--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Nov 25 13:29:11 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/346/PGRP-LB-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1692.65 -1705.14
2 -1692.85 -1702.24
--------------------------------------
TOTAL -1692.75 -1704.50
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.506578 0.007073 0.361108 0.670111 0.495668 920.60 997.90 1.000
r(A<->C){all} 0.170509 0.001529 0.097060 0.245350 0.167931 893.31 924.09 1.000
r(A<->G){all} 0.197010 0.002213 0.112188 0.296008 0.193956 850.66 909.93 1.001
r(A<->T){all} 0.123414 0.002214 0.030770 0.211138 0.119182 677.89 775.02 1.000
r(C<->G){all} 0.090219 0.000590 0.044900 0.137673 0.088253 1138.17 1233.83 1.000
r(C<->T){all} 0.292183 0.003052 0.187053 0.402400 0.289274 888.08 989.77 1.001
r(G<->T){all} 0.126666 0.001651 0.049174 0.202676 0.123289 790.76 841.88 1.000
pi(A){all} 0.212022 0.000221 0.181706 0.239809 0.211460 1081.91 1190.51 1.000
pi(C){all} 0.343399 0.000278 0.310632 0.375300 0.343247 1046.62 1136.12 1.000
pi(G){all} 0.279716 0.000270 0.247147 0.311505 0.279325 1011.72 1033.04 1.000
pi(T){all} 0.164863 0.000182 0.138784 0.190885 0.164897 958.73 973.89 1.000
alpha{1,2} 0.098085 0.003158 0.000124 0.190499 0.098957 938.30 963.26 1.000
alpha{3} 1.965737 0.582422 0.657116 3.419758 1.840381 959.30 1188.08 1.000
pinvar{all} 0.306525 0.011893 0.087535 0.503839 0.309316 806.78 959.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1532.872708
Model 2: PositiveSelection -1532.75116
Model 0: one-ratio -1547.550018
Model 3: discrete -1532.567386
Model 7: beta -1534.322648
Model 8: beta&w>1 -1532.582913
Model 0 vs 1 29.354619999999613
Model 2 vs 1 0.24309600000015053
Model 8 vs 7 3.4794700000002194
>C1
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGVSSTTAPVVPHVHPQAA
APQKPHQSPPAAPKVooooo
>C2
MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLNASDGESSTAAPVVPHVHAQAA
APQTPHQSPPAAPKVooooo
>C3
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLNATEGVSSTAAPVVPHVHAQAA
APQTPHQSPPAAPKVooooo
>C4
MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKA
ATQTPLAQSPPAAPKVoooo
>C5
MQQANLGTARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTP
DCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAHAPKY
NDRSVGIVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLLGHRQ
VRDTECPGGRLFAEISSWPHFTHINDTEGVSSTKAPVEPHVHPQAATQQT
PPKSPPAAPKVooooooooo
>C6
MQHANLGDGAATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVC
YTTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISGWPHFTHLNATEGSTPVPIEPHAHPQAASQ
TPPQSPPQSPPHAPAAAPKV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=232
C1 MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
C2 MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVC
C3 MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
C4 MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVC
C5 MQQANLG----TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
C6 MQHANLGDGAATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVC
**:**** ******************:**:**************.**
C1 YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
C2 YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
C3 YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
C4 YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAH
C5 YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAH
C6 YTTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
*:**:**********************************:******:***
C1 APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
C2 APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
C3 APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
C4 APKYNDKSVGIVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLL
C5 APKYNDRSVGIVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLL
C6 APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
******:***********************::**:***************
C1 GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTTAPVVPHVHPQA
C2 GHRQVRDTECPGGRLFAEISSWPHFTHLNASDGE-SSTAAPVVPHVHAQA
C3 GHRQVRDTECPGGRLFAEISSWPHFTHLNATEGV-SSTAAPVVPHVHAQA
C4 GHRQVRDTECPGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKA
C5 GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTKAPVEPHVHPQA
C6 GHRQVRDTECPGGRLFAEISGWPHFTHLNATEGS---TPVPIEPHAHPQA
********************.******:. ::* * .*: **.*.:*
C1 AAP---QKPHQSPP----AAPKVooooo----
C2 AAP---QTPHQSPP----AAPKVooooo----
C3 AAP---QTPHQSPP----AAPKVooooo----
C4 ATQ---TPLAQSPP----AAPKVoooo-----
C5 ATQ---QTPPKSPP----AAPKVooooooooo
C6 ASQTPPQSPPQSPPHAPAAAPKV---------
*: :*** *****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 220 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 220 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7802]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [7802]--->[7386]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.333 Mb, Max= 30.644 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTTAPVVPHVHPQA
AAP---QKPHQSPP----AAPKVooooo----
>C2
MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLNASDGE-SSTAAPVVPHVHAQA
AAP---QTPHQSPP----AAPKVooooo----
>C3
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLNATEGV-SSTAAPVVPHVHAQA
AAP---QTPHQSPP----AAPKVooooo----
>C4
MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKA
ATQ---TPLAQSPP----AAPKVoooo-----
>C5
MQQANLG----TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAH
APKYNDRSVGIVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTKAPVEPHVHPQA
ATQ---QTPPKSPP----AAPKVooooooooo
>C6
MQHANLGDGAATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVC
YTTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISGWPHFTHLNATEGS---TPVPIEPHAHPQA
ASQTPPQSPPQSPPHAPAAAPKV---------
FORMAT of file /tmp/tmp4525390263686585950aln Not Supported[FATAL:T-COFFEE]
>C1
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTTAPVVPHVHPQA
AAP---QKPHQSPP----AAPKVooooo----
>C2
MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLNASDGE-SSTAAPVVPHVHAQA
AAP---QTPHQSPP----AAPKVooooo----
>C3
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLNATEGV-SSTAAPVVPHVHAQA
AAP---QTPHQSPP----AAPKVooooo----
>C4
MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKA
ATQ---TPLAQSPP----AAPKVoooo-----
>C5
MQQANLG----TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAH
APKYNDRSVGIVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTKAPVEPHVHPQA
ATQ---QTPPKSPP----AAPKVooooooooo
>C6
MQHANLGDGAATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVC
YTTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISGWPHFTHLNATEGS---TPVPIEPHAHPQA
