
Out..
lnL = -1805.437461
917 lfun, 917 eigenQcodon, 10087 P(t)
Time used: 0:04
Model 1: NearlyNeutral
TREE # 1
(1, (2, 3), ((4, 5), (6, 7))); MP score: 179
0.036670 0.035527 0.034351 0.045947 0.047142 0.019296 0.069193 0.082489 0.159807 0.187672 0.225280 1.303627 0.534390 0.193110
ntime & nrate & np: 11 2 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.165379
np = 14
lnL0 = -1856.972016
Iterating by ming2
Initial: fx= 1856.972016
x= 0.03667 0.03553 0.03435 0.04595 0.04714 0.01930 0.06919 0.08249 0.15981 0.18767 0.22528 1.30363 0.53439 0.19311
1 h-m-p 0.0000 0.0016 253.4245 +++YCYYCCC 1828.630208 6 0.0013 32 | 0/14
2 h-m-p 0.0000 0.0002 307.6590 YCYCCC 1825.009258 5 0.0001 57 | 0/14
3 h-m-p 0.0002 0.0015 209.1402 +CCCCC 1814.012517 4 0.0008 83 | 0/14
4 h-m-p 0.0001 0.0007 103.2310 YCYCCC 1812.825889 5 0.0003 108 | 0/14
5 h-m-p 0.0008 0.0049 40.2777 CCCC 1812.060688 3 0.0012 131 | 0/14
6 h-m-p 0.0009 0.0043 30.7214 YYYC 1811.798480 3 0.0008 151 | 0/14
7 h-m-p 0.0024 0.0141 10.5510 YC 1811.734807 1 0.0011 169 | 0/14
8 h-m-p 0.0028 0.0856 4.3442 +YCC 1811.593328 2 0.0071 190 | 0/14
9 h-m-p 0.0027 0.0180 11.6387 CCCC 1811.349730 3 0.0038 213 | 0/14
10 h-m-p 0.0013 0.0410 33.3207 +YCCC 1809.448505 3 0.0095 236 | 0/14
11 h-m-p 0.0018 0.0092 145.8478 CCCC 1807.145392 3 0.0026 259 | 0/14
12 h-m-p 0.0016 0.0081 129.0930 CCCC 1805.779458 3 0.0016 282 | 0/14
13 h-m-p 0.0030 0.0150 20.8256 YC 1805.552188 1 0.0014 300 | 0/14
14 h-m-p 0.0141 0.0899 2.1114 +CYYCCC 1795.287454 5 0.0712 327 | 0/14
15 h-m-p 0.0016 0.0079 21.8699 CYC 1794.918047 2 0.0014 347 | 0/14
16 h-m-p 0.0234 1.0698 1.3368 ++YCYCCCC 1788.179464 6 0.5041 376 | 0/14
17 h-m-p 0.3841 1.9206 0.8011 YYCC 1787.217451 3 0.2906 397 | 0/14
18 h-m-p 0.9522 4.7612 0.0402 YCC 1787.098983 2 0.6502 431 | 0/14
19 h-m-p 1.6000 8.0000 0.0094 CC 1787.078261 1 0.5305 464 | 0/14
20 h-m-p 0.3808 8.0000 0.0132 YC 1787.074156 1 0.6157 496 | 0/14
21 h-m-p 1.6000 8.0000 0.0028 C 1787.073857 0 0.5273 527 | 0/14
22 h-m-p 1.6000 8.0000 0.0005 C 1787.073824 0 0.6136 558 | 0/14
23 h-m-p 1.4176 8.0000 0.0002 Y 1787.073819 0 0.6884 589 | 0/14
24 h-m-p 1.6000 8.0000 0.0001 C 1787.073819 0 0.4032 620 | 0/14
25 h-m-p 1.5621 8.0000 0.0000 Y 1787.073819 0 0.6864 651 | 0/14
26 h-m-p 1.6000 8.0000 0.0000 Y 1787.073819 0 0.6682 682 | 0/14
27 h-m-p 1.6000 8.0000 0.0000 C 1787.073819 0 0.6203 713 | 0/14
28 h-m-p 1.6000 8.0000 0.0000 C 1787.073819 0 0.4000 744 | 0/14
29 h-m-p 1.3338 8.0000 0.0000 Y 1787.073819 0 0.3334 775 | 0/14
30 h-m-p 0.4673 8.0000 0.0000 --------------Y 1787.073819 0 0.0000 820
Out..
lnL = -1787.073819
821 lfun, 2463 eigenQcodon, 18062 P(t)
Time used: 0:11
Model 2: PositiveSelection
TREE # 1
(1, (2, 3), ((4, 5), (6, 7))); MP score: 179
initial w for M2:NSpselection reset.
0.036670 0.035527 0.034351 0.045947 0.047142 0.019296 0.069193 0.082489 0.159807 0.187672 0.225280 1.318050 1.131355 0.291249 0.418683 2.981222
ntime & nrate & np: 11 3 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.214248
np = 16
lnL0 = -1896.304025
Iterating by ming2
Initial: fx= 1896.304025
x= 0.03667 0.03553 0.03435 0.04595 0.04714 0.01930 0.06919 0.08249 0.15981 0.18767 0.22528 1.31805 1.13136 0.29125 0.41868 2.98122
1 h-m-p 0.0000 0.0050 241.2945 +++CYYCC 1888.815095 4 0.0004 31 | 0/16
2 h-m-p 0.0006 0.0030 160.7027 ++ 1836.496074 m 0.0030 50 | 0/16
3 h-m-p 0.0015 0.0074 68.6792 +YCYC 1830.246270 3 0.0042 74 | 0/16
4 h-m-p 0.0005 0.0025 324.4466 CYC 1825.859619 2 0.0006 96 | 0/16
5 h-m-p 0.0015 0.0073 110.1840 YCCCCC 1819.115017 5 0.0029 124 | 0/16
6 h-m-p 0.0035 0.0174 72.4029 CC 1814.004296 1 0.0048 145 | 0/16
7 h-m-p 0.0013 0.0064 77.0197 CCCC 1812.084594 3 0.0019 170 | 0/16
8 h-m-p 0.0025 0.0125 44.1853 YCCC 1811.666635 3 0.0010 194 | 0/16
9 h-m-p 0.0023 0.0117 16.4158 YCC 1811.495460 2 0.0016 216 | 0/16
10 h-m-p 0.0022 0.0675 11.7554 +CCCCC 1810.571235 4 0.0127 244 | 0/16
11 h-m-p 0.0036 0.0179 22.7235 CYC 1810.143364 2 0.0033 266 | 0/16
12 h-m-p 0.0035 0.1099 21.6781 ++YYYYYCCCCC 1800.551851 9 0.0565 300 | 0/16
13 h-m-p 0.0069 0.0343 12.6680 YC 1800.349442 1 0.0034 320 | 0/16
14 h-m-p 0.0028 0.0178 15.3331 CCC 1800.153265 2 0.0029 343 | 0/16
15 h-m-p 0.0027 0.1201 16.8286 ++YYCCC 1797.737605 4 0.0319 370 | 0/16
16 h-m-p 0.2982 1.4909 1.6140 CCCC 1794.178083 3 0.4002 395 | 0/16
17 h-m-p 0.0793 0.3966 1.2236 YCYCCC 1791.484513 5 0.1758 422 | 0/16
18 h-m-p 0.2593 2.4120 0.8298 YCCCC 1789.919787 4 0.5181 448 | 0/16
19 h-m-p 0.3447 1.7234 0.7044 CCC 1789.059543 2 0.3305 487 | 0/16
20 h-m-p 0.5187 2.5934 0.3127 YYCC 1788.695985 3 0.4052 526 | 0/16
21 h-m-p 0.4884 2.7613 0.2594 CCCC 1788.363660 3 0.5775 567 | 0/16
22 h-m-p 0.3183 3.3062 0.4707 CCCC 1788.145918 3 0.3793 608 | 0/16
23 h-m-p 0.4683 6.4453 0.3812 +YCC 1787.716362 2 1.5251 647 | 0/16
24 h-m-p 0.3273 1.6364 1.0289 YCCC 1787.294549 3 0.6730 687 | 0/16
25 h-m-p 0.3975 1.9874 0.4846 YCCC 1787.050296 3 0.9448 711 | 0/16
26 h-m-p 1.6000 8.0000 0.1254 CC 1787.013508 1 0.5627 748 | 0/16
27 h-m-p 1.6000 8.0000 0.0355 YC 1786.998656 1 0.8674 784 | 0/16
28 h-m-p 1.1077 8.0000 0.0278 YC 1786.995342 1 0.4953 820 | 0/16
29 h-m-p 0.3390 8.0000 0.0406 YC 1786.991821 1 0.8084 856 | 0/16
30 h-m-p 1.6000 8.0000 0.0202 YC 1786.991394 1 0.6537 892 | 0/16
31 h-m-p 1.4515 8.0000 0.0091 YC 1786.991109 1 0.9415 928 | 0/16
32 h-m-p 1.0923 8.0000 0.0078 CC 1786.990948 1 1.7178 965 | 0/16
33 h-m-p 0.6148 8.0000 0.0219 +YC 1786.990300 1 3.8777 1002 | 0/16