ASQTPPQSPPQSPPHAPAAAPKV---------
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:232 S:95 BS:232
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 95.45 C1 C2 95.45
TOP 1 0 95.45 C2 C1 95.45
BOT 0 2 97.27 C1 C3 97.27
TOP 2 0 97.27 C3 C1 97.27
BOT 0 3 91.78 C1 C4 91.78
TOP 3 0 91.78 C4 C1 91.78
BOT 0 4 95.37 C1 C5 95.37
TOP 4 0 95.37 C5 C1 95.37
BOT 0 5 92.02 C1 C6 92.02
TOP 5 0 92.02 C6 C1 92.02
BOT 1 2 98.18 C2 C3 98.18
TOP 2 1 98.18 C3 C2 98.18
BOT 1 3 91.78 C2 C4 91.78
TOP 3 1 91.78 C4 C2 91.78
BOT 1 4 92.13 C2 C5 92.13
TOP 4 1 92.13 C5 C2 92.13
BOT 1 5 90.61 C2 C6 90.61
TOP 5 1 90.61 C6 C2 90.61
BOT 2 3 92.69 C3 C4 92.69
TOP 3 2 92.69 C4 C3 92.69
BOT 2 4 93.98 C3 C5 93.98
TOP 4 2 93.98 C5 C3 93.98
BOT 2 5 92.02 C3 C6 92.02
TOP 5 2 92.02 C6 C3 92.02
BOT 3 4 91.16 C4 C5 91.16
TOP 4 3 91.16 C5 C4 91.16
BOT 3 5 88.73 C4 C6 88.73
TOP 5 3 88.73 C6 C4 88.73
BOT 4 5 91.87 C5 C6 91.87
TOP 5 4 91.87 C6 C5 91.87
AVG 0 C1 * 94.38
AVG 1 C2 * 93.63
AVG 2 C3 * 94.83
AVG 3 C4 * 91.23
AVG 4 C5 * 92.90
AVG 5 C6 * 91.05
TOT TOT * 93.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTGTC
C2 ATGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTTTC
C3 ATGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTTTC
C4 ATGCAGCAGGCAAATCTGGGCGATGGTGTGGCCACCGCCCGACTGCTGTC
C5 ATGCAGCAGGCGAATCTGGGC------------ACCGCCCGGCTTCTGTC
C6 ATGCAGCATGCGAATTTGGGCGATGGAGCGGCCACCGCTCGACTTCTGTC
******** **.*** ***** ***** ** ** ** **
C1 CCGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGAGCACTTCCAGG
C2 CCGATCCGACTGGGGTGCCCGGCTGCCCAAGTCTGTGGACCACTTCCAGG
C3 CCGATCCGACTGGGGTGCACGGCTGCCCAAGTCCGTGGAGCACTTCCAGG
C4 CAGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGACCACTTTCAGG
C5 CCGATCCGACTGGGGTGCCCGCCTGCCCAAGTCCGTGGAGCACTTTCAAG
C6 CCGCTCCGACTGGGGCGCCCGTCTGCCCAAGTCCGTGGAGCACTTCGAGG
*.*.*********** **.** *********** ***** ***** *.*
C1 GTCCCGCGCCCTACGTCATCATCCATCACTCGTACATGCCGGCCGTGTGC
C2 GACCCGCGCCCTACGTCATCATCCACCACTCGTACATGCCGGCCGTGTGC
C3 GACCAGCGCCTTACGTCATCATCCACCACTCGTATATGCCGGCCGTGTGC
C4 GACCCGCGCCCTACGTCATCATCCACCACTCGTACATGCCAGGCGTGTGC
C5 GACCCGCGCCCTACGTGATCATCCACCACTCGTACATGCCAGCCGTGTGC
C6 GTCCCGCCCCCTACGTGATCATCCACCACTCTTACATGCCGGCGGTGTGC
*:**.** ** ***** ******** ***** ** *****.* ******
C1 TACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
C2 TACTCCACTCCGGAATGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
C3 TACTCAACTCCGGAATGCATGAAGAGCATGCGGGACATGCAGGACTTTCA
C4 TACTCCACTCCGGAGTGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
C5 TACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
C6 TATACCACTCCCGACTGCATGAAGAGCATGCGCGACATGCAGGACTTCCA
** :*.***** ** ***************** ************** **
C1 TCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCG
C2 TCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCG
C3 TCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCG
C4 CCAGCTGGAGCGCGGATGGAACGATATCGGATATAGCTTTGGCATCGGCG
C5 CCAGCTGGAGCGCGGTTGGAACGATATCGGATATAGCTTTGGCATCGGCG
C6 CCAGCTGGAGCGCGGTTGGAACGACATCGGCTATAGCTTCGGCATCGGCG
**************:******** ** ** ******** **********
C1 GCGATGGCATGATTTACACCGGCAGGGGATTCAATGTCATCGGAGCTCAT
C2 GCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCATCGGAGCTCAT
C3 GCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCATCGGAGCTCAT
C4 GCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCGTCGGAGCTCAT
C5 GCGATGGCATGATCTACGCAGGCAGGGGATTCAATGTCATCGGAGCTCAT
C6 GCGATGGCATGATCTACACCGGAAGGGGATTCAACGTTATCGGAGCTCAT
************* ***.*.**.*********** ** .***********
C1 GCACCCAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAGATTG
C2 GCACCCAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAGATTG
C3 GCACCGAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAGATTG
C4 GCGCCGAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAGATTG
C5 GCGCCGAAGTACAATGACAGGAGCGTGGGCATCGTGCTGATCGGAGATTG
C6 GCACCCAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAGATTG
**.** *************.************ *****************
C1 GAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGA
C2 GAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGA
C3 GAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGA
C4 GAGAACTGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAGGAACCTGA
C5 GAGAACTGAACTTCCGCCCAAGCAGATGCTGGATGCGGCCAAGGACCTGA
C6 GAGAACTGAACTGCCGCCCAAACAGATGCTGGACGCGGCCAAAAACCTGA
****** ***** ********.*********** *******...******
C1 TCGCCTTTGGCGTTTTCAAGGGCTACATTGACCCTGCCTACAAGCTGCTG
C2 TCGCCTTCGGAGTTTTCAAGGGCTACATTGACCCCGCCTACAAACTGCTG
C3 TCGCCTTCGGCGTTTTCAAGGGCTACATTGACCCCGCCTACAAGCTGCTG
C4 TCTCCTTCGGGGTGTTCAAGGGCTACATTGACCCCGCCTACAAGCTGCTG
C5 TCGCCTTCGGGGTGTTCAAGGGCTACATTGACCCCGCCTACAAGCTGCTG
C6 TCGCCTTCGGCGTGTTCAAGGGCTACATTGACCCCGCATACAAGCTGCTG
** **** ** ** ******************** **.*****.******
C1 GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTGTTCGC
C2 GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGAGGCCGCCTCTTCGC
C3 GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTCTTCGC
C4 GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGAGGCCGCCTGTTTGC
C5 GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGGGGCCGCCTGTTTGC
C6 GGCCACCGACAGGTTCGTGACACCGAGTGTCCCGGAGGCAGGCTGTTCGC
************** ** ** *********** ** ***.* ** ** **
C1 CGAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAAGGCG
C2 CGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAACGCCAGCGACGGCG
C3 CGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAACGCCACCGAAGGCG
C4 CGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAGCGAAACCGAAGGCG
C5 CGAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAAGGCG
C6 GGAGATCTCCGGCTGGCCGCACTTTACCCACCTAAACGCCACCGAAGGCA
*********.********************.***.**..* ***.***.
C1 TC---AGCAGCACCACGGCGCCCGTCGTGCCCCACGTCCATCCACAGGCG
C2 AG---AGCAGCACTGCGGCGCCCGTCGTGCCCCATGTCCATGCACAGGCG
C3 TG---AGCAGCACTGCGGCGCCCGTCGTGCCCCATGTCCATGCACAGGCG
C4 TAGTTAGCAGCACTGCTGCGCCCGTCGAGCCCCACGTCCATCCAAAGGCG
C5 TT---AGCAGTACGAAGGCGCCGGTCGAGCCCCACGTCCATCCACAGGCG
C6 GC---------ACCCCCGTCCCCATTGAACCGCACGCACATCCCCAGGCG
** . * ** .* *:.** ** * .*** *..*****
C1 GCAGCACCA---------CAAAAGCCGCACCAATCCCCGCCA--------
C2 GCAGCACCA---------CAAACGCCGCACCAATCCCCGCCA--------
C3 GCAGCACCA---------CAAACGCCGCACCAATCCCCGCCA--------
C4 GCAACACAA---------ACGCCACTCGCCCAATCCCCGCCA--------
C5 GCAACACAA---------CAAACGCCGCCCAAATCCCCGCCA--------
C6 GCGTCCCAAACGCCACCCCAATCACCACCCCAATCGCCACCCCATGCCCC
**. *.*.* ... ..* .*.**** **.**.
C1 ----GCTGCGCCCAAGGTC---------------------------
C2 ----GCTGCGCCCAAGGTC---------------------------
C3 ----GCTGCGCCCAAGGTC---------------------------
C4 ----GCTGCGCCCAAGGTC---------------------------
C5 ----GCTGCGCCCAAGGTC---------------------------
C6 GGCAGCTGCGCCCAAGGTC---------------------------
***************
>C1
ATGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTGTC
CCGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGAGCACTTCCAGG
GTCCCGCGCCCTACGTCATCATCCATCACTCGTACATGCCGGCCGTGTGC
TACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
TCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCG
GCGATGGCATGATTTACACCGGCAGGGGATTCAATGTCATCGGAGCTCAT
GCACCCAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAGATTG
GAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGA
TCGCCTTTGGCGTTTTCAAGGGCTACATTGACCCTGCCTACAAGCTGCTG
GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTGTTCGC
CGAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAAGGCG
TC---AGCAGCACCACGGCGCCCGTCGTGCCCCACGTCCATCCACAGGCG
GCAGCACCA---------CAAAAGCCGCACCAATCCCCGCCA--------
----GCTGCGCCCAAGGTC---------------------------
>C2
ATGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTTTC
CCGATCCGACTGGGGTGCCCGGCTGCCCAAGTCTGTGGACCACTTCCAGG
GACCCGCGCCCTACGTCATCATCCACCACTCGTACATGCCGGCCGTGTGC
TACTCCACTCCGGAATGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
TCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCG
GCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCATCGGAGCTCAT
GCACCCAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAGATTG
GAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGA
TCGCCTTCGGAGTTTTCAAGGGCTACATTGACCCCGCCTACAAACTGCTG
GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGAGGCCGCCTCTTCGC
CGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAACGCCAGCGACGGCG
AG---AGCAGCACTGCGGCGCCCGTCGTGCCCCATGTCCATGCACAGGCG
GCAGCACCA---------CAAACGCCGCACCAATCCCCGCCA--------
----GCTGCGCCCAAGGTC---------------------------
>C3
ATGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTTTC
CCGATCCGACTGGGGTGCACGGCTGCCCAAGTCCGTGGAGCACTTCCAGG
GACCAGCGCCTTACGTCATCATCCACCACTCGTATATGCCGGCCGTGTGC
TACTCAACTCCGGAATGCATGAAGAGCATGCGGGACATGCAGGACTTTCA
TCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCG
GCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCATCGGAGCTCAT
GCACCGAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAGATTG
GAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGA
TCGCCTTCGGCGTTTTCAAGGGCTACATTGACCCCGCCTACAAGCTGCTG
GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTCTTCGC
CGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAACGCCACCGAAGGCG
TG---AGCAGCACTGCGGCGCCCGTCGTGCCCCATGTCCATGCACAGGCG
GCAGCACCA---------CAAACGCCGCACCAATCCCCGCCA--------
----GCTGCGCCCAAGGTC---------------------------
>C4
ATGCAGCAGGCAAATCTGGGCGATGGTGTGGCCACCGCCCGACTGCTGTC
CAGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGACCACTTTCAGG
GACCCGCGCCCTACGTCATCATCCACCACTCGTACATGCCAGGCGTGTGC
TACTCCACTCCGGAGTGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
CCAGCTGGAGCGCGGATGGAACGATATCGGATATAGCTTTGGCATCGGCG
GCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCGTCGGAGCTCAT
GCGCCGAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAGATTG
GAGAACTGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAGGAACCTGA
TCTCCTTCGGGGTGTTCAAGGGCTACATTGACCCCGCCTACAAGCTGCTG
GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGAGGCCGCCTGTTTGC
CGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAGCGAAACCGAAGGCG
TAGTTAGCAGCACTGCTGCGCCCGTCGAGCCCCACGTCCATCCAAAGGCG
GCAACACAA---------ACGCCACTCGCCCAATCCCCGCCA--------
----GCTGCGCCCAAGGTC---------------------------
>C5
ATGCAGCAGGCGAATCTGGGC------------ACCGCCCGGCTTCTGTC
CCGATCCGACTGGGGTGCCCGCCTGCCCAAGTCCGTGGAGCACTTTCAAG
GACCCGCGCCCTACGTGATCATCCACCACTCGTACATGCCAGCCGTGTGC
TACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
CCAGCTGGAGCGCGGTTGGAACGATATCGGATATAGCTTTGGCATCGGCG
GCGATGGCATGATCTACGCAGGCAGGGGATTCAATGTCATCGGAGCTCAT
GCGCCGAAGTACAATGACAGGAGCGTGGGCATCGTGCTGATCGGAGATTG
GAGAACTGAACTTCCGCCCAAGCAGATGCTGGATGCGGCCAAGGACCTGA
TCGCCTTCGGGGTGTTCAAGGGCTACATTGACCCCGCCTACAAGCTGCTG
GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGGGGCCGCCTGTTTGC
CGAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAAGGCG
TT---AGCAGTACGAAGGCGCCGGTCGAGCCCCACGTCCATCCACAGGCG
GCAACACAA---------CAAACGCCGCCCAAATCCCCGCCA--------
----GCTGCGCCCAAGGTC---------------------------
>C6
ATGCAGCATGCGAATTTGGGCGATGGAGCGGCCACCGCTCGACTTCTGTC
CCGCTCCGACTGGGGCGCCCGTCTGCCCAAGTCCGTGGAGCACTTCGAGG
GTCCCGCCCCCTACGTGATCATCCACCACTCTTACATGCCGGCGGTGTGC
TATACCACTCCCGACTGCATGAAGAGCATGCGCGACATGCAGGACTTCCA
CCAGCTGGAGCGCGGTTGGAACGACATCGGCTATAGCTTCGGCATCGGCG
GCGATGGCATGATCTACACCGGAAGGGGATTCAACGTTATCGGAGCTCAT
GCACCCAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAGATTG
GAGAACTGAACTGCCGCCCAAACAGATGCTGGACGCGGCCAAAAACCTGA
TCGCCTTCGGCGTGTTCAAGGGCTACATTGACCCCGCATACAAGCTGCTG
GGCCACCGACAGGTTCGTGACACCGAGTGTCCCGGAGGCAGGCTGTTCGC
GGAGATCTCCGGCTGGCCGCACTTTACCCACCTAAACGCCACCGAAGGCA
GC---------ACCCCCGTCCCCATTGAACCGCACGCACATCCCCAGGCG
GCGTCCCAAACGCCACCCCAATCACCACCCCAATCGCCACCCCATGCCCC
GGCAGCTGCGCCCAAGGTC---------------------------
>C1
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGVoSSTTAPVVPHVHPQA
AAPoooQKPHQSPPooooAAPKV
>C2
MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLNASDGEoSSTAAPVVPHVHAQA
AAPoooQTPHQSPPooooAAPKV
>C3
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLNATEGVoSSTAAPVVPHVHAQA
AAPoooQTPHQSPPooooAAPKV
>C4
MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKA
ATQoooTPLAQSPPooooAAPKV
>C5
MQQANLGooooTARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAH
APKYNDRSVGIVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGVoSSTKAPVEPHVHPQA
ATQoooQTPPKSPPooooAAPKV
>C6
MQHANLGDGAATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVC
YTTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISGWPHFTHLNATEGSoooTPVPIEPHAHPQA
ASQTPPQSPPQSPPHAPAAAPKV
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 696 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480080183
Setting output file names to "/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 830289532
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 6551251364
Seed = 649379904
Swapseed = 1480080183
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 28 unique site patterns
Division 2 has 28 unique site patterns
Division 3 has 65 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2022.974903 -- -24.965149
Chain 2 -- -2051.453545 -- -24.965149
Chain 3 -- -2033.206297 -- -24.965149
Chain 4 -- -2071.121421 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2073.491300 -- -24.965149
Chain 2 -- -2022.622852 -- -24.965149
Chain 3 -- -2040.088916 -- -24.965149
Chain 4 -- -2008.456294 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2022.975] (-2051.454) (-2033.206) (-2071.121) * [-2073.491] (-2022.623) (-2040.089) (-2008.456)
500 -- (-1739.239) (-1733.777) [-1721.365] (-1721.273) * (-1730.607) [-1725.605] (-1742.685) (-1735.765) -- 0:00:00
1000 -- (-1720.189) [-1710.300] (-1712.908) (-1728.138) * [-1722.898] (-1720.465) (-1739.999) (-1719.722) -- 0:00:00
1500 -- (-1722.146) [-1709.678] (-1704.138) (-1711.518) * [-1716.972] (-1702.155) (-1717.554) (-1708.248) -- 0:00:00
2000 -- (-1696.827) [-1694.854] (-1697.101) (-1710.758) * [-1703.605] (-1704.342) (-1709.874) (-1714.381) -- 0:00:00
2500 -- (-1694.035) [-1697.093] (-1693.777) (-1709.054) * [-1698.931] (-1698.612) (-1705.512) (-1706.803) -- 0:00:00
3000 -- (-1690.378) (-1695.747) [-1693.487] (-1697.000) * (-1700.614) [-1695.113] (-1708.030) (-1706.617) -- 0:00:00
3500 -- (-1697.012) [-1694.896] (-1700.178) (-1702.265) * (-1694.000) (-1699.522) [-1700.352] (-1701.180) -- 0:00:00
4000 -- [-1693.009] (-1692.727) (-1698.774) (-1698.981) * (-1693.256) [-1692.747] (-1694.674) (-1711.439) -- 0:04:09
4500 -- (-1694.986) (-1696.941) [-1693.905] (-1701.660) * (-1696.791) [-1692.265] (-1691.516) (-1704.994) -- 0:03:41
5000 -- [-1692.950] (-1697.266) (-1696.128) (-1700.735) * (-1693.488) [-1695.343] (-1692.806) (-1702.152) -- 0:03:19
Average standard deviation of split frequencies: 0.031427
5500 -- (-1694.873) [-1694.032] (-1695.208) (-1697.994) * (-1699.935) [-1701.363] (-1699.084) (-1697.691) -- 0:03:00
6000 -- [-1696.954] (-1697.011) (-1698.289) (-1704.178) * (-1691.298) (-1697.525) [-1697.343] (-1700.727) -- 0:02:45
6500 -- (-1695.554) (-1701.198) [-1698.625] (-1697.242) * (-1703.104) [-1695.562] (-1698.481) (-1695.819) -- 0:02:32
7000 -- (-1695.550) (-1694.063) [-1699.763] (-1701.454) * (-1696.465) [-1696.438] (-1695.258) (-1703.221) -- 0:02:21
7500 -- (-1698.617) (-1699.203) (-1696.957) [-1702.659] * (-1696.108) (-1692.095) (-1692.580) [-1694.286] -- 0:02:12
8000 -- (-1694.568) (-1704.306) (-1696.523) [-1694.990] * [-1693.904] (-1701.048) (-1697.448) (-1696.449) -- 0:04:08
8500 -- [-1692.759] (-1694.109) (-1705.893) (-1698.969) * (-1697.656) [-1690.682] (-1697.218) (-1697.523) -- 0:03:53
9000 -- (-1693.894) [-1692.366] (-1709.585) (-1692.662) * (-1698.462) (-1691.906) (-1704.574) [-1696.938] -- 0:03:40
9500 -- (-1699.364) [-1693.105] (-1699.486) (-1695.230) * [-1696.936] (-1694.913) (-1700.344) (-1697.940) -- 0:03:28
10000 -- (-1692.065) (-1699.233) (-1692.122) [-1693.950] * [-1702.462] (-1698.247) (-1703.819) (-1702.690) -- 0:03:18
Average standard deviation of split frequencies: 0.022097
10500 -- (-1699.248) [-1698.679] (-1698.882) (-1691.850) * (-1705.708) [-1692.190] (-1701.395) (-1693.465) -- 0:03:08
11000 -- (-1694.258) (-1705.717) (-1700.289) [-1693.460] * (-1716.261) [-1695.629] (-1701.196) (-1696.107) -- 0:02:59
11500 -- (-1694.322) [-1698.834] (-1705.969) (-1701.649) * (-1696.646) [-1695.514] (-1707.708) (-1699.549) -- 0:02:51
12000 -- [-1696.005] (-1697.617) (-1707.961) (-1700.752) * (-1698.162) (-1694.580) (-1699.816) [-1697.801] -- 0:04:07
12500 -- (-1703.198) [-1692.375] (-1695.330) (-1697.715) * (-1698.455) (-1696.393) [-1697.436] (-1692.788) -- 0:03:57
13000 -- (-1702.563) [-1696.358] (-1692.814) (-1694.661) * (-1692.793) [-1690.396] (-1699.291) (-1696.057) -- 0:03:47
13500 -- (-1705.003) [-1698.288] (-1698.071) (-1693.950) * [-1690.756] (-1694.890) (-1698.526) (-1694.947) -- 0:03:39
14000 -- (-1701.929) [-1693.942] (-1696.607) (-1703.672) * (-1695.169) [-1693.427] (-1694.287) (-1700.480) -- 0:03:31
14500 -- (-1696.915) [-1695.820] (-1701.361) (-1695.315) * (-1695.662) (-1696.627) [-1690.939] (-1697.183) -- 0:03:23
15000 -- (-1693.549) (-1694.532) (-1694.369) [-1692.631] * (-1700.575) [-1696.453] (-1696.732) (-1695.275) -- 0:03:17
Average standard deviation of split frequencies: 0.014731
15500 -- (-1692.436) (-1702.423) [-1692.825] (-1695.252) * (-1697.156) (-1698.860) (-1693.132) [-1694.800] -- 0:03:10
16000 -- (-1694.058) (-1695.125) (-1702.157) [-1694.623] * (-1693.469) (-1695.093) [-1697.565] (-1693.900) -- 0:04:06
16500 -- (-1697.311) (-1700.616) (-1698.790) [-1693.888] * (-1696.873) (-1702.023) (-1699.543) [-1698.198] -- 0:03:58
17000 -- (-1693.605) (-1695.257) (-1700.941) [-1693.733] * (-1690.467) (-1694.234) [-1696.191] (-1706.692) -- 0:03:51
17500 -- [-1696.742] (-1694.738) (-1703.629) (-1693.752) * (-1695.446) [-1692.927] (-1695.929) (-1704.936) -- 0:03:44
18000 -- [-1698.096] (-1693.634) (-1692.607) (-1697.525) * (-1700.684) (-1698.166) [-1697.298] (-1692.516) -- 0:03:38
18500 -- (-1693.692) [-1695.780] (-1693.863) (-1693.110) * (-1692.773) (-1697.989) (-1699.146) [-1691.753] -- 0:03:32
19000 -- (-1694.817) (-1690.377) (-1696.585) [-1692.304] * (-1693.354) [-1697.733] (-1695.243) (-1704.804) -- 0:03:26
19500 -- [-1696.263] (-1700.106) (-1694.938) (-1691.553) * [-1695.215] (-1706.422) (-1695.917) (-1696.970) -- 0:03:21
20000 -- (-1704.778) (-1693.206) (-1704.999) [-1697.144] * (-1696.400) (-1706.888) (-1695.950) [-1700.803] -- 0:04:05
Average standard deviation of split frequencies: 0.022810
20500 -- (-1700.269) (-1699.824) (-1699.994) [-1696.998] * (-1700.940) [-1694.757] (-1693.232) (-1697.285) -- 0:03:58
21000 -- (-1695.133) (-1700.429) (-1700.455) [-1702.747] * (-1710.418) (-1697.872) (-1701.898) [-1700.124] -- 0:03:53
21500 -- (-1689.027) [-1692.570] (-1700.249) (-1695.718) * (-1695.057) (-1699.675) [-1692.284] (-1701.621) -- 0:03:47
22000 -- (-1697.526) [-1695.368] (-1700.170) (-1696.623) * (-1694.330) (-1697.300) (-1696.607) [-1691.617] -- 0:03:42
22500 -- (-1696.193) (-1693.242) (-1698.044) [-1698.161] * [-1695.837] (-1698.244) (-1700.578) (-1691.998) -- 0:03:37
23000 -- [-1696.378] (-1696.758) (-1699.619) (-1701.907) * (-1694.766) (-1695.674) (-1696.655) [-1695.499] -- 0:03:32
23500 -- (-1700.315) (-1695.756) [-1693.651] (-1697.562) * [-1695.190] (-1697.845) (-1701.219) (-1701.818) -- 0:03:27
24000 -- (-1701.227) (-1694.018) (-1703.443) [-1694.882] * (-1695.557) (-1700.009) [-1691.431] (-1693.288) -- 0:04:04
24500 -- (-1694.571) (-1695.685) (-1701.515) [-1694.950] * (-1696.803) (-1707.969) (-1697.373) [-1694.895] -- 0:03:58
25000 -- (-1698.012) [-1699.278] (-1694.752) (-1701.757) * (-1700.892) (-1699.887) [-1691.767] (-1697.669) -- 0:03:54
Average standard deviation of split frequencies: 0.032636
25500 -- (-1693.067) (-1694.810) (-1699.053) [-1694.625] * (-1702.065) [-1691.406] (-1697.301) (-1699.548) -- 0:03:49
26000 -- (-1697.808) (-1702.767) (-1699.834) [-1691.218] * [-1699.032] (-1710.553) (-1696.329) (-1702.096) -- 0:03:44
26500 -- (-1702.231) (-1697.855) [-1692.577] (-1701.797) * (-1697.508) (-1700.703) (-1696.132) [-1694.306] -- 0:03:40
27000 -- (-1696.668) (-1696.189) [-1700.114] (-1704.554) * [-1696.034] (-1692.653) (-1698.423) (-1699.154) -- 0:03:36
27500 -- (-1696.016) [-1692.607] (-1695.695) (-1691.643) * (-1702.312) [-1695.724] (-1697.531) (-1701.608) -- 0:03:32
28000 -- (-1703.074) [-1694.511] (-1695.795) (-1701.210) * [-1700.876] (-1690.702) (-1697.168) (-1695.061) -- 0:04:03
28500 -- [-1700.465] (-1699.652) (-1696.330) (-1696.018) * (-1697.077) (-1691.883) [-1697.820] (-1696.087) -- 0:03:58
29000 -- (-1694.823) (-1692.566) [-1698.790] (-1696.075) * [-1697.137] (-1701.755) (-1693.933) (-1694.927) -- 0:03:54
29500 -- (-1695.420) (-1696.094) [-1697.448] (-1702.346) * [-1696.082] (-1704.077) (-1697.166) (-1702.401) -- 0:03:50
30000 -- (-1694.889) [-1700.651] (-1699.053) (-1699.301) * (-1695.221) [-1694.024] (-1697.777) (-1702.971) -- 0:03:46
Average standard deviation of split frequencies: 0.039967
30500 -- (-1694.596) [-1697.409] (-1697.041) (-1699.842) * (-1694.448) [-1694.653] (-1699.224) (-1696.524) -- 0:03:42
31000 -- (-1701.480) (-1701.041) (-1698.330) [-1693.503] * (-1697.398) (-1696.521) [-1698.592] (-1699.107) -- 0:03:38
31500 -- (-1699.877) [-1697.985] (-1694.785) (-1694.848) * (-1701.242) (-1703.146) (-1695.801) [-1694.509] -- 0:04:05
32000 -- [-1699.646] (-1698.364) (-1695.428) (-1691.379) * [-1695.773] (-1703.037) (-1693.558) (-1695.841) -- 0:04:02
32500 -- (-1702.582) (-1693.582) (-1696.868) [-1696.769] * (-1694.779) (-1704.526) (-1698.305) [-1703.929] -- 0:03:58
33000 -- (-1701.533) (-1700.675) (-1698.445) [-1695.299] * (-1699.487) (-1704.709) [-1695.101] (-1705.280) -- 0:03:54
33500 -- (-1704.192) [-1690.695] (-1695.924) (-1697.486) * (-1692.359) (-1701.412) [-1696.200] (-1692.836) -- 0:03:50
34000 -- [-1699.307] (-1698.250) (-1694.170) (-1698.751) * (-1699.574) (-1707.626) [-1697.407] (-1692.399) -- 0:03:47
34500 -- [-1697.707] (-1698.838) (-1697.904) (-1692.560) * (-1695.059) (-1698.822) (-1694.629) [-1694.538] -- 0:03:43
35000 -- (-1701.279) (-1697.588) (-1696.655) [-1693.583] * [-1706.377] (-1698.230) (-1698.283) (-1702.247) -- 0:03:40
Average standard deviation of split frequencies: 0.052378
35500 -- (-1703.078) (-1692.827) [-1695.986] (-1693.997) * (-1705.407) (-1692.742) [-1691.635] (-1698.586) -- 0:04:04
36000 -- [-1695.379] (-1702.658) (-1692.047) (-1696.542) * (-1701.567) (-1694.004) [-1700.951] (-1702.191) -- 0:04:01
36500 -- (-1698.828) [-1699.019] (-1697.831) (-1697.038) * (-1699.944) (-1696.010) [-1697.032] (-1694.933) -- 0:03:57
37000 -- (-1694.712) [-1698.652] (-1696.167) (-1699.702) * (-1702.531) (-1693.126) [-1698.667] (-1690.882) -- 0:03:54
37500 -- (-1699.111) [-1694.797] (-1695.070) (-1695.355) * (-1695.782) [-1694.631] (-1694.102) (-1694.947) -- 0:03:51
38000 -- (-1697.008) (-1700.344) [-1692.111] (-1696.236) * (-1698.647) [-1699.408] (-1703.502) (-1699.498) -- 0:03:47
38500 -- (-1698.563) (-1709.077) [-1694.844] (-1693.147) * (-1701.241) (-1700.202) [-1702.306] (-1701.827) -- 0:03:44
39000 -- (-1707.625) (-1707.912) (-1692.182) [-1694.635] * (-1692.216) (-1704.715) (-1696.929) [-1695.157] -- 0:03:41
39500 -- (-1697.680) (-1703.730) (-1693.727) [-1697.602] * [-1694.753] (-1702.938) (-1693.180) (-1699.665) -- 0:04:03
40000 -- [-1694.068] (-1703.173) (-1696.545) (-1693.801) * [-1693.424] (-1697.260) (-1697.918) (-1701.481) -- 0:04:00
Average standard deviation of split frequencies: 0.053323
40500 -- [-1690.866] (-1698.370) (-1698.349) (-1698.382) * [-1698.281] (-1695.214) (-1692.418) (-1700.684) -- 0:03:56
41000 -- [-1690.637] (-1697.347) (-1702.155) (-1696.481) * [-1693.648] (-1697.813) (-1700.307) (-1693.036) -- 0:03:53
41500 -- (-1700.942) (-1697.087) (-1693.002) [-1694.117] * (-1698.283) [-1693.515] (-1700.386) (-1696.744) -- 0:03:50
42000 -- (-1698.948) [-1690.361] (-1694.832) (-1693.972) * (-1691.577) [-1692.784] (-1704.924) (-1694.929) -- 0:03:48
42500 -- (-1694.838) (-1697.476) [-1696.454] (-1699.575) * (-1699.493) [-1693.524] (-1698.794) (-1698.108) -- 0:03:45
43000 -- (-1701.813) (-1692.067) [-1696.798] (-1701.544) * (-1697.864) (-1697.886) (-1707.133) [-1696.201] -- 0:03:42
43500 -- (-1699.333) [-1697.056] (-1701.255) (-1703.334) * [-1694.805] (-1690.126) (-1694.626) (-1706.614) -- 0:04:01
44000 -- (-1696.180) (-1697.079) [-1690.537] (-1699.634) * (-1702.598) [-1694.588] (-1704.404) (-1697.083) -- 0:03:59
44500 -- [-1703.843] (-1697.024) (-1702.920) (-1694.796) * [-1692.872] (-1694.071) (-1701.093) (-1696.530) -- 0:03:56
45000 -- [-1705.718] (-1694.977) (-1692.264) (-1698.523) * (-1699.947) (-1701.124) (-1699.705) [-1702.286] -- 0:03:53
Average standard deviation of split frequencies: 0.036893
45500 -- (-1702.438) [-1692.176] (-1694.199) (-1691.392) * (-1697.781) (-1698.304) (-1695.143) [-1693.625] -- 0:03:50
46000 -- (-1699.466) (-1691.635) (-1701.169) [-1697.588] * (-1699.522) (-1702.478) (-1696.720) [-1692.807] -- 0:03:48
46500 -- (-1694.967) (-1693.991) (-1696.206) [-1691.810] * [-1697.480] (-1694.130) (-1696.920) (-1700.310) -- 0:03:45
47000 -- (-1702.615) (-1695.398) [-1692.568] (-1699.369) * [-1701.587] (-1694.409) (-1701.736) (-1698.371) -- 0:03:43
47500 -- (-1698.973) (-1702.935) [-1689.647] (-1702.787) * (-1692.580) (-1696.734) (-1697.001) [-1703.544] -- 0:04:00
48000 -- (-1698.844) [-1694.683] (-1690.468) (-1696.518) * (-1697.008) [-1696.314] (-1701.245) (-1697.597) -- 0:03:58
48500 -- (-1698.148) [-1691.471] (-1696.800) (-1701.193) * (-1696.295) (-1696.826) (-1699.583) [-1701.873] -- 0:03:55
49000 -- (-1696.978) (-1702.274) [-1701.997] (-1702.864) * (-1690.509) (-1704.172) (-1704.167) [-1695.444] -- 0:03:52
49500 -- (-1694.493) [-1693.201] (-1695.384) (-1697.757) * (-1694.341) (-1699.014) [-1697.135] (-1693.938) -- 0:03:50
50000 -- (-1697.567) [-1699.515] (-1700.506) (-1694.449) * (-1699.036) (-1692.705) [-1691.966] (-1698.925) -- 0:03:48
Average standard deviation of split frequencies: 0.029773
50500 -- (-1701.321) (-1700.682) [-1698.232] (-1696.477) * [-1708.362] (-1698.559) (-1694.980) (-1701.029) -- 0:03:45
51000 -- (-1696.444) [-1696.197] (-1693.697) (-1691.645) * (-1701.420) (-1697.405) [-1696.664] (-1691.261) -- 0:03:43
51500 -- (-1695.929) (-1695.339) (-1694.202) [-1694.825] * (-1704.252) (-1698.198) [-1696.007] (-1706.203) -- 0:03:59
52000 -- (-1697.166) (-1697.861) (-1698.429) [-1695.401] * (-1699.732) (-1695.368) (-1697.881) [-1700.435] -- 0:03:57
52500 -- (-1697.137) [-1694.623] (-1696.837) (-1697.463) * [-1694.979] (-1690.626) (-1698.296) (-1698.662) -- 0:03:54
53000 -- (-1698.503) (-1698.542) (-1697.057) [-1693.656] * (-1699.325) (-1693.543) [-1692.915] (-1697.699) -- 0:03:52
53500 -- (-1693.334) (-1700.377) [-1693.884] (-1692.919) * (-1700.920) (-1697.533) [-1689.384] (-1701.511) -- 0:03:49
54000 -- [-1693.888] (-1697.860) (-1698.854) (-1696.446) * (-1693.507) [-1690.630] (-1692.751) (-1693.156) -- 0:03:47
54500 -- (-1697.097) (-1693.562) (-1694.728) [-1696.937] * (-1700.260) (-1701.437) (-1695.850) [-1692.783] -- 0:03:45
55000 -- (-1694.788) [-1698.516] (-1691.522) (-1698.002) * (-1699.911) [-1696.587] (-1695.175) (-1701.082) -- 0:03:43
Average standard deviation of split frequencies: 0.025254
55500 -- (-1702.497) (-1702.485) (-1691.763) [-1702.326] * (-1690.215) (-1700.734) (-1695.168) [-1693.057] -- 0:03:58
56000 -- (-1698.410) (-1696.170) [-1694.373] (-1698.870) * (-1691.878) [-1694.218] (-1700.530) (-1700.500) -- 0:03:56
56500 -- (-1695.179) [-1693.355] (-1699.310) (-1695.145) * [-1697.082] (-1700.379) (-1692.707) (-1698.017) -- 0:03:53
57000 -- [-1699.603] (-1696.663) (-1693.191) (-1695.852) * [-1692.927] (-1694.626) (-1697.633) (-1700.856) -- 0:03:51
57500 -- (-1695.755) (-1702.101) (-1696.545) [-1698.088] * (-1698.048) [-1696.367] (-1697.501) (-1702.786) -- 0:03:49
58000 -- (-1696.565) (-1700.621) (-1702.314) [-1690.752] * (-1702.838) (-1694.049) [-1694.655] (-1700.507) -- 0:03:47
58500 -- [-1696.695] (-1703.135) (-1700.383) (-1693.774) * (-1696.330) [-1693.519] (-1700.267) (-1693.999) -- 0:03:45
59000 -- (-1700.202) (-1704.802) [-1692.248] (-1701.794) * (-1693.704) [-1695.790] (-1693.935) (-1693.376) -- 0:03:43
59500 -- (-1696.124) (-1692.909) [-1693.826] (-1696.774) * (-1696.514) (-1703.738) (-1700.879) [-1692.278] -- 0:03:57
60000 -- [-1697.849] (-1701.119) (-1692.680) (-1698.770) * (-1697.978) (-1698.034) [-1692.681] (-1697.327) -- 0:03:55
Average standard deviation of split frequencies: 0.026419
60500 -- (-1700.207) (-1700.193) (-1697.524) [-1694.253] * (-1704.357) (-1697.588) [-1696.461] (-1696.616) -- 0:03:52
61000 -- (-1698.985) [-1700.517] (-1702.273) (-1698.832) * (-1694.902) (-1696.351) [-1691.265] (-1696.180) -- 0:03:50
61500 -- (-1695.063) (-1703.885) [-1699.110] (-1696.214) * (-1703.003) [-1696.350] (-1696.638) (-1702.911) -- 0:03:48
62000 -- (-1694.426) (-1698.276) [-1698.102] (-1696.709) * (-1691.290) (-1698.753) (-1693.903) [-1700.365] -- 0:03:46
62500 -- (-1697.254) (-1704.183) [-1697.144] (-1696.450) * (-1695.413) (-1697.091) (-1701.482) [-1695.385] -- 0:03:45
63000 -- (-1701.309) [-1698.387] (-1695.517) (-1703.433) * (-1689.390) [-1700.501] (-1695.684) (-1692.936) -- 0:03:43
63500 -- (-1699.639) (-1693.649) (-1702.770) [-1695.521] * (-1692.673) [-1698.532] (-1691.958) (-1693.655) -- 0:03:55
64000 -- [-1693.249] (-1698.431) (-1699.908) (-1707.582) * (-1692.520) [-1696.517] (-1694.041) (-1704.514) -- 0:03:54
64500 -- [-1696.346] (-1706.987) (-1697.133) (-1702.254) * (-1693.597) (-1695.540) [-1692.191] (-1702.457) -- 0:03:52
65000 -- (-1695.528) [-1700.295] (-1697.817) (-1698.322) * [-1700.418] (-1696.595) (-1696.936) (-1701.019) -- 0:03:50
Average standard deviation of split frequencies: 0.018570
65500 -- [-1693.896] (-1693.952) (-1694.913) (-1696.413) * [-1692.108] (-1695.717) (-1695.234) (-1698.522) -- 0:03:48