34 h-m-p 0.7233 8.0000 0.1173 +CCC 1786.986938 2 3.2112 1042 | 0/16
35 h-m-p 1.6000 8.0000 0.2231 YYC 1786.984643 2 1.2510 1079 | 0/16
36 h-m-p 1.6000 8.0000 0.0285 YC 1786.983441 1 0.7856 1115 | 0/16
37 h-m-p 0.1028 8.0000 0.2180 +YC 1786.982468 1 0.8607 1152 | 0/16
38 h-m-p 0.9174 8.0000 0.2045 CCC 1786.981602 2 1.0842 1191 | 0/16
39 h-m-p 1.6000 8.0000 0.0406 YC 1786.981054 1 1.0631 1227 | 0/16
40 h-m-p 0.2362 8.0000 0.1827 +YC 1786.980584 1 0.9693 1264 | 0/16
41 h-m-p 1.4180 8.0000 0.1249 Y 1786.980357 0 1.4180 1299 | 0/16
42 h-m-p 1.6000 8.0000 0.0082 YC 1786.980194 1 0.8908 1335 | 0/16
43 h-m-p 0.0730 8.0000 0.1002 ++C 1786.980070 0 1.1682 1372 | 0/16
44 h-m-p 1.1938 8.0000 0.0981 Y 1786.979993 0 1.1938 1407 | 0/16
45 h-m-p 1.6000 8.0000 0.0057 Y 1786.979949 0 1.1766 1442 | 0/16
46 h-m-p 0.0822 8.0000 0.0822 ++Y 1786.979920 0 0.8902 1479 | 0/16
47 h-m-p 1.1752 8.0000 0.0623 Y 1786.979906 0 1.1752 1514 | 0/16
48 h-m-p 1.6000 8.0000 0.0158 C 1786.979897 0 1.4660 1549 | 0/16
49 h-m-p 0.8752 8.0000 0.0265 C 1786.979895 0 1.0935 1584 | 0/16
50 h-m-p 1.6000 8.0000 0.0087 Y 1786.979894 0 0.8549 1619 | 0/16
51 h-m-p 0.6139 8.0000 0.0121 C 1786.979894 0 0.6579 1654 | 0/16
52 h-m-p 1.6000 8.0000 0.0011 Y 1786.979894 0 0.9637 1689 | 0/16
53 h-m-p 1.6000 8.0000 0.0003 Y 1786.979894 0 0.8815 1724 | 0/16
54 h-m-p 1.6000 8.0000 0.0001 Y 1786.979894 0 1.6000 1759 | 0/16
55 h-m-p 1.6000 8.0000 0.0000 -------C 1786.979894 0 0.0000 1801
Out..
lnL = -1786.979894
1802 lfun, 7208 eigenQcodon, 59466 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1796.213123 S = -1711.561485 -75.798680
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 154 patterns 0:34
did 20 / 154 patterns 0:34
did 30 / 154 patterns 0:34
did 40 / 154 patterns 0:35
did 50 / 154 patterns 0:35
did 60 / 154 patterns 0:35
did 70 / 154 patterns 0:35
did 80 / 154 patterns 0:35
did 90 / 154 patterns 0:35
did 100 / 154 patterns 0:35
did 110 / 154 patterns 0:35
did 120 / 154 patterns 0:35
did 130 / 154 patterns 0:35
did 140 / 154 patterns 0:35
did 150 / 154 patterns 0:35
did 154 / 154 patterns 0:35
Time used: 0:35
Model 3: discrete
TREE # 1
(1, (2, 3), ((4, 5), (6, 7))); MP score: 179
0.036670 0.035527 0.034351 0.045947 0.047142 0.019296 0.069193 0.082489 0.159807 0.187672 0.225280 1.325973 0.960589 0.897086 0.048980 0.125996 0.171588
ntime & nrate & np: 11 4 17
Bounds (np=17):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 18.615860
np = 17
lnL0 = -1803.266175
Iterating by ming2
Initial: fx= 1803.266175
x= 0.03667 0.03553 0.03435 0.04595 0.04714 0.01930 0.06919 0.08249 0.15981 0.18767 0.22528 1.32597 0.96059 0.89709 0.04898 0.12600 0.17159
1 h-m-p 0.0000 0.0006 164.8143 ++YCCC 1799.692091 3 0.0003 29 | 0/17
2 h-m-p 0.0000 0.0002 135.6167 ++ 1797.596233 m 0.0002 49 | 1/17
3 h-m-p 0.0000 0.0003 1101.3886 +YCCC 1795.576084 3 0.0001 75 | 1/17
4 h-m-p 0.0008 0.0041 101.1293 YCCCCC 1792.282603 5 0.0016 104 | 1/17
5 h-m-p 0.0002 0.0012 165.0494 CCC 1791.608442 2 0.0003 128 | 1/17
6 h-m-p 0.0006 0.0029 52.5364 CCCCC 1791.152388 4 0.0007 156 | 0/17
7 h-m-p 0.0005 0.0047 79.6412 CCCC 1790.660560 3 0.0004 182 | 0/17
8 h-m-p 0.0006 0.0036 57.4601 YCC 1790.411882 2 0.0005 205 | 0/17
9 h-m-p 0.0010 0.0051 20.1160 YC 1790.349054 1 0.0005 226 | 0/17
10 h-m-p 0.0007 0.0118 15.1021 YC 1790.319414 1 0.0004 247 | 0/17
11 h-m-p 0.0010 0.0274 6.7485 CC 1790.303042 1 0.0009 269 | 0/17
12 h-m-p 0.0013 0.0346 4.9883 YC 1790.296075 1 0.0007 290 | 0/17
13 h-m-p 0.0010 0.4851 3.7625 +++CCC 1789.781991 2 0.0787 317 | 0/17
14 h-m-p 0.0012 0.0067 247.1811 CCCC 1789.157604 3 0.0014 343 | 0/17
15 h-m-p 0.0072 0.0360 20.8114 CC 1789.081728 1 0.0022 365 | 0/17
16 h-m-p 0.0148 0.6039 3.0484 +CCCC 1788.757712 3 0.0730 392 | 0/17
17 h-m-p 0.1346 0.6730 1.1127 CYCCC 1788.447919 4 0.2082 419 | 0/17
18 h-m-p 0.5804 2.9020 0.0618 YCCC 1788.082298 3 1.1029 444 | 0/17
19 h-m-p 0.1170 8.0000 0.5829 YCCC 1787.936766 3 0.2754 486 | 0/17
20 h-m-p 0.2906 3.8953 0.5524 +YCC 1787.613595 2 0.9965 527 | 0/17
21 h-m-p 0.2515 1.2575 0.2912 ++ 1787.092639 m 1.2575 564 | 1/17
22 h-m-p 0.3083 4.7679 1.1846 C 1787.063793 0 0.0853 601 | 1/17
23 h-m-p 0.4426 8.0000 0.2283 +YCC 1786.876948 2 1.1458 625 | 1/17
24 h-m-p 1.6000 8.0000 0.0392 YCC 1786.757840 2 2.6909 664 | 1/17
25 h-m-p 1.1774 8.0000 0.0896 +YC 1786.643490 1 3.0930 702 | 0/17
26 h-m-p 0.0017 0.0473 167.2634 YC 1786.627906 1 0.0003 739 | 0/17
27 h-m-p 0.8451 8.0000 0.0628 +YC 1786.541707 1 2.3918 761 | 0/17
28 h-m-p 1.4897 8.0000 0.1008 CC 1786.515539 1 1.2270 800 | 0/17
29 h-m-p 1.6000 8.0000 0.0438 CYC 1786.505841 2 1.4404 840 | 0/17
30 h-m-p 1.6000 8.0000 0.0175 CCC 1786.497535 2 2.3923 881 | 0/17
31 h-m-p 1.3915 8.0000 0.0301 YC 1786.491571 1 2.4081 919 | 0/17
32 h-m-p 1.3791 6.8955 0.0372 ++ 1786.472575 m 6.8955 956 | 1/17
33 h-m-p 1.6000 8.0000 0.1212 C 1786.463706 0 0.4000 993 | 1/17
34 h-m-p 0.7797 8.0000 0.0622 CC 1786.453127 1 0.9577 1031 | 1/17
35 h-m-p 1.6000 8.0000 0.0092 YC 1786.452841 1 0.9328 1068 | 1/17
36 h-m-p 1.1006 8.0000 0.0078 YC 1786.452814 1 0.5920 1105 | 1/17
37 h-m-p 1.6000 8.0000 0.0008 Y 1786.452812 0 0.9242 1141 | 1/17
38 h-m-p 1.6000 8.0000 0.0000 Y 1786.452812 0 1.0349 1177 | 1/17
39 h-m-p 1.6000 8.0000 0.0000 Y 1786.452812 0 1.0941 1213 | 1/17
40 h-m-p 1.6000 8.0000 0.0000 Y 1786.452812 0 1.6000 1249 | 1/17
41 h-m-p 1.6000 8.0000 0.0000 C 1786.452812 0 1.6757 1285 | 1/17
42 h-m-p 1.6000 8.0000 0.0000 ----C 1786.452812 0 0.0016 1325
Out..