66000 -- (-1694.510) (-1695.212) (-1699.983) [-1699.176] * (-1698.773) (-1697.890) [-1693.306] (-1702.404) -- 0:03:46
66500 -- (-1695.794) [-1698.400] (-1693.848) (-1699.763) * (-1700.336) (-1695.214) [-1693.363] (-1702.925) -- 0:03:44
67000 -- [-1696.306] (-1696.872) (-1703.161) (-1701.708) * [-1698.767] (-1699.105) (-1693.890) (-1696.310) -- 0:03:42
67500 -- (-1696.457) [-1699.099] (-1704.276) (-1701.190) * [-1701.443] (-1701.921) (-1693.790) (-1697.842) -- 0:03:54
68000 -- [-1692.893] (-1701.851) (-1696.439) (-1693.190) * (-1703.231) [-1692.677] (-1702.626) (-1701.933) -- 0:03:53
68500 -- (-1696.268) (-1695.804) (-1702.784) [-1695.676] * (-1699.676) (-1697.334) [-1693.126] (-1698.311) -- 0:03:51
69000 -- [-1695.587] (-1705.400) (-1703.951) (-1699.182) * (-1697.606) (-1697.005) (-1696.737) [-1705.471] -- 0:03:49
69500 -- (-1695.368) (-1701.486) (-1708.095) [-1694.624] * (-1701.502) (-1703.623) (-1698.391) [-1700.685] -- 0:03:47
70000 -- (-1697.197) (-1701.239) [-1696.943] (-1696.013) * (-1700.216) (-1698.691) [-1695.098] (-1700.948) -- 0:03:45
Average standard deviation of split frequencies: 0.018345
70500 -- (-1697.003) (-1697.638) (-1694.514) [-1692.383] * (-1698.993) (-1695.282) [-1697.112] (-1705.366) -- 0:03:44
71000 -- (-1698.689) (-1693.319) (-1711.987) [-1694.425] * (-1695.149) [-1695.256] (-1699.993) (-1698.905) -- 0:03:42
71500 -- (-1698.955) (-1703.065) [-1697.607] (-1696.115) * (-1696.319) (-1696.314) (-1696.619) [-1699.868] -- 0:03:53
72000 -- (-1695.850) [-1692.395] (-1700.644) (-1696.535) * (-1701.566) [-1696.969] (-1703.581) (-1693.530) -- 0:03:52
72500 -- (-1693.963) (-1698.832) [-1697.511] (-1694.780) * [-1699.424] (-1695.253) (-1700.597) (-1697.867) -- 0:03:50
73000 -- (-1697.274) (-1698.678) (-1696.096) [-1694.310] * (-1695.413) (-1695.894) [-1699.206] (-1695.884) -- 0:03:48
73500 -- (-1690.686) (-1699.679) [-1696.858] (-1697.821) * (-1694.335) (-1694.561) (-1698.259) [-1696.266] -- 0:03:46
74000 -- [-1693.724] (-1706.440) (-1696.614) (-1701.757) * (-1697.815) (-1693.547) [-1702.479] (-1700.569) -- 0:03:45
74500 -- (-1704.225) (-1702.289) [-1693.600] (-1703.377) * (-1696.392) [-1692.653] (-1695.199) (-1700.701) -- 0:03:43
75000 -- [-1691.925] (-1700.666) (-1692.036) (-1698.691) * (-1696.691) (-1694.267) (-1698.514) [-1695.658] -- 0:03:42
Average standard deviation of split frequencies: 0.007753
75500 -- (-1699.224) (-1708.222) [-1693.391] (-1695.585) * (-1697.510) (-1695.371) [-1696.126] (-1696.309) -- 0:03:52
76000 -- [-1695.272] (-1696.115) (-1699.849) (-1704.658) * (-1701.232) (-1700.538) (-1696.223) [-1694.855] -- 0:03:51
76500 -- (-1698.256) [-1705.036] (-1698.256) (-1697.804) * (-1691.515) [-1699.273] (-1696.370) (-1697.573) -- 0:03:49
77000 -- [-1695.827] (-1704.668) (-1696.638) (-1695.744) * (-1696.449) (-1702.712) (-1699.330) [-1700.643] -- 0:03:47
77500 -- (-1700.792) (-1707.032) [-1694.037] (-1690.862) * [-1700.107] (-1700.080) (-1692.457) (-1695.959) -- 0:03:46
78000 -- (-1697.735) [-1700.376] (-1699.971) (-1696.162) * [-1699.260] (-1698.218) (-1699.932) (-1698.322) -- 0:03:44
78500 -- (-1695.003) [-1697.268] (-1695.895) (-1698.108) * (-1695.499) (-1695.824) [-1694.584] (-1695.389) -- 0:03:43
79000 -- (-1696.044) (-1699.466) (-1701.229) [-1697.007] * [-1697.140] (-1700.832) (-1695.415) (-1692.835) -- 0:03:41
79500 -- (-1698.055) [-1697.821] (-1702.632) (-1700.125) * (-1697.334) [-1695.656] (-1696.082) (-1692.173) -- 0:03:51
80000 -- [-1695.338] (-1689.265) (-1701.346) (-1695.011) * (-1695.573) (-1698.599) (-1695.901) [-1692.280] -- 0:03:50
Average standard deviation of split frequencies: 0.016071
80500 -- (-1699.571) [-1691.437] (-1705.028) (-1704.510) * (-1692.420) (-1704.286) (-1697.983) [-1697.668] -- 0:03:48
81000 -- (-1697.014) [-1694.462] (-1703.910) (-1700.644) * (-1697.571) (-1704.782) [-1696.668] (-1698.667) -- 0:03:46
81500 -- (-1700.891) (-1692.233) (-1708.371) [-1698.805] * (-1693.561) [-1695.307] (-1702.919) (-1695.551) -- 0:03:45
82000 -- (-1693.919) (-1692.995) [-1698.082] (-1694.504) * (-1696.065) [-1694.226] (-1696.585) (-1697.299) -- 0:03:43
82500 -- (-1696.617) (-1692.036) (-1696.227) [-1696.352] * (-1693.621) (-1696.844) [-1698.431] (-1701.221) -- 0:03:42
83000 -- [-1692.196] (-1694.704) (-1696.689) (-1691.466) * [-1698.581] (-1699.731) (-1698.250) (-1700.197) -- 0:03:40
83500 -- (-1694.688) (-1697.356) (-1698.008) [-1701.100] * (-1693.504) (-1696.865) (-1691.268) [-1697.091] -- 0:03:50
84000 -- (-1707.516) [-1693.856] (-1700.474) (-1703.535) * (-1698.715) [-1694.998] (-1697.380) (-1697.668) -- 0:03:49
84500 -- (-1696.942) [-1694.382] (-1695.439) (-1700.692) * (-1695.307) (-1707.724) [-1703.556] (-1699.235) -- 0:03:47
85000 -- (-1701.124) (-1700.374) [-1698.647] (-1694.644) * [-1704.910] (-1691.739) (-1700.259) (-1702.081) -- 0:03:46
Average standard deviation of split frequencies: 0.013704
85500 -- (-1702.619) [-1693.477] (-1699.360) (-1694.009) * (-1696.520) (-1692.286) [-1692.540] (-1705.779) -- 0:03:44
86000 -- (-1699.378) (-1700.068) (-1699.326) [-1691.153] * [-1699.253] (-1698.704) (-1697.099) (-1697.600) -- 0:03:43
86500 -- (-1693.996) [-1696.262] (-1697.946) (-1692.719) * (-1698.217) [-1695.360] (-1698.123) (-1700.274) -- 0:03:41
87000 -- (-1699.110) [-1693.231] (-1706.007) (-1694.829) * (-1699.124) (-1695.026) [-1695.566] (-1694.553) -- 0:03:40
87500 -- (-1700.504) (-1695.141) [-1695.454] (-1696.247) * [-1699.512] (-1695.892) (-1696.911) (-1692.171) -- 0:03:49
88000 -- [-1699.732] (-1703.681) (-1706.823) (-1698.326) * [-1696.602] (-1694.027) (-1694.510) (-1691.777) -- 0:03:48
88500 -- [-1695.685] (-1701.083) (-1699.795) (-1699.458) * (-1700.669) (-1698.883) [-1692.409] (-1695.057) -- 0:03:46
89000 -- [-1700.561] (-1696.835) (-1702.533) (-1704.750) * (-1698.636) (-1700.131) (-1695.466) [-1697.647] -- 0:03:45
89500 -- (-1698.259) (-1694.347) (-1696.568) [-1703.802] * (-1700.188) [-1697.842] (-1697.784) (-1691.367) -- 0:03:43
90000 -- (-1696.775) (-1697.076) [-1689.699] (-1699.769) * (-1706.666) (-1699.991) (-1705.546) [-1697.949] -- 0:03:42
Average standard deviation of split frequencies: 0.010399
90500 -- (-1700.511) [-1691.011] (-1700.636) (-1700.016) * (-1698.565) (-1694.360) [-1698.400] (-1698.083) -- 0:03:41
91000 -- [-1695.321] (-1697.833) (-1697.687) (-1702.253) * (-1700.689) (-1699.710) (-1700.793) [-1697.680] -- 0:03:39
91500 -- (-1696.204) (-1694.817) [-1692.016] (-1705.272) * (-1702.580) (-1700.250) (-1708.729) [-1697.722] -- 0:03:48
92000 -- (-1697.517) [-1693.944] (-1695.759) (-1700.616) * [-1702.860] (-1698.731) (-1709.614) (-1699.197) -- 0:03:47
92500 -- (-1697.179) (-1697.765) [-1698.923] (-1703.575) * (-1697.825) [-1694.764] (-1703.238) (-1700.319) -- 0:03:45
93000 -- (-1699.927) [-1697.785] (-1695.445) (-1694.435) * (-1694.821) [-1699.444] (-1696.310) (-1699.284) -- 0:03:44
93500 -- (-1700.300) (-1699.428) [-1694.019] (-1702.648) * [-1695.442] (-1692.692) (-1703.630) (-1699.486) -- 0:03:42
94000 -- [-1703.747] (-1696.554) (-1702.818) (-1710.881) * [-1692.016] (-1697.430) (-1693.704) (-1698.713) -- 0:03:41
94500 -- (-1694.621) (-1697.664) [-1696.139] (-1703.007) * [-1694.419] (-1699.358) (-1698.146) (-1699.987) -- 0:03:40
95000 -- (-1697.762) (-1698.598) (-1699.621) [-1698.907] * (-1691.104) (-1705.236) [-1694.158] (-1702.816) -- 0:03:39
Average standard deviation of split frequencies: 0.017187
95500 -- [-1697.800] (-1702.352) (-1702.111) (-1696.909) * [-1691.300] (-1700.116) (-1696.517) (-1697.015) -- 0:03:47
96000 -- (-1694.285) (-1699.087) (-1700.788) [-1698.871] * (-1694.825) [-1696.415] (-1696.386) (-1697.086) -- 0:03:46
96500 -- [-1697.600] (-1698.179) (-1699.781) (-1701.427) * [-1698.700] (-1695.987) (-1693.194) (-1700.854) -- 0:03:44
97000 -- (-1701.633) (-1694.547) (-1696.419) [-1696.562] * (-1694.375) (-1704.928) (-1697.433) [-1699.483] -- 0:03:43
97500 -- (-1692.865) (-1700.374) (-1692.718) [-1693.622] * (-1700.984) (-1702.148) [-1695.716] (-1697.512) -- 0:03:42
98000 -- (-1693.289) (-1696.607) [-1694.877] (-1692.975) * [-1692.671] (-1703.014) (-1693.764) (-1700.747) -- 0:03:40
98500 -- [-1697.962] (-1708.983) (-1700.607) (-1697.097) * (-1697.028) (-1699.123) [-1694.837] (-1695.164) -- 0:03:39
99000 -- (-1695.543) [-1694.113] (-1696.189) (-1704.484) * (-1700.829) [-1701.194] (-1693.098) (-1706.392) -- 0:03:38
99500 -- (-1696.246) (-1694.685) [-1697.544] (-1700.350) * [-1697.699] (-1700.880) (-1694.595) (-1702.659) -- 0:03:46
100000 -- (-1694.397) (-1695.403) (-1706.858) [-1697.221] * (-1697.632) [-1703.223] (-1694.455) (-1707.744) -- 0:03:45
Average standard deviation of split frequencies: 0.014048
100500 -- (-1700.202) [-1697.452] (-1699.259) (-1696.906) * [-1698.365] (-1703.683) (-1698.311) (-1696.185) -- 0:03:43
101000 -- (-1693.802) (-1694.546) [-1698.298] (-1693.597) * [-1696.889] (-1696.659) (-1694.854) (-1693.657) -- 0:03:42
101500 -- (-1704.820) (-1692.111) [-1697.141] (-1691.606) * (-1696.710) [-1699.237] (-1702.087) (-1702.678) -- 0:03:41
102000 -- [-1700.254] (-1693.790) (-1696.950) (-1697.427) * (-1694.880) (-1700.216) [-1697.758] (-1702.225) -- 0:03:40
102500 -- [-1694.771] (-1701.762) (-1694.178) (-1701.455) * (-1701.754) [-1700.785] (-1697.990) (-1696.116) -- 0:03:38
103000 -- (-1690.583) (-1703.323) [-1695.581] (-1690.975) * (-1692.849) (-1704.271) [-1694.392] (-1698.065) -- 0:03:37
103500 -- (-1695.879) [-1695.803] (-1695.052) (-1693.161) * (-1697.959) (-1696.717) (-1695.513) [-1692.916] -- 0:03:45
104000 -- [-1693.238] (-1698.145) (-1695.172) (-1696.301) * (-1693.515) (-1696.265) (-1700.919) [-1688.647] -- 0:03:44
104500 -- [-1694.228] (-1702.643) (-1702.479) (-1695.869) * (-1697.708) (-1697.867) (-1695.104) [-1692.710] -- 0:03:42
105000 -- (-1694.893) [-1707.785] (-1694.399) (-1696.170) * (-1699.203) (-1703.553) (-1698.018) [-1696.545] -- 0:03:41