lnL = -1786.452812
1326 lfun, 5304 eigenQcodon, 43758 P(t)
Time used: 0:52
Model 7: beta
TREE # 1
(1, (2, 3), ((4, 5), (6, 7))); MP score: 179
0.036670 0.035527 0.034351 0.045947 0.047142 0.019296 0.069193 0.082489 0.159807 0.187672 0.225280 1.325884 0.496071 1.323761
ntime & nrate & np: 11 1 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 12.651363
np = 14
lnL0 = -1812.482063
Iterating by ming2
Initial: fx= 1812.482063
x= 0.03667 0.03553 0.03435 0.04595 0.04714 0.01930 0.06919 0.08249 0.15981 0.18767 0.22528 1.32588 0.49607 1.32376
1 h-m-p 0.0000 0.0020 184.5842 ++YCYCC 1808.707595 4 0.0003 27 | 0/14
2 h-m-p 0.0005 0.0050 108.3208 +YYYYCYCCCC 1794.768802 10 0.0026 59 | 0/14
3 h-m-p 0.0002 0.0012 226.9858 YYYC 1793.020740 3 0.0002 79 | 0/14
4 h-m-p 0.0003 0.0015 87.2916 CCCCC 1792.153479 4 0.0004 104 | 0/14
5 h-m-p 0.0009 0.0043 29.6316 YCCC 1792.000759 3 0.0004 126 | 0/14
6 h-m-p 0.0009 0.0104 14.1816 CC 1791.933492 1 0.0008 145 | 0/14
7 h-m-p 0.0004 0.0103 28.5473 YC 1791.787291 1 0.0010 163 | 0/14
8 h-m-p 0.0008 0.0135 38.4996 YC 1791.557604 1 0.0014 181 | 0/14
9 h-m-p 0.0012 0.0140 44.5190 YCCC 1791.041490 3 0.0028 203 | 0/14
10 h-m-p 0.0011 0.0057 108.6197 CYC 1790.590427 2 0.0011 223 | 0/14
11 h-m-p 0.0009 0.0058 133.1328 YYC 1790.222251 2 0.0007 242 | 0/14
12 h-m-p 0.0018 0.0129 54.0462 YCCC 1790.010454 3 0.0011 264 | 0/14
13 h-m-p 0.0387 0.3236 1.5217 CC 1789.997442 1 0.0084 283 | 0/14
14 h-m-p 0.0026 0.2812 4.9011 +CCC 1789.917891 2 0.0166 305 | 0/14
15 h-m-p 0.5416 2.7082 0.0892 CCCC 1789.399895 3 0.8267 328 | 0/14
16 h-m-p 1.0914 8.0000 0.0676 CCC 1789.292811 2 1.7291 363 | 0/14
17 h-m-p 1.0372 8.0000 0.1127 YCCC 1789.191416 3 2.5046 399 | 0/14
18 h-m-p 1.6000 8.0000 0.0510 YC 1789.170165 1 1.0069 431 | 0/14
19 h-m-p 1.6000 8.0000 0.0169 YC 1789.169552 1 0.8234 463 | 0/14
20 h-m-p 1.6000 8.0000 0.0027 Y 1789.169534 0 0.7753 494 | 0/14
21 h-m-p 1.6000 8.0000 0.0001 Y 1789.169534 0 0.7866 525 | 0/14
22 h-m-p 1.6000 8.0000 0.0000 Y 1789.169534 0 0.7467 556 | 0/14
23 h-m-p 1.6000 8.0000 0.0000 Y 1789.169534 0 0.8753 587 | 0/14
24 h-m-p 1.6000 8.0000 0.0000 C 1789.169534 0 1.6000 618 | 0/14
25 h-m-p 1.6000 8.0000 0.0000 ---------------Y 1789.169534 0 0.0000 664
Out..
lnL = -1789.169534
665 lfun, 7315 eigenQcodon, 73150 P(t)
Time used: 1:20
Model 8: beta&w>1
TREE # 1
(1, (2, 3), ((4, 5), (6, 7))); MP score: 179
initial w for M8:NSbetaw>1 reset.
0.036670 0.035527 0.034351 0.045947 0.047142 0.019296 0.069193 0.082489 0.159807 0.187672 0.225280 1.307835 0.900000 0.225525 1.016293 2.374037
ntime & nrate & np: 11 2 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 10.251402
np = 16
lnL0 = -1817.423318
Iterating by ming2
Initial: fx= 1817.423318
x= 0.03667 0.03553 0.03435 0.04595 0.04714 0.01930 0.06919 0.08249 0.15981 0.18767 0.22528 1.30784 0.90000 0.22553 1.01629 2.37404
1 h-m-p 0.0000 0.0004 356.4340 +++ 1795.811410 m 0.0004 22 | 0/16
2 h-m-p 0.0000 0.0000 92.5362
h-m-p: 0.00000000e+00 0.00000000e+00 9.25361671e+01 1795.811410
.. | 0/16
3 h-m-p 0.0000 0.0011 152.1797 ++YCCCC 1792.025443 4 0.0003 66 | 0/16
4 h-m-p 0.0001 0.0003 157.7216 +CYC 1789.970814 2 0.0002 89 | 0/16
5 h-m-p 0.0005 0.0027 59.5391 YCC 1789.416476 2 0.0004 111 | 0/16
6 h-m-p 0.0006 0.0033 38.0198 YC 1789.278219 1 0.0003 131 | 0/16
7 h-m-p 0.0012 0.0168 8.6576 YC 1789.250563 1 0.0008 151 | 0/16
8 h-m-p 0.0005 0.0163 14.8504 CC 1789.224188 1 0.0006 172 | 0/16
9 h-m-p 0.0010 0.0177 8.5582 YC 1789.216385 1 0.0004 192 | 0/16
10 h-m-p 0.0006 0.0370 6.4763 CC 1789.208935 1 0.0007 213 | 0/16
11 h-m-p 0.0005 0.2606 9.8207 +YC 1789.151998 1 0.0044 234 | 0/16
12 h-m-p 0.0008 0.0096 54.5430 YC 1789.107436 1 0.0006 254 | 0/16
13 h-m-p 0.0008 0.0544 41.3486 +YCC 1788.828471 2 0.0053 277 | 0/16
14 h-m-p 0.0012 0.0115 179.7466 CC 1788.562046 1 0.0012 298 | 0/16
15 h-m-p 0.0201 0.1004 4.5244 -YC 1788.551351 1 0.0023 319 | 0/16
16 h-m-p 0.0033 0.0728 3.2456 CC 1788.547943 1 0.0013 340 | 0/16
17 h-m-p 0.0010 0.4800 3.9710 ++YCCC 1788.448774 3 0.0315 366 | 0/16
18 h-m-p 0.1432 1.9080 0.8737 +CC 1787.877089 1 0.6950 388 | 0/16
19 h-m-p 1.3594 6.7968 0.3995 CCC 1787.413168 2 2.1275 427 | 0/16
20 h-m-p 1.6000 8.0000 0.3644 CCC 1787.195811 2 1.5351 466 | 0/16
21 h-m-p 0.6541 3.2706 0.6411 YCCC 1786.998808 3 1.1902 506 | 0/16
22 h-m-p 1.5245 8.0000 0.5005 YCCC 1786.737024 3 3.4330 546 | 0/16
23 h-m-p 1.3000 6.5001 0.6568 CCC 1786.636570 2 1.8573 585 | 0/16
24 h-m-p 1.6000 8.0000 0.6254 CYC 1786.597049 2 1.8037 623 | 0/16
25 h-m-p 1.3327 8.0000 0.8465 CC 1786.568125 1 1.8333 660 | 0/16
26 h-m-p 1.6000 8.0000 0.5292 CYC 1786.561484 2 1.8601 698 | 0/16
27 h-m-p 1.6000 8.0000 0.2869 C 1786.560448 0 1.6000 733 | 0/16
28 h-m-p 1.6000 8.0000 0.0665 C 1786.560338 0 1.9068 768 | 0/16
29 h-m-p 1.6000 8.0000 0.0076 ++ 1786.560007 m 8.0000 803 | 0/16
30 h-m-p 0.6674 8.0000 0.0913 YC 1786.559756 1 1.4601 839 | 0/16
31 h-m-p 1.6000 8.0000 0.0500 Y 1786.559737 0 1.2238 874 | 0/16
32 h-m-p 1.6000 8.0000 0.0017 Y 1786.559737 0 1.0023 909 | 0/16
33 h-m-p 1.6000 8.0000 0.0001 Y 1786.559737 0 1.1050 944 | 0/16
34 h-m-p 1.6000 8.0000 0.0000 C 1786.559737 0 1.5000 979 | 0/16
35 h-m-p 1.6000 8.0000 0.0000 ------Y 1786.559737 0 0.0001 1020
Out..