Average standard deviation of split frequencies: 0.011118
105500 -- (-1699.573) (-1703.101) (-1699.052) [-1692.404] * (-1705.256) [-1692.716] (-1696.664) (-1698.452) -- 0:03:40
106000 -- (-1698.048) (-1705.535) (-1703.033) [-1703.758] * (-1697.957) (-1699.822) (-1698.561) [-1695.933] -- 0:03:39
106500 -- (-1696.902) (-1696.292) (-1696.313) [-1692.908] * (-1696.422) [-1693.967] (-1700.998) (-1693.558) -- 0:03:38
107000 -- (-1695.110) (-1694.194) [-1690.940] (-1695.294) * (-1696.880) [-1696.462] (-1700.991) (-1693.941) -- 0:03:45
107500 -- [-1694.713] (-1693.130) (-1693.692) (-1698.024) * (-1697.425) (-1699.113) (-1694.169) [-1697.902] -- 0:03:44
108000 -- (-1701.075) (-1692.910) [-1700.465] (-1703.661) * [-1697.211] (-1702.219) (-1699.352) (-1698.101) -- 0:03:43
108500 -- (-1701.278) (-1698.130) [-1698.468] (-1697.061) * (-1700.337) (-1697.106) (-1696.141) [-1693.739] -- 0:03:41
109000 -- [-1698.266] (-1700.653) (-1701.448) (-1702.771) * (-1709.498) (-1691.963) (-1695.894) [-1694.530] -- 0:03:40
109500 -- (-1696.937) (-1700.444) [-1697.277] (-1697.278) * (-1702.581) [-1695.105] (-1695.282) (-1694.666) -- 0:03:39
110000 -- (-1696.882) (-1699.863) (-1696.747) [-1695.241] * (-1703.541) [-1694.206] (-1694.439) (-1705.140) -- 0:03:38
Average standard deviation of split frequencies: 0.009584
110500 -- [-1699.210] (-1693.688) (-1699.538) (-1695.810) * (-1701.806) (-1701.202) (-1695.522) [-1696.557] -- 0:03:37
111000 -- (-1692.715) [-1692.937] (-1705.716) (-1696.319) * (-1705.233) [-1695.155] (-1700.472) (-1694.870) -- 0:03:44
111500 -- (-1702.883) (-1696.753) [-1694.688] (-1701.363) * (-1706.136) [-1697.101] (-1698.685) (-1697.013) -- 0:03:43
112000 -- (-1696.769) (-1696.628) [-1693.561] (-1702.125) * (-1697.293) [-1698.443] (-1695.623) (-1696.668) -- 0:03:42
112500 -- (-1700.507) [-1702.544] (-1696.308) (-1697.306) * (-1695.410) (-1695.429) (-1693.776) [-1694.263] -- 0:03:40
113000 -- (-1699.157) (-1701.112) (-1693.226) [-1693.437] * [-1703.570] (-1697.682) (-1696.891) (-1706.586) -- 0:03:39
113500 -- (-1701.224) (-1696.297) [-1694.882] (-1699.306) * (-1696.054) (-1698.478) [-1694.461] (-1693.346) -- 0:03:38
114000 -- (-1697.929) [-1698.878] (-1695.110) (-1701.289) * (-1698.608) [-1691.987] (-1697.844) (-1694.592) -- 0:03:37
114500 -- (-1699.497) (-1692.789) [-1693.817] (-1700.075) * (-1706.387) (-1693.137) (-1693.496) [-1698.078] -- 0:03:36
115000 -- (-1705.638) (-1694.897) [-1693.093] (-1701.944) * [-1697.471] (-1694.092) (-1692.962) (-1697.862) -- 0:03:43
Average standard deviation of split frequencies: 0.017271
115500 -- (-1703.343) (-1702.207) [-1696.149] (-1706.991) * (-1693.256) [-1692.515] (-1702.817) (-1700.326) -- 0:03:42
116000 -- (-1701.016) (-1703.698) [-1694.607] (-1701.073) * [-1692.877] (-1690.176) (-1703.655) (-1705.805) -- 0:03:41
116500 -- (-1697.658) (-1700.485) [-1696.548] (-1702.096) * [-1698.892] (-1695.664) (-1696.882) (-1695.539) -- 0:03:39
117000 -- [-1691.354] (-1708.847) (-1704.207) (-1700.217) * (-1697.329) (-1700.965) [-1690.752] (-1697.203) -- 0:03:38
117500 -- (-1694.184) (-1698.383) [-1700.420] (-1703.901) * (-1698.826) (-1695.445) (-1694.821) [-1693.871] -- 0:03:37
118000 -- (-1701.497) (-1701.001) (-1704.436) [-1696.149] * (-1701.658) [-1692.187] (-1694.866) (-1702.035) -- 0:03:36
118500 -- (-1695.595) (-1696.758) (-1694.119) [-1699.934] * (-1696.841) [-1695.068] (-1700.065) (-1697.724) -- 0:03:35
119000 -- (-1699.514) (-1696.660) [-1694.517] (-1701.026) * (-1702.012) (-1699.199) (-1694.784) [-1695.047] -- 0:03:42
119500 -- (-1705.909) (-1700.454) [-1695.473] (-1697.231) * (-1698.037) (-1698.641) (-1692.495) [-1693.015] -- 0:03:41
120000 -- (-1696.876) (-1705.072) [-1698.971] (-1699.189) * [-1699.502] (-1703.511) (-1694.904) (-1695.838) -- 0:03:40
Average standard deviation of split frequencies: 0.019533
120500 -- [-1695.463] (-1695.741) (-1699.328) (-1708.014) * (-1698.133) [-1702.040] (-1693.288) (-1693.028) -- 0:03:38
121000 -- (-1698.148) [-1697.016] (-1700.564) (-1706.776) * [-1700.469] (-1705.903) (-1687.635) (-1700.190) -- 0:03:37
121500 -- (-1698.873) (-1696.176) (-1692.753) [-1701.055] * (-1695.116) (-1695.039) (-1697.620) [-1692.030] -- 0:03:36
122000 -- (-1694.407) (-1704.103) (-1696.667) [-1704.167] * [-1702.740] (-1694.572) (-1696.483) (-1696.792) -- 0:03:35
122500 -- (-1700.405) (-1695.180) [-1693.943] (-1695.329) * (-1693.572) (-1702.729) (-1704.038) [-1697.112] -- 0:03:34
123000 -- (-1700.538) [-1694.589] (-1700.485) (-1698.466) * (-1700.036) (-1695.047) (-1696.468) [-1694.084] -- 0:03:41
123500 -- (-1698.662) (-1697.485) [-1699.801] (-1700.141) * (-1691.278) (-1698.308) [-1695.102] (-1691.805) -- 0:03:40
124000 -- (-1697.693) (-1696.271) [-1697.312] (-1707.627) * (-1692.147) (-1696.441) [-1692.222] (-1699.566) -- 0:03:39
124500 -- (-1697.061) (-1703.533) [-1699.355] (-1699.006) * (-1697.276) (-1694.579) [-1701.050] (-1701.893) -- 0:03:37
125000 -- (-1703.558) (-1701.566) [-1692.055] (-1692.625) * (-1695.437) [-1698.021] (-1693.904) (-1696.713) -- 0:03:37
Average standard deviation of split frequencies: 0.015901
125500 -- (-1696.348) (-1693.726) (-1696.461) [-1700.015] * (-1697.294) [-1695.239] (-1694.227) (-1696.182) -- 0:03:36
126000 -- (-1698.073) [-1696.290] (-1700.019) (-1703.877) * (-1696.489) (-1693.380) (-1694.945) [-1696.267] -- 0:03:35
126500 -- (-1705.056) [-1699.531] (-1697.144) (-1702.668) * (-1691.687) [-1693.510] (-1704.488) (-1693.302) -- 0:03:34
127000 -- (-1699.247) (-1699.369) (-1700.405) [-1700.312] * (-1691.492) [-1695.014] (-1697.172) (-1698.988) -- 0:03:39
127500 -- (-1693.912) (-1692.398) (-1702.797) [-1702.848] * (-1692.901) (-1707.013) (-1692.484) [-1690.069] -- 0:03:38
128000 -- (-1695.803) [-1692.077] (-1694.528) (-1706.063) * [-1697.190] (-1698.414) (-1694.969) (-1693.554) -- 0:03:38
128500 -- [-1700.862] (-1699.925) (-1695.219) (-1707.602) * (-1692.920) [-1697.389] (-1698.641) (-1697.316) -- 0:03:37
129000 -- (-1706.124) [-1691.570] (-1698.047) (-1702.707) * [-1691.034] (-1700.568) (-1692.448) (-1694.446) -- 0:03:36
129500 -- (-1701.614) (-1694.105) (-1697.604) [-1697.851] * (-1696.615) (-1694.842) [-1694.642] (-1696.836) -- 0:03:35
130000 -- (-1701.098) (-1697.227) (-1699.131) [-1694.572] * (-1699.111) (-1694.321) (-1703.039) [-1697.950] -- 0:03:34
Average standard deviation of split frequencies: 0.011725
130500 -- (-1692.984) (-1694.169) (-1699.426) [-1699.075] * (-1690.879) (-1698.790) [-1691.970] (-1691.611) -- 0:03:33
131000 -- (-1693.517) [-1696.570] (-1694.841) (-1694.113) * (-1704.209) (-1700.800) [-1694.191] (-1692.126) -- 0:03:38
131500 -- [-1699.265] (-1691.005) (-1699.765) (-1695.425) * (-1694.889) [-1702.981] (-1692.829) (-1696.628) -- 0:03:37
132000 -- (-1699.344) [-1697.058] (-1696.669) (-1695.042) * (-1693.814) (-1695.002) [-1696.494] (-1696.462) -- 0:03:37
132500 -- (-1692.408) (-1699.610) [-1693.443] (-1691.442) * (-1698.064) (-1701.920) (-1709.142) [-1695.491] -- 0:03:36
133000 -- [-1693.926] (-1694.950) (-1692.719) (-1694.476) * (-1703.662) (-1702.368) (-1695.130) [-1694.777] -- 0:03:35
133500 -- (-1701.760) (-1700.260) (-1696.529) [-1694.015] * (-1696.655) [-1700.433] (-1699.789) (-1696.691) -- 0:03:34
134000 -- (-1699.447) [-1699.052] (-1703.171) (-1695.492) * (-1703.779) (-1702.830) (-1698.935) [-1694.838] -- 0:03:33
134500 -- (-1695.802) (-1698.414) (-1700.460) [-1694.175] * (-1696.375) (-1705.159) [-1700.980] (-1693.352) -- 0:03:32
135000 -- (-1692.732) (-1695.434) (-1699.142) [-1695.447] * (-1708.523) (-1707.758) [-1692.955] (-1692.599) -- 0:03:37
Average standard deviation of split frequencies: 0.010399
135500 -- (-1695.680) (-1697.626) [-1696.166] (-1692.752) * (-1699.462) (-1708.051) [-1696.144] (-1692.686) -- 0:03:36
136000 -- (-1696.353) [-1694.834] (-1695.024) (-1697.884) * (-1700.011) (-1704.588) [-1691.872] (-1697.528) -- 0:03:36
136500 -- [-1694.584] (-1705.075) (-1704.779) (-1696.511) * (-1696.871) (-1701.787) [-1694.521] (-1692.959) -- 0:03:35
137000 -- (-1695.561) [-1704.653] (-1696.295) (-1694.614) * [-1697.610] (-1708.739) (-1699.419) (-1693.183) -- 0:03:34
137500 -- [-1707.198] (-1705.429) (-1696.234) (-1695.635) * (-1696.381) (-1696.097) (-1693.913) [-1695.736] -- 0:03:33
138000 -- (-1704.269) (-1697.457) (-1702.511) [-1695.483] * (-1698.737) (-1697.162) (-1693.107) [-1691.872] -- 0:03:32
138500 -- (-1703.051) (-1701.068) (-1703.147) [-1697.994] * (-1696.926) [-1698.741] (-1696.533) (-1696.461) -- 0:03:31
139000 -- (-1704.562) (-1702.422) (-1693.637) [-1697.122] * (-1696.443) (-1695.735) [-1692.990] (-1704.656) -- 0:03:36
139500 -- (-1711.693) (-1697.000) [-1690.117] (-1700.780) * (-1697.490) (-1701.255) (-1702.264) [-1702.325] -- 0:03:35
140000 -- (-1698.728) [-1697.031] (-1702.260) (-1697.801) * (-1697.266) [-1692.603] (-1703.307) (-1697.530) -- 0:03:35
Average standard deviation of split frequencies: 0.010891
140500 -- (-1705.707) (-1693.206) [-1694.634] (-1693.942) * [-1693.114] (-1693.619) (-1697.455) (-1697.887) -- 0:03:34
141000 -- (-1707.214) (-1691.984) [-1691.096] (-1702.742) * [-1697.792] (-1697.875) (-1692.979) (-1695.441) -- 0:03:33
141500 -- (-1701.478) (-1698.499) [-1697.029] (-1691.527) * (-1699.367) (-1701.356) (-1695.542) [-1693.322] -- 0:03:32
142000 -- (-1702.124) (-1697.845) [-1692.873] (-1693.651) * (-1700.594) (-1700.813) [-1700.430] (-1700.652) -- 0:03:31
142500 -- (-1695.910) [-1693.865] (-1691.963) (-1695.479) * (-1699.114) (-1696.768) (-1703.089) [-1695.418] -- 0:03:30
143000 -- (-1696.078) [-1691.690] (-1698.663) (-1700.956) * [-1700.992] (-1697.553) (-1699.824) (-1697.526) -- 0:03:35
143500 -- [-1699.468] (-1694.236) (-1693.021) (-1702.390) * (-1699.807) (-1692.140) (-1698.773) [-1697.522] -- 0:03:34
144000 -- (-1691.616) (-1697.756) [-1700.704] (-1695.564) * [-1695.906] (-1692.690) (-1705.021) (-1696.236) -- 0:03:34