lnL = -1786.559737
1021 lfun, 12252 eigenQcodon, 123541 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1796.316173 S = -1711.556449 -76.646791
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 154 patterns 2:07
did 20 / 154 patterns 2:07
did 30 / 154 patterns 2:08
did 40 / 154 patterns 2:08
did 50 / 154 patterns 2:08
did 60 / 154 patterns 2:08
did 70 / 154 patterns 2:08
did 80 / 154 patterns 2:09
did 90 / 154 patterns 2:09
did 100 / 154 patterns 2:09
did 110 / 154 patterns 2:09
did 120 / 154 patterns 2:09
did 130 / 154 patterns 2:10
did 140 / 154 patterns 2:10
did 150 / 154 patterns 2:10
did 154 / 154 patterns 2:10
Time used: 2:10
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=253
D_melanogaster_PGRP-LB-PC MTALGLVLLSMMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVEHF
D_sechellia_PGRP-LB-PC MTALGLVLLSIMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVDHF
D_simulans_PGRP-LB-PC MTALGLVLLSMMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVEHF
D_yakuba_PGRP-LB-PC MTALGLILLSMMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVDHF
D_erecta_PGRP-LB-PC MTALGLVLLSMMGYSQHMQQANLG-----TARLLSRSDWGARLPKSVEHF
D_elegans_PGRP-LB-PC MTALGLVLLSMMGYSQHMQHANLGD-GAATARLLSRSDWGARLPKSVEHF
D_takahashii_PGRP-LB-PC MTALGLVLLSMMGYSQ--PAVNLGESGVANARLLSRSDWGARLPKSVEHF
******:***:***** .*** .*****************:**
D_melanogaster_PGRP-LB-PC QGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
D_sechellia_PGRP-LB-PC QGPAPYVIIHHSYMPAVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGI
D_simulans_PGRP-LB-PC QGPAPYVIIHHSYMPAVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGI
D_yakuba_PGRP-LB-PC QGPAPYVIIHHSYMPGVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGI
D_erecta_PGRP-LB-PC QGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
D_elegans_PGRP-LB-PC EGPAPYVIIHHSYMPAVCYTTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
D_takahashii_PGRP-LB-PC QGPAPYVIIHHSYMPGVCYTTPDCMKSMRDMQDFHQLERGWNDIGYSFGI
:**************.***:**:***************************
D_melanogaster_PGRP-LB-PC GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
D_sechellia_PGRP-LB-PC GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
D_simulans_PGRP-LB-PC GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
D_yakuba_PGRP-LB-PC GGDGMIYTGRGFNVVGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAARN
D_erecta_PGRP-LB-PC GGDGMIYAGRGFNVIGAHAPKYNDRSVGIVLIGDWRTELPPKQMLDAAKD
D_elegans_PGRP-LB-PC GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
D_takahashii_PGRP-LB-PC GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN
*******:******:*********:***********************::
D_melanogaster_PGRP-LB-PC LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHINDTE
D_sechellia_PGRP-LB-PC LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLNASD
D_simulans_PGRP-LB-PC LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLNATE
D_yakuba_PGRP-LB-PC LISFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLSETE
D_erecta_PGRP-LB-PC LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHINDTE
D_elegans_PGRP-LB-PC LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISGWPHFTHLNATE
D_takahashii_PGRP-LB-PC LISFGVFKGYIDPAYKLLGHRQVRDTECPGDRLFAEITGWPHFTLLNGTE
**:***************************.******:.***** :. ::
D_melanogaster_PGRP-LB-PC GV-SSTTAPVVPHVHPQAAAP---QKPHQSPP----AAPKVooooo----
D_sechellia_PGRP-LB-PC GE-SSTAAPVVPHVHAQAAAP---QTPHQSPP----AAPKVooooo----
D_simulans_PGRP-LB-PC GV-SSTAAPVVPHVHAQAAAP---QTPHQSPP----AAPKVooooo----
D_yakuba_PGRP-LB-PC GVVSSTAAPVEPHVHPKAATQ---TPLAQSPP----AAPKVoooo-----
D_erecta_PGRP-LB-PC GV-SSTKAPVEPHVHPQAATQ---QTPPKSPP----AAPKVooooooooo
D_elegans_PGRP-LB-PC GS---TPVPIEPHAHPQAASQTPPQSPPQSPPHAPAAAPKV---------
D_takahashii_PGRP-LB-PC TT---TSAPVEPHVHPQPVAP-------QSPP----AAPKVooooooooo
* .*: **.*.:..: :*** *****
D_melanogaster_PGRP-LB-PC ---
D_sechellia_PGRP-LB-PC ---
D_simulans_PGRP-LB-PC ---
D_yakuba_PGRP-LB-PC ---
D_erecta_PGRP-LB-PC ---
D_elegans_PGRP-LB-PC ---
D_takahashii_PGRP-LB-PC ooo
>D_melanogaster_PGRP-LB-PC ATGACAGCACTGGGATTAGTTCTGCTATCGATGATGGGCTATAGTCAGCA CATGCAGCAGGCGAATCTGGGCGAC---GGTGTGGCCACCGCCCGCCTGC TGTCCCGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGAGCACTTC CAGGGTCCCGCGCCCTACGTCATCATCCATCACTCGTACATGCCGGCCGT GTGCTACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACT TCCATCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATC GGCGGCGATGGCATGATTTACACCGGCAGGGGATTCAATGTCATCGGAGC TCATGCACCCAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAG ATTGGAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAAC CTGATCGCCTTTGGCGTTTTCAAGGGCTACATTGACCCTGCCTACAAGCT GCTGGGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTGT TCGCCGAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAA GGCGTC---AGCAGCACCACGGCGCCCGTCGTGCCCCACGTCCATCCACA GGCGGCAGCACCA---------CAAAAGCCGCACCAATCCCCGCCA---- --------GCTGCGCCCAAGGTC--------------------------- --------- >D_sechellia_PGRP-LB-PC ATGACAGCACTGGGATTAGTTCTGCTATCGATAATGGGCTATAGTCAGCA CATGCAGCAGGCGAATCTGGGCGAC---GGTGTGGCCACCGCCCGCCTGC TTTCCCGATCCGACTGGGGTGCCCGGCTGCCCAAGTCTGTGGACCACTTC CAGGGACCCGCGCCCTACGTCATCATCCACCACTCGTACATGCCGGCCGT GTGCTACTCCACTCCGGAATGCATGAAGAGCATGCGGGACATGCAGGACT TCCATCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATC GGCGGCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCATCGGAGC TCATGCACCCAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAG ATTGGAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAAC CTGATCGCCTTCGGAGTTTTCAAGGGCTACATTGACCCCGCCTACAAACT GCTGGGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGAGGCCGCCTCT TCGCCGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAACGCCAGCGAC GGCGAG---AGCAGCACTGCGGCGCCCGTCGTGCCCCATGTCCATGCACA GGCGGCAGCACCA---------CAAACGCCGCACCAATCCCCGCCA---- --------GCTGCGCCCAAGGTC--------------------------- --------- >D_simulans_PGRP-LB-PC ATGACAGCACTGGGATTAGTTCTGCTATCGATGATGGGCTATAGTCAGCA CATGCAGCAGGCGAATCTGGGCGAC---GGTGTGGCCACCGCCCGCCTGC TTTCCCGATCCGACTGGGGTGCACGGCTGCCCAAGTCCGTGGAGCACTTC CAGGGACCAGCGCCTTACGTCATCATCCACCACTCGTATATGCCGGCCGT GTGCTACTCAACTCCGGAATGCATGAAGAGCATGCGGGACATGCAGGACT TTCATCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATC GGCGGCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCATCGGAGC TCATGCACCGAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAG ATTGGAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAAC CTGATCGCCTTCGGCGTTTTCAAGGGCTACATTGACCCCGCCTACAAGCT GCTGGGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTCT TCGCCGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAACGCCACCGAA GGCGTG---AGCAGCACTGCGGCGCCCGTCGTGCCCCATGTCCATGCACA GGCGGCAGCACCA---------CAAACGCCGCACCAATCCCCGCCA---- --------GCTGCGCCCAAGGTC--------------------------- --------- >D_yakuba_PGRP-LB-PC ATGACAGCACTGGGATTAATTCTGCTATCGATGATGGGCTATAGTCAGCA CATGCAGCAGGCAAATCTGGGCGAT---GGTGTGGCCACCGCCCGACTGC TGTCCAGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGACCACTTT CAGGGACCCGCGCCCTACGTCATCATCCACCACTCGTACATGCCAGGCGT GTGCTACTCCACTCCGGAGTGCATGAAGAGCATGCGGGACATGCAGGACT TCCACCAGCTGGAGCGCGGATGGAACGATATCGGATATAGCTTTGGCATC GGCGGCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCGTCGGAGC TCATGCGCCGAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAG ATTGGAGAACTGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAGGAAC CTGATCTCCTTCGGGGTGTTCAAGGGCTACATTGACCCCGCCTACAAGCT GCTGGGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGAGGCCGCCTGT TTGCCGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAGCGAAACCGAA GGCGTAGTTAGCAGCACTGCTGCGCCCGTCGAGCCCCACGTCCATCCAAA GGCGGCAACACAA---------ACGCCACTCGCCCAATCCCCGCCA---- --------GCTGCGCCCAAGGTC--------------------------- --------- >D_erecta_PGRP-LB-PC ATGACAGCACTGGGATTAGTTCTGCTATCGATGATGGGCTATAGTCAGCA CATGCAGCAGGCGAATCTGGGC---------------ACCGCCCGGCTTC TGTCCCGATCCGACTGGGGTGCCCGCCTGCCCAAGTCCGTGGAGCACTTT CAAGGACCCGCGCCCTACGTGATCATCCACCACTCGTACATGCCAGCCGT GTGCTACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACT TCCACCAGCTGGAGCGCGGTTGGAACGATATCGGATATAGCTTTGGCATC GGCGGCGATGGCATGATCTACGCAGGCAGGGGATTCAATGTCATCGGAGC TCATGCGCCGAAGTACAATGACAGGAGCGTGGGCATCGTGCTGATCGGAG ATTGGAGAACTGAACTTCCGCCCAAGCAGATGCTGGATGCGGCCAAGGAC CTGATCGCCTTCGGGGTGTTCAAGGGCTACATTGACCCCGCCTACAAGCT GCTGGGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGGGGCCGCCTGT TTGCCGAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAA GGCGTT---AGCAGTACGAAGGCGCCGGTCGAGCCCCACGTCCATCCACA GGCGGCAACACAA---------CAAACGCCGCCCAAATCCCCGCCA---- --------GCTGCGCCCAAGGTC--------------------------- --------- >D_elegans_PGRP-LB-PC ATGACAGCACTGGGATTAGTTTTGCTATCAATGATGGGCTATAGCCAGCA CATGCAGCATGCGAATTTGGGCGAT---GGAGCGGCCACCGCTCGACTTC TGTCCCGCTCCGACTGGGGCGCCCGTCTGCCCAAGTCCGTGGAGCACTTC GAGGGTCCCGCCCCCTACGTGATCATCCACCACTCTTACATGCCGGCGGT GTGCTATACCACTCCCGACTGCATGAAGAGCATGCGCGACATGCAGGACT TCCACCAGCTGGAGCGCGGTTGGAACGACATCGGCTATAGCTTCGGCATC GGCGGCGATGGCATGATCTACACCGGAAGGGGATTCAACGTTATCGGAGC TCATGCACCCAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAG ATTGGAGAACTGAACTGCCGCCCAAACAGATGCTGGACGCGGCCAAAAAC CTGATCGCCTTCGGCGTGTTCAAGGGCTACATTGACCCCGCATACAAGCT GCTGGGCCACCGACAGGTTCGTGACACCGAGTGTCCCGGAGGCAGGCTGT TCGCGGAGATCTCCGGCTGGCCGCACTTTACCCACCTAAACGCCACCGAA GGCAGC---------ACCCCCGTCCCCATTGAACCGCACGCACATCCCCA GGCGGCGTCCCAAACGCCACCCCAATCACCACCCCAATCGCCACCCCATG CCCCGGCAGCTGCGCCCAAGGTC--------------------------- --------- >D_takahashii_PGRP-LB-PC ATGACAGCACTGGGATTAGTTTTGCTATCCATGATGGGCTATAGCCAG-- ----CCCGCTGTGAATCTGGGCGAATCTGGGGTGGCCAACGCTCGACTCC TGTCCCGCTCCGACTGGGGTGCCCGGCTGCCCAAATCCGTGGAGCACTTC CAGGGTCCCGCCCCCTACGTGATCATCCACCACTCATATATGCCCGGCGT TTGCTATACCACGCCGGACTGCATGAAGAGCATGCGCGACATGCAGGACT TCCACCAACTGGAGCGCGGCTGGAACGATATCGGCTATAGCTTTGGAATC GGCGGCGATGGGATGATCTACACCGGAAGGGGATTCAACGTTATCGGAGC TCATGCCCCTAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAG ATTGGAGAACTGAATTGCCTCCCAAACAGATGCTGGATGCGGCCAAGAAC CTGATCTCCTTTGGGGTCTTCAAGGGTTACATTGACCCCGCCTACAAGCT GCTGGGCCACAGACAGGTGCGGGACACCGAGTGTCCCGGGGACAGACTGT TCGCTGAGATCACCGGCTGGCCGCATTTCACCCTCCTAAACGGCACCGAG ACCACC---------ACTTCGGCACCCGTGGAACCCCACGTCCATCCACA GCCGGTGGCGCCC---------------------CAATCCCCGCCA---- --------GCTGCGCCCAAGGTC--------------------------- ---------
>D_melanogaster_PGRP-LB-PC MTALGLVLLSMMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVEHF QGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGI GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHINDTE GV-SSTTAPVVPHVHPQAAAP---QKPHQSPP----AAPKV >D_sechellia_PGRP-LB-PC MTALGLVLLSIMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVDHF QGPAPYVIIHHSYMPAVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGI GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLNASD GE-SSTAAPVVPHVHAQAAAP---QTPHQSPP----AAPKV >D_simulans_PGRP-LB-PC MTALGLVLLSMMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVEHF QGPAPYVIIHHSYMPAVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGI GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLNATE GV-SSTAAPVVPHVHAQAAAP---QTPHQSPP----AAPKV >D_yakuba_PGRP-LB-PC MTALGLILLSMMGYSQHMQQANLGD-GVATARLLSRSDWGARLPKSVDHF QGPAPYVIIHHSYMPGVCYSTPECMKSMRDMQDFHQLERGWNDIGYSFGI GGDGMIYTGRGFNVVGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAARN LISFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHLSETE GVVSSTAAPVEPHVHPKAATQ---TPLAQSPP----AAPKV >D_erecta_PGRP-LB-PC MTALGLVLLSMMGYSQHMQQANLG-----TARLLSRSDWGARLPKSVEHF QGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGI GGDGMIYAGRGFNVIGAHAPKYNDRSVGIVLIGDWRTELPPKQMLDAAKD LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHINDTE GV-SSTKAPVEPHVHPQAATQ---QTPPKSPP----AAPKV >D_elegans_PGRP-LB-PC MTALGLVLLSMMGYSQHMQHANLGD-GAATARLLSRSDWGARLPKSVEHF EGPAPYVIIHHSYMPAVCYTTPDCMKSMRDMQDFHQLERGWNDIGYSFGI GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISGWPHFTHLNATE GS---TPVPIEPHAHPQAASQTPPQSPPQSPPHAPAAAPKV >D_takahashii_PGRP-LB-PC MTALGLVLLSMMGYSQ--PAVNLGESGVANARLLSRSDWGARLPKSVEHF QGPAPYVIIHHSYMPGVCYTTPDCMKSMRDMQDFHQLERGWNDIGYSFGI GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN LISFGVFKGYIDPAYKLLGHRQVRDTECPGDRLFAEITGWPHFTLLNGTE TT---TSAPVEPHVHPQPVAP-------QSPP----AAPKV
#NEXUS
[ID: 6218355503]
begin taxa;
dimensions ntax=7;
taxlabels
D_melanogaster_PGRP-LB-PC
D_sechellia_PGRP-LB-PC
D_simulans_PGRP-LB-PC
D_yakuba_PGRP-LB-PC
D_erecta_PGRP-LB-PC
D_elegans_PGRP-LB-PC
D_takahashii_PGRP-LB-PC
;
end;
begin trees;
translate
1 D_melanogaster_PGRP-LB-PC,
2 D_sechellia_PGRP-LB-PC,
3 D_simulans_PGRP-LB-PC,
4 D_yakuba_PGRP-LB-PC,
5 D_erecta_PGRP-LB-PC,
6 D_elegans_PGRP-LB-PC,
7 D_takahashii_PGRP-LB-PC
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0190006,(2:0.02207274,3:0.01608539)1.000:0.01861347,((4:0.05776953,5:0.04219813)0.654:0.01389881,(6:0.1199527,7:0.1570066)1.000:0.1052536)0.999:0.03542667);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0190006,(2:0.02207274,3:0.01608539):0.01861347,((4:0.05776953,5:0.04219813):0.01389881,(6:0.1199527,7:0.1570066):0.1052536):0.03542667);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2051.99 -2064.76
2 -2051.93 -2065.32
--------------------------------------
TOTAL -2051.96 -2065.08
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.624931 0.007924 0.468754 0.811508 0.617244 1277.15 1389.08 1.000
r(A<->C){all} 0.173457 0.001248 0.108964 0.242416 0.171935 896.39 949.45 1.000
r(A<->G){all} 0.216278 0.001805 0.135484 0.301119 0.213160 926.45 1086.97 1.000
r(A<->T){all} 0.115345 0.001702 0.038856 0.195234 0.112325 724.99 766.11 1.000
r(C<->G){all} 0.086550 0.000461 0.044450 0.127274 0.085082 1061.47 1096.41 1.000
r(C<->T){all} 0.290430 0.002433 0.195889 0.382359 0.287095 863.67 881.71 1.000
r(G<->T){all} 0.117941 0.001145 0.055895 0.185885 0.115437 858.90 947.12 1.001
pi(A){all} 0.210129 0.000211 0.183291 0.239217 0.209791 948.26 1077.01 1.000
pi(C){all} 0.335873 0.000261 0.306860 0.369988 0.335670 1299.01 1327.29 1.000
pi(G){all} 0.278728 0.000237 0.248555 0.307870 0.278633 1126.76 1196.18 1.000
pi(T){all} 0.175270 0.000179 0.148824 0.200635 0.175173 991.34 994.98 1.000
alpha{1,2} 0.178047 0.002400 0.089423 0.287474 0.175109 1132.01 1133.32 1.000
alpha{3} 2.072347 0.611477 0.764466 3.656266 1.947823 1258.38 1367.97 1.000
pinvar{all} 0.355198 0.008805 0.154051 0.517182 0.368988 1004.61 1067.87 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/346/PGRP-LB-PC/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 7 ls = 220
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 2 3 4 4 1 | Ser TCT 0 1 0 0 0 1 | Tyr TAT 2 2 3 2 2 3 | Cys TGT 1 1 1 1 1 1
TTC 5 6 5 4 4 7 | TCC 6 5 5 7 6 5 | TAC 7 7 6 7 7 6 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 0 0 1 0 0 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 2 | TCG 2 2 2 2 2 1 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 1 1 0 2 1 | Pro CCT 2 1 2 1 1 0 | His CAT 4 4 4 2 2 3 | Arg CGT 0 0 0 0 0 2
CTC 0 1 1 0 0 0 | CCC 8 9 6 8 7 13 | CAC 6 6 6 8 8 8 | CGC 3 3 3 2 3 3
CTA 1 2 2 2 1 2 | CCA 3 2 3 3 3 1 | Gln CAA 1 1 1 2 2 2 | CGA 2 2 2 2 2 2
CTG 14 12 12 14 12 11 | CCG 5 5 6 5 6 4 | CAG 9 9 9 8 8 7 | CGG 3 3 3 3 3 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 2 3 2 1 2 | Thr ACT 1 2 2 3 2 2 | Asn AAT 3 3 3 3 3 2 | Ser AGT 1 1 1 1 1 0
ATC 7 9 8 9 10 10 | ACC 7 5 6 5 4 7 | AAC 3 3 3 2 2 4 | AGC 4 5 4 5 4 5
ATA 1 1 0 0 1 0 | ACA 1 1 1 2 2 1 | Lys AAA 0 1 0 0 1 2 | Arg AGA 1 1 1 2 1 1
Met ATG 9 8 9 9 9 9 | ACG 1 0 0 0 1 0 | AAG 9 8 9 9 9 7 | AGG 1 1 1 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 0 2 3 | Ala GCT 2 2 2 3 2 3 | Asp GAT 5 5 5 5 5 2 | Gly GGT 3 2 2 1 2 2
GTC 6 5 5 6 4 2 | GCC 7 8 7 5 7 5 | GAC 7 7 5 6 8 9 | GGC 14 12 14 13 12 15
GTA 0 0 0 1 0 0 | GCA 4 5 6 3 3 4 | Glu GAA 2 2 3 3 2 3 | GGA 5 8 6 8 6 6
GTG 6 6 7 6 7 6 | GCG 6 7 7 6 7 7 | GAG 4 4 4 5 5 5 | GGG 0 0 0 1 2 0
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------
Phe TTT 2 | Ser TCT 0 | Tyr TAT 4 | Cys TGT 1
TTC 6 | TCC 6 | TAC 5 | TGC 2
Leu TTA 1 | TCA 1 | *** TAA 0 | *** TGA 0
TTG 2 | TCG 1 | TAG 0 | Trp TGG 4
------------------------------------------------------
Leu CTT 0 | Pro CCT 2 | His CAT 3 | Arg CGT 0
CTC 2 | CCC 12 | CAC 6 | CGC 3
CTA 2 | CCA 2 | Gln CAA 2 | CGA 1
CTG 11 | CCG 4 | CAG 6 | CGG 2
------------------------------------------------------
Ile ATT 1 | Thr ACT 2 | Asn AAT 2 | Ser AGT 0
ATC 10 | ACC 8 | AAC 5 | AGC 4
ATA 0 | ACA 1 | Lys AAA 2 | Arg AGA 3
Met ATG 9 | ACG 1 | AAG 7 | AGG 1
------------------------------------------------------
Val GTT 3 | Ala GCT 5 | Asp GAT 4 | Gly GGT 3
GTC 3 | GCC 5 | GAC 8 | GGC 11
GTA 0 | GCA 2 | Glu GAA 2 | GGA 6
GTG 8 | GCG 3 | GAG 5 | GGG 3
------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_PGRP-LB-PC
position 1: T:0.15000 C:0.27727 A:0.24091 G:0.33182
position 2: T:0.26818 C:0.25000 A:0.28182 G:0.20000
position 3: T:0.15000 C:0.41818 A:0.10000 G:0.33182
Average T:0.18939 C:0.31515 A:0.20758 G:0.28788
#2: D_sechellia_PGRP-LB-PC
position 1: T:0.15000 C:0.27727 A:0.23182 G:0.34091
position 2: T:0.26364 C:0.25000 A:0.28182 G:0.20455
position 3: T:0.14091 C:0.42273 A:0.12273 G:0.31364
Average T:0.18485 C:0.31667 A:0.21212 G:0.28636
#3: D_simulans_PGRP-LB-PC
position 1: T:0.15000 C:0.27727 A:0.23182 G:0.34091
position 2: T:0.26818 C:0.25455 A:0.27727 G:0.20000
position 3: T:0.15455 C:0.39091 A:0.12273 G:0.33182
Average T:0.19091 C:0.30758 A:0.21061 G:0.29091
#4: D_yakuba_PGRP-LB-PC
position 1: T:0.15455 C:0.27273 A:0.24545 G:0.32727
position 2: T:0.26364 C:0.24091 A:0.28182 G:0.21364
position 3: T:0.12727 C:0.40455 A:0.13182 G:0.33636
Average T:0.18182 C:0.30606 A:0.21970 G:0.29242
#5: D_erecta_PGRP-LB-PC
position 1: T:0.15000 C:0.27273 A:0.24091 G:0.33636
position 2: T:0.26364 C:0.24091 A:0.29091 G:0.20455
position 3: T:0.13636 C:0.40000 A:0.11364 G:0.35000
Average T:0.18333 C:0.30455 A:0.21515 G:0.29697
#6: D_elegans_PGRP-LB-PC
position 1: T:0.15909 C:0.26818 A:0.24545 G:0.32727
position 2: T:0.25909 C:0.25000 A:0.28636 G:0.20455
position 3: T:0.12727 C:0.45909 A:0.11818 G:0.29545
Average T:0.18182 C:0.32576 A:0.21667 G:0.27576
#7: D_takahashii_PGRP-LB-PC
position 1: T:0.15909 C:0.26364 A:0.25455 G:0.32273
position 2: T:0.27273 C:0.25000 A:0.27727 G:0.20000
position 3: T:0.14545 C:0.43636 A:0.11364 G:0.30455
Average T:0.19242 C:0.31667 A:0.21515 G:0.27576
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 19 | Ser S TCT 2 | Tyr Y TAT 18 | Cys C TGT 7
TTC 37 | TCC 40 | TAC 45 | TGC 14
Leu L TTA 7 | TCA 3 | *** * TAA 0 | *** * TGA 0
TTG 4 | TCG 12 | TAG 0 | Trp W TGG 28
------------------------------------------------------------------------------
Leu L CTT 5 | Pro P CCT 9 | His H CAT 22 | Arg R CGT 2
CTC 4 | CCC 63 | CAC 48 | CGC 20
CTA 12 | CCA 17 | Gln Q CAA 11 | CGA 13
CTG 86 | CCG 35 | CAG 56 | CGG 17
------------------------------------------------------------------------------
Ile I ATT 15 | Thr T ACT 14 | Asn N AAT 19 | Ser S AGT 5
ATC 63 | ACC 42 | AAC 22 | AGC 31
ATA 3 | ACA 9 | Lys K AAA 6 | Arg R AGA 10
Met M ATG 62 | ACG 3 | AAG 58 | AGG 10
------------------------------------------------------------------------------
Val V GTT 14 | Ala A GCT 19 | Asp D GAT 31 | Gly G GGT 15
GTC 31 | GCC 44 | GAC 50 | GGC 91
GTA 1 | GCA 27 | Glu E GAA 17 | GGA 45
GTG 46 | GCG 43 | GAG 32 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15325 C:0.27273 A:0.24156 G:0.33247