144500 -- (-1696.456) (-1698.396) (-1691.829) [-1699.165] * (-1699.261) (-1696.747) [-1695.768] (-1703.019) -- 0:03:33
145000 -- (-1706.513) [-1693.296] (-1699.239) (-1693.745) * (-1697.497) [-1697.191] (-1693.476) (-1700.557) -- 0:03:32
Average standard deviation of split frequencies: 0.008879
145500 -- (-1699.376) [-1700.206] (-1697.617) (-1694.188) * (-1695.318) (-1694.757) (-1693.207) [-1698.710] -- 0:03:31
146000 -- (-1696.275) (-1699.268) [-1698.020] (-1696.223) * [-1694.365] (-1699.088) (-1703.390) (-1696.879) -- 0:03:30
146500 -- (-1700.732) (-1697.319) [-1696.562] (-1699.199) * [-1698.180] (-1695.770) (-1693.040) (-1695.045) -- 0:03:29
147000 -- (-1703.476) [-1701.885] (-1697.843) (-1688.859) * [-1698.086] (-1703.703) (-1699.291) (-1697.991) -- 0:03:34
147500 -- (-1703.619) [-1697.663] (-1695.950) (-1696.122) * (-1702.793) [-1696.359] (-1696.769) (-1698.740) -- 0:03:33
148000 -- (-1702.991) [-1694.423] (-1703.861) (-1693.224) * (-1700.525) (-1695.427) (-1697.344) [-1695.372] -- 0:03:33
148500 -- [-1696.526] (-1694.827) (-1697.998) (-1691.151) * [-1696.885] (-1693.409) (-1700.442) (-1693.184) -- 0:03:32
149000 -- [-1696.672] (-1695.337) (-1702.213) (-1701.805) * [-1691.330] (-1695.185) (-1697.829) (-1694.911) -- 0:03:31
149500 -- (-1697.983) [-1695.059] (-1699.760) (-1696.533) * [-1695.790] (-1694.401) (-1693.551) (-1693.938) -- 0:03:30
150000 -- (-1698.536) [-1696.072] (-1697.480) (-1699.397) * (-1693.011) (-1693.841) (-1697.920) [-1696.063] -- 0:03:29
Average standard deviation of split frequencies: 0.011733
150500 -- (-1704.324) (-1697.707) (-1703.933) [-1694.941] * (-1694.497) (-1697.543) [-1690.446] (-1698.707) -- 0:03:28
151000 -- (-1699.383) (-1695.282) [-1693.391] (-1695.052) * [-1690.186] (-1694.042) (-1692.563) (-1694.855) -- 0:03:33
151500 -- (-1702.105) [-1693.323] (-1693.854) (-1694.780) * (-1697.566) (-1710.123) (-1697.430) [-1697.386] -- 0:03:32
152000 -- (-1697.670) (-1700.272) [-1702.002] (-1702.139) * (-1695.375) (-1698.206) [-1689.664] (-1697.088) -- 0:03:32
152500 -- [-1692.496] (-1697.201) (-1703.642) (-1703.188) * (-1694.465) [-1694.471] (-1704.845) (-1704.503) -- 0:03:31
153000 -- (-1698.430) (-1696.334) [-1696.973] (-1708.247) * (-1700.869) (-1694.936) [-1699.584] (-1700.006) -- 0:03:30
153500 -- (-1690.694) (-1695.305) [-1696.539] (-1708.958) * (-1701.336) (-1703.730) (-1697.682) [-1695.331] -- 0:03:29
154000 -- (-1697.617) [-1702.436] (-1695.939) (-1701.378) * (-1701.797) (-1703.984) [-1697.746] (-1697.281) -- 0:03:28
154500 -- (-1693.233) (-1696.838) [-1701.585] (-1702.162) * (-1695.019) (-1699.949) (-1694.981) [-1697.611] -- 0:03:27
155000 -- (-1701.996) (-1695.812) [-1695.547] (-1696.860) * (-1697.125) (-1695.848) [-1694.443] (-1699.149) -- 0:03:32
Average standard deviation of split frequencies: 0.009821
155500 -- (-1698.104) (-1699.573) [-1695.833] (-1696.548) * [-1695.235] (-1700.872) (-1715.198) (-1700.395) -- 0:03:31
156000 -- (-1695.758) [-1693.496] (-1696.516) (-1695.295) * [-1696.418] (-1698.819) (-1704.195) (-1695.464) -- 0:03:31
156500 -- (-1694.801) (-1692.032) (-1698.753) [-1694.972] * (-1701.612) (-1699.599) (-1701.545) [-1701.830] -- 0:03:30
157000 -- (-1696.567) (-1695.860) (-1693.861) [-1699.522] * (-1698.375) (-1700.906) [-1697.542] (-1698.901) -- 0:03:29
157500 -- [-1699.041] (-1696.166) (-1695.860) (-1696.539) * (-1694.507) (-1695.920) [-1692.964] (-1692.800) -- 0:03:28
158000 -- (-1700.503) (-1696.955) [-1701.507] (-1691.889) * (-1693.823) (-1694.058) [-1692.326] (-1697.477) -- 0:03:27
158500 -- (-1703.036) (-1697.875) (-1694.782) [-1697.042] * (-1700.520) (-1692.004) (-1696.848) [-1697.138] -- 0:03:27
159000 -- (-1694.950) (-1696.395) (-1699.644) [-1697.028] * (-1700.585) [-1690.978] (-1693.153) (-1700.041) -- 0:03:31
159500 -- (-1695.297) (-1696.414) (-1695.919) [-1699.254] * (-1691.245) (-1699.455) (-1696.673) [-1694.121] -- 0:03:30
160000 -- (-1699.271) [-1694.467] (-1703.607) (-1701.037) * (-1695.057) [-1696.354] (-1695.375) (-1699.670) -- 0:03:30
Average standard deviation of split frequencies: 0.010269
160500 -- (-1703.453) [-1698.366] (-1699.955) (-1700.538) * (-1693.711) [-1693.270] (-1700.055) (-1693.988) -- 0:03:29
161000 -- [-1691.911] (-1694.305) (-1693.670) (-1693.840) * (-1695.580) [-1697.210] (-1709.605) (-1697.464) -- 0:03:28
161500 -- (-1690.388) (-1696.712) (-1695.110) [-1700.813] * (-1701.710) (-1697.209) (-1707.651) [-1696.721] -- 0:03:27
162000 -- (-1702.242) (-1695.287) [-1696.091] (-1694.266) * (-1696.903) [-1695.524] (-1701.972) (-1694.102) -- 0:03:26
162500 -- (-1699.625) [-1700.971] (-1697.329) (-1692.257) * [-1697.537] (-1701.221) (-1702.552) (-1696.446) -- 0:03:31
163000 -- (-1697.286) (-1691.270) (-1696.533) [-1700.497] * (-1694.631) (-1699.090) [-1697.202] (-1695.712) -- 0:03:30
163500 -- (-1694.501) [-1695.755] (-1700.487) (-1694.593) * (-1692.582) [-1697.863] (-1708.453) (-1696.674) -- 0:03:29
164000 -- [-1692.543] (-1701.927) (-1700.819) (-1691.869) * (-1696.610) (-1696.910) (-1697.809) [-1698.591] -- 0:03:29
164500 -- (-1699.636) (-1694.958) (-1702.864) [-1690.044] * (-1703.498) (-1697.217) (-1698.879) [-1690.780] -- 0:03:28
165000 -- [-1697.680] (-1694.817) (-1694.552) (-1702.653) * (-1694.028) (-1705.556) (-1703.599) [-1693.433] -- 0:03:27
Average standard deviation of split frequencies: 0.003550
165500 -- [-1696.611] (-1706.045) (-1700.788) (-1695.101) * [-1693.467] (-1697.330) (-1707.631) (-1695.417) -- 0:03:26
166000 -- (-1701.258) [-1703.511] (-1709.531) (-1694.146) * (-1699.741) (-1703.750) (-1700.549) [-1697.437] -- 0:03:25
166500 -- [-1694.757] (-1699.125) (-1706.465) (-1699.061) * (-1698.679) (-1700.980) [-1698.917] (-1693.384) -- 0:03:30
167000 -- (-1701.116) (-1700.850) (-1704.023) [-1697.515] * (-1694.661) (-1693.781) (-1694.271) [-1692.489] -- 0:03:29
167500 -- [-1699.164] (-1696.209) (-1704.544) (-1697.958) * (-1697.707) (-1698.698) [-1692.165] (-1697.105) -- 0:03:28
168000 -- (-1697.714) (-1693.396) (-1701.068) [-1693.545] * (-1698.046) [-1694.818] (-1695.852) (-1695.911) -- 0:03:28
168500 -- [-1694.476] (-1699.477) (-1702.327) (-1696.393) * (-1697.197) (-1698.018) (-1695.832) [-1693.534] -- 0:03:27
169000 -- (-1697.933) (-1699.802) (-1714.269) [-1698.103] * (-1695.806) (-1697.666) [-1691.194] (-1698.241) -- 0:03:26
169500 -- (-1700.646) (-1697.966) [-1692.896] (-1704.578) * (-1699.979) (-1695.391) [-1693.437] (-1700.270) -- 0:03:25
170000 -- (-1695.185) (-1698.269) (-1696.695) [-1696.611] * [-1695.437] (-1700.441) (-1696.977) (-1701.687) -- 0:03:25
Average standard deviation of split frequencies: 0.003453
170500 -- (-1698.139) (-1709.508) (-1695.784) [-1699.919] * (-1696.416) (-1692.288) (-1694.126) [-1694.969] -- 0:03:29
171000 -- (-1695.381) [-1692.240] (-1694.289) (-1699.194) * [-1703.383] (-1693.690) (-1691.792) (-1696.079) -- 0:03:28
171500 -- (-1698.693) (-1692.166) [-1693.595] (-1699.366) * (-1700.166) (-1692.039) (-1698.410) [-1697.468] -- 0:03:27
172000 -- (-1697.537) (-1699.090) (-1696.720) [-1700.910] * [-1703.254] (-1709.629) (-1695.921) (-1698.585) -- 0:03:27
172500 -- (-1693.882) [-1694.772] (-1701.340) (-1700.381) * [-1694.643] (-1701.735) (-1693.896) (-1696.261) -- 0:03:26
173000 -- (-1695.253) [-1693.519] (-1693.803) (-1703.436) * (-1695.752) (-1696.498) [-1687.683] (-1697.148) -- 0:03:25
173500 -- (-1694.863) (-1693.197) (-1691.263) [-1704.991] * (-1695.144) (-1696.662) [-1694.330] (-1694.799) -- 0:03:24
174000 -- [-1695.983] (-1698.382) (-1696.808) (-1706.146) * [-1693.093] (-1696.143) (-1703.423) (-1692.375) -- 0:03:24
174500 -- (-1693.406) (-1694.234) [-1696.285] (-1696.662) * (-1694.344) [-1697.209] (-1693.605) (-1700.288) -- 0:03:28
175000 -- (-1690.205) [-1692.529] (-1698.160) (-1702.323) * [-1695.150] (-1702.259) (-1701.813) (-1696.608) -- 0:03:27
Average standard deviation of split frequencies: 0.005357
175500 -- [-1699.458] (-1692.223) (-1697.044) (-1698.125) * (-1695.702) [-1695.041] (-1693.094) (-1701.004) -- 0:03:26
176000 -- [-1697.133] (-1694.379) (-1695.899) (-1692.236) * (-1691.767) (-1705.902) (-1695.723) [-1692.214] -- 0:03:26
176500 -- [-1695.769] (-1704.330) (-1694.433) (-1700.342) * (-1693.812) (-1698.492) [-1693.944] (-1694.535) -- 0:03:25
177000 -- (-1695.767) (-1696.622) [-1696.709] (-1702.908) * (-1699.807) (-1692.576) [-1696.115] (-1696.449) -- 0:03:24
177500 -- (-1692.323) [-1698.360] (-1693.623) (-1701.725) * [-1693.614] (-1693.457) (-1695.929) (-1702.079) -- 0:03:23
178000 -- [-1694.781] (-1703.465) (-1709.847) (-1702.648) * [-1700.688] (-1696.333) (-1700.472) (-1696.898) -- 0:03:23
178500 -- (-1695.330) (-1697.167) [-1695.277] (-1699.214) * [-1701.236] (-1699.074) (-1699.438) (-1698.876) -- 0:03:27
179000 -- (-1695.566) (-1705.469) [-1695.426] (-1693.976) * [-1691.672] (-1701.628) (-1699.147) (-1694.255) -- 0:03:26
179500 -- (-1694.904) (-1707.377) [-1698.964] (-1695.979) * [-1696.031] (-1703.597) (-1700.115) (-1698.742) -- 0:03:25
180000 -- [-1702.755] (-1698.230) (-1704.293) (-1699.638) * [-1702.487] (-1692.794) (-1702.998) (-1692.808) -- 0:03:25
Average standard deviation of split frequencies: 0.003914
180500 -- (-1701.576) [-1701.489] (-1696.549) (-1693.529) * (-1706.349) (-1699.427) (-1701.145) [-1701.106] -- 0:03:24
181000 -- (-1696.100) (-1700.489) (-1694.070) [-1690.169] * (-1695.790) [-1697.465] (-1702.921) (-1694.579) -- 0:03:23
181500 -- (-1704.601) (-1699.989) (-1696.903) [-1694.003] * (-1701.810) (-1692.443) [-1691.878] (-1695.578) -- 0:03:22
182000 -- [-1702.796] (-1696.439) (-1694.956) (-1696.975) * (-1690.958) (-1701.084) [-1692.464] (-1694.310) -- 0:03:22
182500 -- (-1696.154) (-1697.944) (-1693.108) [-1692.538] * (-1691.125) (-1693.824) (-1703.093) [-1698.121] -- 0:03:26
183000 -- (-1695.332) (-1702.195) [-1697.102] (-1694.613) * (-1703.030) (-1702.650) [-1697.792] (-1703.024) -- 0:03:25
183500 -- (-1695.814) (-1693.795) [-1689.714] (-1690.320) * (-1706.718) (-1695.688) (-1695.000) [-1693.823] -- 0:03:24