position 2: T:0.26558 C:0.24805 A:0.28247 G:0.20390
position 3: T:0.14026 C:0.41883 A:0.11753 G:0.32338
Average T:0.18636 C:0.31320 A:0.21385 G:0.28658
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_PGRP-LB-PC
D_sechellia_PGRP-LB-PC 0.2248 (0.0214 0.0952)
D_simulans_PGRP-LB-PC 0.0899 (0.0101 0.1126) 0.1304 (0.0101 0.0776)
D_yakuba_PGRP-LB-PC 0.1862 (0.0307 0.1651) 0.2208 (0.0339 0.1535) 0.1441 (0.0276 0.1918)
D_erecta_PGRP-LB-PC 0.0787 (0.0162 0.2060) 0.1964 (0.0380 0.1937) 0.1154 (0.0265 0.2301) 0.3740 (0.0359 0.0960)
D_elegans_PGRP-LB-PC 0.0698 (0.0327 0.4692) 0.0868 (0.0429 0.4943) 0.0591 (0.0338 0.5726) 0.1072 (0.0493 0.4599) 0.0834 (0.0400 0.4796)
D_takahashii_PGRP-LB-PC 0.1046 (0.0498 0.4761) 0.1251 (0.0617 0.4932) 0.0961 (0.0523 0.5449) 0.1468 (0.0649 0.4422) 0.1423 (0.0659 0.4631) 0.1240 (0.0507 0.4089)
Model 0: one-ratio
TREE # 1: (1, (2, 3), ((4, 5), (6, 7))); MP score: 179
lnL(ntime: 11 np: 13): -1805.437461 +0.000000
8..1 8..9 9..2 9..3 8..10 10..11 11..4 11..5 10..12 12..6 12..7
0.042107 0.035861 0.045409 0.035584 0.046740 0.037345 0.073758 0.089707 0.162793 0.188654 0.265055 1.303627 0.097960
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.02301
(1: 0.042107, (2: 0.045409, 3: 0.035584): 0.035861, ((4: 0.073758, 5: 0.089707): 0.037345, (6: 0.188654, 7: 0.265055): 0.162793): 0.046740);
(D_melanogaster_PGRP-LB-PC: 0.042107, (D_sechellia_PGRP-LB-PC: 0.045409, D_simulans_PGRP-LB-PC: 0.035584): 0.035861, ((D_yakuba_PGRP-LB-PC: 0.073758, D_erecta_PGRP-LB-PC: 0.089707): 0.037345, (D_elegans_PGRP-LB-PC: 0.188654, D_takahashii_PGRP-LB-PC: 0.265055): 0.162793): 0.046740);
Detailed output identifying parameters
kappa (ts/tv) = 1.30363
omega (dN/dS) = 0.09796
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.042 523.4 136.6 0.0980 0.0048 0.0493 2.5 6.7
8..9 0.036 523.4 136.6 0.0980 0.0041 0.0420 2.2 5.7
9..2 0.045 523.4 136.6 0.0980 0.0052 0.0532 2.7 7.3
9..3 0.036 523.4 136.6 0.0980 0.0041 0.0417 2.1 5.7
8..10 0.047 523.4 136.6 0.0980 0.0054 0.0547 2.8 7.5
10..11 0.037 523.4 136.6 0.0980 0.0043 0.0437 2.2 6.0
11..4 0.074 523.4 136.6 0.0980 0.0085 0.0864 4.4 11.8
11..5 0.090 523.4 136.6 0.0980 0.0103 0.1051 5.4 14.3
10..12 0.163 523.4 136.6 0.0980 0.0187 0.1907 9.8 26.0
12..6 0.189 523.4 136.6 0.0980 0.0216 0.2210 11.3 30.2
12..7 0.265 523.4 136.6 0.0980 0.0304 0.3105 15.9 42.4
tree length for dN: 0.1174
tree length for dS: 1.1982
Time used: 0:04
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (2, 3), ((4, 5), (6, 7))); MP score: 179
lnL(ntime: 11 np: 14): -1787.073819 +0.000000
8..1 8..9 9..2 9..3 8..10 10..11 11..4 11..5 10..12 12..6 12..7
0.043075 0.035736 0.046445 0.036380 0.052041 0.035193 0.075322 0.092146 0.170315 0.197065 0.278826 1.318050 0.939736 0.052447
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.06254
(1: 0.043075, (2: 0.046445, 3: 0.036380): 0.035736, ((4: 0.075322, 5: 0.092146): 0.035193, (6: 0.197065, 7: 0.278826): 0.170315): 0.052041);
(D_melanogaster_PGRP-LB-PC: 0.043075, (D_sechellia_PGRP-LB-PC: 0.046445, D_simulans_PGRP-LB-PC: 0.036380): 0.035736, ((D_yakuba_PGRP-LB-PC: 0.075322, D_erecta_PGRP-LB-PC: 0.092146): 0.035193, (D_elegans_PGRP-LB-PC: 0.197065, D_takahashii_PGRP-LB-PC: 0.278826): 0.170315): 0.052041);
Detailed output identifying parameters
kappa (ts/tv) = 1.31805
dN/dS (w) for site classes (K=2)
p: 0.93974 0.06026
w: 0.05245 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.043 523.3 136.7 0.1096 0.0054 0.0488 2.8 6.7
8..9 0.036 523.3 136.7 0.1096 0.0044 0.0405 2.3 5.5
9..2 0.046 523.3 136.7 0.1096 0.0058 0.0527 3.0 7.2
9..3 0.036 523.3 136.7 0.1096 0.0045 0.0413 2.4 5.6
8..10 0.052 523.3 136.7 0.1096 0.0065 0.0590 3.4 8.1
10..11 0.035 523.3 136.7 0.1096 0.0044 0.0399 2.3 5.5
11..4 0.075 523.3 136.7 0.1096 0.0094 0.0854 4.9 11.7
11..5 0.092 523.3 136.7 0.1096 0.0114 0.1045 6.0 14.3
10..12 0.170 523.3 136.7 0.1096 0.0212 0.1931 11.1 26.4
12..6 0.197 523.3 136.7 0.1096 0.0245 0.2235 12.8 30.5
12..7 0.279 523.3 136.7 0.1096 0.0346 0.3162 18.1 43.2
Time used: 0:11
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (2, 3), ((4, 5), (6, 7))); MP score: 179
lnL(ntime: 11 np: 16): -1786.979894 +0.000000
8..1 8..9 9..2 9..3 8..10 10..11 11..4 11..5 10..12 12..6 12..7
0.043258 0.035802 0.046621 0.036567 0.052685 0.035161 0.075783 0.092470 0.171127 0.198492 0.280706 1.325973 0.948641 0.015367 0.056017 1.285429
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.06867
(1: 0.043258, (2: 0.046621, 3: 0.036567): 0.035802, ((4: 0.075783, 5: 0.092470): 0.035161, (6: 0.198492, 7: 0.280706): 0.171127): 0.052685);
(D_melanogaster_PGRP-LB-PC: 0.043258, (D_sechellia_PGRP-LB-PC: 0.046621, D_simulans_PGRP-LB-PC: 0.036567): 0.035802, ((D_yakuba_PGRP-LB-PC: 0.075783, D_erecta_PGRP-LB-PC: 0.092470): 0.035161, (D_elegans_PGRP-LB-PC: 0.198492, D_takahashii_PGRP-LB-PC: 0.280706): 0.171127): 0.052685);
Detailed output identifying parameters
kappa (ts/tv) = 1.32597
dN/dS (w) for site classes (K=3)
p: 0.94864 0.01537 0.03599
w: 0.05602 1.00000 1.28543
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.043 523.2 136.8 0.1148 0.0055 0.0484 2.9 6.6
8..9 0.036 523.2 136.8 0.1148 0.0046 0.0400 2.4 5.5
9..2 0.047 523.2 136.8 0.1148 0.0060 0.0521 3.1 7.1
9..3 0.037 523.2 136.8 0.1148 0.0047 0.0409 2.5 5.6
8..10 0.053 523.2 136.8 0.1148 0.0068 0.0589 3.5 8.1
10..11 0.035 523.2 136.8 0.1148 0.0045 0.0393 2.4 5.4
11..4 0.076 523.2 136.8 0.1148 0.0097 0.0847 5.1 11.6
11..5 0.092 523.2 136.8 0.1148 0.0119 0.1034 6.2 14.1
10..12 0.171 523.2 136.8 0.1148 0.0220 0.1913 11.5 26.2
12..6 0.198 523.2 136.8 0.1148 0.0255 0.2219 13.3 30.3
12..7 0.281 523.2 136.8 0.1148 0.0360 0.3138 18.8 42.9
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PC)
Pr(w>1) post mean +- SE for w
18 Q 0.713 1.182
189 I 0.681 1.104
191 D 0.728 1.204
195 V 0.771 1.219
197 T 0.819 1.234
210 A 0.617 1.028
211 P 0.691 1.128
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PC)
Pr(w>1) post mean +- SE for w
189 I 0.567 1.482 +- 0.878
195 V 0.623 1.585 +- 0.858
197 T 0.765 1.812 +- 1.097
211 P 0.525 1.401 +- 0.727
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.705 0.197 0.052 0.019 0.009 0.006 0.004 0.003 0.002 0.002
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.006 0.993
sum of density on p0-p1 = 1.000000
Time used: 0:35
Model 3: discrete (3 categories)
TREE # 1: (1, (2, 3), ((4, 5), (6, 7))); MP score: 179
lnL(ntime: 11 np: 17): -1786.452812 +0.000000
8..1 8..9 9..2 9..3 8..10 10..11 11..4 11..5 10..12 12..6 12..7
0.043360 0.035902 0.046706 0.036738 0.052409 0.035807 0.076336 0.092505 0.171233 0.199129 0.282893 1.325884 0.436217 0.526222 0.000001 0.116636 1.464221
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.07302
(1: 0.043360, (2: 0.046706, 3: 0.036738): 0.035902, ((4: 0.076336, 5: 0.092505): 0.035807, (6: 0.199129, 7: 0.282893): 0.171233): 0.052409);
(D_melanogaster_PGRP-LB-PC: 0.043360, (D_sechellia_PGRP-LB-PC: 0.046706, D_simulans_PGRP-LB-PC: 0.036738): 0.035902, ((D_yakuba_PGRP-LB-PC: 0.076336, D_erecta_PGRP-LB-PC: 0.092505): 0.035807, (D_elegans_PGRP-LB-PC: 0.199129, D_takahashii_PGRP-LB-PC: 0.282893): 0.171233): 0.052409);
Detailed output identifying parameters
kappa (ts/tv) = 1.32588
dN/dS (w) for site classes (K=3)
p: 0.43622 0.52622 0.03756
w: 0.00000 0.11664 1.46422
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.043 523.2 136.8 0.1164 0.0056 0.0483 2.9 6.6
8..9 0.036 523.2 136.8 0.1164 0.0047 0.0400 2.4 5.5
9..2 0.047 523.2 136.8 0.1164 0.0060 0.0520 3.2 7.1
9..3 0.037 523.2 136.8 0.1164 0.0048 0.0409 2.5 5.6
8..10 0.052 523.2 136.8 0.1164 0.0068 0.0583 3.6 8.0
10..11 0.036 523.2 136.8 0.1164 0.0046 0.0399 2.4 5.5
11..4 0.076 523.2 136.8 0.1164 0.0099 0.0850 5.2 11.6
11..5 0.093 523.2 136.8 0.1164 0.0120 0.1030 6.3 14.1
10..12 0.171 523.2 136.8 0.1164 0.0222 0.1906 11.6 26.1
12..6 0.199 523.2 136.8 0.1164 0.0258 0.2216 13.5 30.3
12..7 0.283 523.2 136.8 0.1164 0.0366 0.3149 19.2 43.1
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PC)
Pr(w>1) post mean +- SE for w
18 Q 0.883 1.306
189 I 0.785 1.174
191 D 0.960* 1.410
195 V 0.987* 1.446
197 T 0.999** 1.463
210 A 0.661 1.008
211 P 0.812 1.210
Time used: 0:52
Model 7: beta (10 categories)
TREE # 1: (1, (2, 3), ((4, 5), (6, 7))); MP score: 179
lnL(ntime: 11 np: 14): -1789.169534 +0.000000
8..1 8..9 9..2 9..3 8..10 10..11 11..4 11..5 10..12 12..6 12..7
0.042776 0.035951 0.046164 0.036240 0.049927 0.036362 0.074950 0.091670 0.169062 0.194110 0.276008 1.307835 0.175606 1.390367
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.05322
(1: 0.042776, (2: 0.046164, 3: 0.036240): 0.035951, ((4: 0.074950, 5: 0.091670): 0.036362, (6: 0.194110, 7: 0.276008): 0.169062): 0.049927);
(D_melanogaster_PGRP-LB-PC: 0.042776, (D_sechellia_PGRP-LB-PC: 0.046164, D_simulans_PGRP-LB-PC: 0.036240): 0.035951, ((D_yakuba_PGRP-LB-PC: 0.074950, D_erecta_PGRP-LB-PC: 0.091670): 0.036362, (D_elegans_PGRP-LB-PC: 0.194110, D_takahashii_PGRP-LB-PC: 0.276008): 0.169062): 0.049927);
Detailed output identifying parameters
kappa (ts/tv) = 1.30784
Parameters in M7 (beta):
p = 0.17561 q = 1.39037
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00001 0.00024 0.00160 0.00671 0.02115 0.05540 0.12833 0.27612 0.59185
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.043 523.4 136.6 0.1081 0.0053 0.0487 2.8 6.7
8..9 0.036 523.4 136.6 0.1081 0.0044 0.0409 2.3 5.6
9..2 0.046 523.4 136.6 0.1081 0.0057 0.0526 3.0 7.2
9..3 0.036 523.4 136.6 0.1081 0.0045 0.0413 2.3 5.6
8..10 0.050 523.4 136.6 0.1081 0.0061 0.0569 3.2 7.8
10..11 0.036 523.4 136.6 0.1081 0.0045 0.0414 2.3 5.7
11..4 0.075 523.4 136.6 0.1081 0.0092 0.0853 4.8 11.7
11..5 0.092 523.4 136.6 0.1081 0.0113 0.1044 5.9 14.3
10..12 0.169 523.4 136.6 0.1081 0.0208 0.1925 10.9 26.3
12..6 0.194 523.4 136.6 0.1081 0.0239 0.2210 12.5 30.2
12..7 0.276 523.4 136.6 0.1081 0.0340 0.3143 17.8 42.9
Time used: 1:20
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (2, 3), ((4, 5), (6, 7))); MP score: 179
lnL(ntime: 11 np: 16): -1786.559737 +0.000000
8..1 8..9 9..2 9..3 8..10 10..11 11..4 11..5 10..12 12..6 12..7
0.043342 0.035886 0.046691 0.036720 0.052450 0.035728 0.076250 0.092502 0.171183 0.199000 0.282570 1.325580 0.962618 0.781983 11.015871 1.453544
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.07232
(1: 0.043342, (2: 0.046691, 3: 0.036720): 0.035886, ((4: 0.076250, 5: 0.092502): 0.035728, (6: 0.199000, 7: 0.282570): 0.171183): 0.052450);
(D_melanogaster_PGRP-LB-PC: 0.043342, (D_sechellia_PGRP-LB-PC: 0.046691, D_simulans_PGRP-LB-PC: 0.036720): 0.035886, ((D_yakuba_PGRP-LB-PC: 0.076250, D_erecta_PGRP-LB-PC: 0.092502): 0.035728, (D_elegans_PGRP-LB-PC: 0.199000, D_takahashii_PGRP-LB-PC: 0.282570): 0.171183): 0.052450);
Detailed output identifying parameters
kappa (ts/tv) = 1.32558
Parameters in M8 (beta&w>1):
p0 = 0.96262 p = 0.78198 q = 11.01587
(p1 = 0.03738) w = 1.45354
dN/dS (w) for site classes (K=11)
p: 0.09626 0.09626 0.09626 0.09626 0.09626 0.09626 0.09626 0.09626 0.09626 0.09626 0.03738
w: 0.00182 0.00767 0.01539 0.02493 0.03660 0.05105 0.06946 0.09426 0.13164 0.20896 1.45354
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.043 523.2 136.8 0.1161 0.0056 0.0483 2.9 6.6
8..9 0.036 523.2 136.8 0.1161 0.0046 0.0400 2.4 5.5
9..2 0.047 523.2 136.8 0.1161 0.0060 0.0520 3.2 7.1
9..3 0.037 523.2 136.8 0.1161 0.0047 0.0409 2.5 5.6
8..10 0.052 523.2 136.8 0.1161 0.0068 0.0584 3.5 8.0
10..11 0.036 523.2 136.8 0.1161 0.0046 0.0398 2.4 5.4
11..4 0.076 523.2 136.8 0.1161 0.0099 0.0849 5.2 11.6
11..5 0.093 523.2 136.8 0.1161 0.0120 0.1030 6.3 14.1
10..12 0.171 523.2 136.8 0.1161 0.0221 0.1907 11.6 26.1
12..6 0.199 523.2 136.8 0.1161 0.0257 0.2217 13.5 30.3
12..7 0.283 523.2 136.8 0.1161 0.0365 0.3147 19.1 43.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PC)
Pr(w>1) post mean +- SE for w
18 Q 0.854 1.267
189 I 0.778 1.165
191 D 0.931 1.366
195 V 0.975* 1.422
197 T 0.997** 1.450
210 A 0.658 1.010
211 P 0.800 1.195
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PC)
Pr(w>1) post mean +- SE for w
18 Q 0.629 1.274 +- 0.683
189 I 0.684 1.381 +- 0.832
191 D 0.681 1.367 +- 0.694
195 V 0.833 1.604 +- 0.752
197 T 0.938 1.750 +- 0.753
210 A 0.568 1.202 +- 0.853
211 P 0.664 1.334 +- 0.771
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.005 0.027 0.082 0.173 0.291 0.422
ws: 0.770 0.181 0.033 0.009 0.003 0.002 0.001 0.001 0.000 0.000
Time used: 2:10
Model 1: NearlyNeutral -1787.073819 Model 2: PositiveSelection -1786.979894 Model 0: one-ratio -1805.437461 Model 3: discrete -1786.452812 Model 7: beta -1789.169534 Model 8: beta&w>1 -1786.559737 Model 0 vs 1 36.727284000000054 Model 2 vs 1 0.18784999999979846 Model 8 vs 7 5.219594000000143
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