184000 -- (-1704.710) [-1696.024] (-1703.768) (-1700.929) * [-1700.132] (-1699.845) (-1702.055) (-1701.876) -- 0:03:24
184500 -- [-1691.568] (-1695.932) (-1700.740) (-1698.115) * (-1698.231) [-1696.692] (-1700.138) (-1698.593) -- 0:03:23
185000 -- (-1692.351) (-1699.693) [-1696.831] (-1693.084) * (-1705.231) (-1703.594) [-1695.123] (-1697.099) -- 0:03:22
Average standard deviation of split frequencies: 0.006970
185500 -- [-1692.211] (-1697.806) (-1706.034) (-1692.826) * (-1697.283) (-1703.160) (-1697.731) [-1692.959] -- 0:03:21
186000 -- (-1703.547) (-1700.161) (-1694.350) [-1699.141] * [-1696.151] (-1695.438) (-1693.329) (-1702.332) -- 0:03:21
186500 -- (-1693.370) (-1699.348) (-1696.783) [-1691.373] * (-1693.812) (-1702.284) [-1696.177] (-1702.816) -- 0:03:25
187000 -- (-1696.505) (-1700.126) [-1693.305] (-1697.668) * (-1707.761) (-1700.949) [-1694.198] (-1696.604) -- 0:03:24
187500 -- (-1693.389) (-1704.858) [-1697.728] (-1704.537) * (-1704.732) (-1698.594) [-1695.961] (-1695.290) -- 0:03:23
188000 -- (-1694.188) (-1700.093) (-1697.127) [-1693.293] * (-1706.101) (-1705.615) [-1696.921] (-1695.117) -- 0:03:23
188500 -- (-1695.259) [-1699.016] (-1694.889) (-1699.957) * [-1701.136] (-1695.150) (-1696.646) (-1697.153) -- 0:03:22
189000 -- (-1692.184) (-1703.114) (-1698.131) [-1704.149] * (-1696.700) [-1704.014] (-1697.028) (-1698.076) -- 0:03:21
189500 -- [-1695.296] (-1702.391) (-1696.145) (-1696.537) * [-1697.660] (-1705.883) (-1700.655) (-1698.111) -- 0:03:21
190000 -- (-1694.476) [-1694.805] (-1693.062) (-1695.192) * [-1691.333] (-1702.629) (-1694.667) (-1689.653) -- 0:03:20
Average standard deviation of split frequencies: 0.006181
190500 -- (-1692.890) (-1702.353) [-1690.139] (-1694.203) * (-1695.561) [-1699.181] (-1694.778) (-1698.920) -- 0:03:23
191000 -- (-1691.917) [-1695.275] (-1693.592) (-1694.525) * (-1705.954) (-1698.864) (-1696.411) [-1696.975] -- 0:03:23
191500 -- [-1697.074] (-1697.896) (-1694.025) (-1699.247) * (-1699.363) (-1701.275) [-1697.290] (-1691.943) -- 0:03:22
192000 -- (-1692.480) (-1695.115) (-1692.809) [-1700.513] * (-1696.893) (-1700.378) [-1698.112] (-1696.399) -- 0:03:22
192500 -- (-1697.447) [-1701.630] (-1690.298) (-1697.468) * [-1694.521] (-1697.271) (-1700.256) (-1696.179) -- 0:03:21
193000 -- (-1695.117) [-1696.784] (-1691.497) (-1697.992) * [-1692.702] (-1692.591) (-1696.795) (-1712.815) -- 0:03:20
193500 -- (-1697.558) (-1696.276) [-1696.479] (-1697.727) * (-1697.788) (-1701.410) (-1697.747) [-1695.038] -- 0:03:20
194000 -- (-1701.858) (-1698.637) (-1695.411) [-1700.878] * (-1703.670) (-1696.952) [-1696.961] (-1694.022) -- 0:03:19
194500 -- (-1701.440) (-1702.178) [-1696.060] (-1696.141) * (-1703.028) (-1698.230) [-1697.483] (-1702.996) -- 0:03:22
195000 -- (-1703.535) (-1700.705) (-1697.311) [-1697.591] * (-1708.655) [-1696.859] (-1692.815) (-1694.204) -- 0:03:22
Average standard deviation of split frequencies: 0.004209
195500 -- (-1698.851) (-1700.241) [-1695.651] (-1701.901) * (-1709.506) (-1693.431) [-1693.047] (-1697.833) -- 0:03:21
196000 -- [-1695.633] (-1696.961) (-1694.324) (-1696.515) * (-1696.502) (-1693.530) [-1694.664] (-1701.294) -- 0:03:21
196500 -- (-1701.037) [-1700.615] (-1700.894) (-1695.924) * (-1694.531) (-1697.491) [-1701.394] (-1697.127) -- 0:03:20
197000 -- [-1704.467] (-1694.689) (-1698.794) (-1694.441) * [-1694.704] (-1692.344) (-1700.058) (-1700.351) -- 0:03:19
197500 -- (-1696.408) [-1690.992] (-1696.459) (-1702.121) * (-1700.317) (-1699.625) [-1699.125] (-1696.501) -- 0:03:19
198000 -- [-1698.049] (-1694.581) (-1690.621) (-1700.767) * (-1696.760) (-1692.648) [-1698.233] (-1697.447) -- 0:03:18
198500 -- [-1693.197] (-1693.454) (-1699.592) (-1699.283) * (-1699.328) [-1692.670] (-1694.340) (-1695.192) -- 0:03:21
199000 -- (-1695.165) (-1694.464) [-1696.544] (-1691.363) * (-1697.061) (-1693.687) (-1695.915) [-1697.045] -- 0:03:21
199500 -- (-1707.362) (-1700.024) (-1701.710) [-1691.322] * (-1703.146) (-1693.833) (-1701.077) [-1698.870] -- 0:03:20
200000 -- [-1697.504] (-1690.512) (-1704.087) (-1696.788) * (-1702.908) (-1696.052) [-1695.934] (-1705.444) -- 0:03:20
Average standard deviation of split frequencies: 0.005873
200500 -- [-1698.444] (-1691.804) (-1703.575) (-1699.507) * [-1692.373] (-1698.761) (-1696.272) (-1702.885) -- 0:03:19
201000 -- [-1697.530] (-1692.928) (-1700.787) (-1696.834) * [-1692.778] (-1697.856) (-1704.945) (-1702.937) -- 0:03:18
201500 -- [-1696.266] (-1693.115) (-1707.393) (-1697.026) * [-1694.082] (-1698.065) (-1698.062) (-1705.383) -- 0:03:18
202000 -- [-1695.208] (-1697.452) (-1700.815) (-1696.239) * (-1701.058) [-1697.731] (-1695.445) (-1693.523) -- 0:03:17
202500 -- [-1693.850] (-1703.386) (-1694.559) (-1693.728) * (-1699.231) (-1693.082) (-1694.220) [-1695.380] -- 0:03:20
203000 -- (-1700.330) (-1696.472) [-1696.487] (-1701.464) * (-1703.260) [-1694.935] (-1699.730) (-1705.718) -- 0:03:20
203500 -- (-1693.244) [-1696.266] (-1698.025) (-1696.085) * (-1698.373) (-1696.057) [-1697.545] (-1701.159) -- 0:03:19
204000 -- (-1695.031) [-1699.827] (-1700.883) (-1699.158) * (-1694.487) (-1700.266) [-1697.324] (-1697.243) -- 0:03:19
204500 -- [-1695.497] (-1695.169) (-1700.086) (-1692.561) * (-1699.929) [-1694.581] (-1694.693) (-1705.640) -- 0:03:18
205000 -- [-1695.127] (-1698.252) (-1702.434) (-1696.558) * (-1698.312) (-1696.309) (-1698.152) [-1695.993] -- 0:03:17
Average standard deviation of split frequencies: 0.005149
205500 -- (-1694.879) [-1700.904] (-1696.865) (-1698.266) * (-1696.898) (-1693.618) (-1699.052) [-1693.665] -- 0:03:17
206000 -- (-1695.844) [-1698.229] (-1698.952) (-1694.414) * (-1698.227) [-1694.397] (-1697.423) (-1692.686) -- 0:03:16
206500 -- (-1699.315) (-1704.783) (-1695.744) [-1695.788] * [-1694.689] (-1702.090) (-1701.889) (-1698.790) -- 0:03:19
207000 -- (-1700.750) [-1696.675] (-1692.495) (-1694.865) * (-1695.956) (-1702.678) [-1701.139] (-1697.103) -- 0:03:19
207500 -- (-1703.552) (-1691.256) [-1695.379] (-1698.966) * [-1693.050] (-1697.757) (-1702.296) (-1693.951) -- 0:03:18
208000 -- (-1696.755) [-1695.848] (-1698.073) (-1701.367) * [-1696.123] (-1703.391) (-1700.213) (-1693.829) -- 0:03:18
208500 -- (-1705.573) (-1704.635) (-1692.714) [-1696.675] * (-1693.478) [-1699.904] (-1698.861) (-1693.679) -- 0:03:17
209000 -- (-1699.995) (-1696.624) (-1697.637) [-1697.194] * (-1706.524) (-1701.895) [-1696.691] (-1701.402) -- 0:03:16
209500 -- (-1702.202) (-1700.150) (-1699.657) [-1699.318] * [-1698.192] (-1698.623) (-1698.987) (-1695.997) -- 0:03:16
210000 -- (-1698.024) (-1700.979) (-1697.183) [-1691.539] * (-1696.962) (-1690.786) [-1700.145] (-1697.117) -- 0:03:15
Average standard deviation of split frequencies: 0.003357
210500 -- (-1695.032) (-1697.504) [-1692.686] (-1698.106) * [-1696.083] (-1695.374) (-1705.983) (-1694.366) -- 0:03:18
211000 -- (-1705.037) (-1700.862) (-1703.242) [-1696.680] * (-1700.752) (-1700.146) [-1699.431] (-1693.986) -- 0:03:18
211500 -- (-1699.966) (-1692.999) [-1702.615] (-1703.105) * (-1696.758) [-1694.040] (-1699.742) (-1700.116) -- 0:03:17
212000 -- (-1698.214) (-1694.203) [-1693.668] (-1702.718) * (-1700.458) (-1695.492) (-1704.654) [-1692.651] -- 0:03:17
212500 -- (-1697.559) (-1697.308) [-1691.078] (-1703.902) * (-1703.520) (-1693.655) (-1700.409) [-1694.246] -- 0:03:16
213000 -- (-1697.829) [-1696.505] (-1700.254) (-1702.250) * (-1700.094) [-1699.719] (-1698.751) (-1692.778) -- 0:03:15
213500 -- (-1698.040) [-1693.637] (-1692.131) (-1692.616) * (-1697.936) (-1707.425) (-1691.810) [-1692.952] -- 0:03:15
214000 -- (-1705.808) (-1695.218) (-1704.389) [-1695.687] * [-1698.413] (-1697.388) (-1693.760) (-1699.816) -- 0:03:14
214500 -- (-1695.166) (-1697.694) [-1694.232] (-1696.153) * (-1690.621) [-1692.664] (-1697.249) (-1699.618) -- 0:03:17
215000 -- (-1696.407) (-1697.111) [-1701.260] (-1703.811) * (-1696.068) (-1696.957) [-1695.508] (-1698.052) -- 0:03:17
Average standard deviation of split frequencies: 0.003819
215500 -- (-1696.900) [-1695.383] (-1695.708) (-1696.199) * (-1698.903) (-1705.883) [-1693.951] (-1701.963) -- 0:03:16
216000 -- (-1693.311) (-1696.368) (-1699.147) [-1697.099] * (-1698.047) (-1697.457) [-1695.035] (-1696.603) -- 0:03:16
216500 -- (-1694.540) (-1695.493) (-1701.245) [-1698.500] * (-1697.333) (-1698.277) [-1696.956] (-1693.191) -- 0:03:15
217000 -- (-1696.538) [-1695.476] (-1700.013) (-1693.738) * (-1702.128) (-1700.515) (-1695.844) [-1694.560] -- 0:03:14
217500 -- [-1695.587] (-1692.687) (-1696.678) (-1699.120) * (-1697.045) (-1696.198) (-1691.980) [-1692.710] -- 0:03:14
218000 -- [-1693.868] (-1702.148) (-1701.321) (-1697.032) * (-1694.758) (-1710.868) [-1701.335] (-1698.265) -- 0:03:13
218500 -- (-1692.828) (-1696.422) (-1699.750) [-1693.850] * (-1697.332) [-1697.537] (-1696.220) (-1695.400) -- 0:03:16
219000 -- (-1697.969) [-1691.115] (-1698.165) (-1692.694) * [-1693.385] (-1702.105) (-1696.237) (-1696.094) -- 0:03:16
219500 -- (-1696.285) (-1694.780) (-1700.102) [-1698.264] * (-1695.651) (-1693.700) (-1698.446) [-1694.699] -- 0:03:15
220000 -- (-1696.152) [-1694.012] (-1697.532) (-1699.188) * (-1696.380) (-1692.710) [-1696.679] (-1695.278) -- 0:03:15
Average standard deviation of split frequencies: 0.008011
220500 -- (-1700.300) [-1693.007] (-1701.051) (-1697.364) * (-1692.979) (-1696.716) [-1694.500] (-1693.619) -- 0:03:14
221000 -- (-1701.390) [-1698.277] (-1695.658) (-1691.798) * (-1697.990) (-1695.937) [-1699.157] (-1696.262) -- 0:03:13
221500 -- (-1701.864) (-1694.382) (-1696.759) [-1691.910] * (-1698.135) (-1697.083) [-1691.909] (-1698.459) -- 0:03:13
222000 -- [-1703.872] (-1699.866) (-1696.253) (-1703.750) * (-1696.982) (-1714.812) [-1691.127] (-1696.638) -- 0:03:12
222500 -- (-1699.716) [-1696.254] (-1698.676) (-1704.508) * (-1697.355) (-1706.089) (-1697.411) [-1699.487] -- 0:03:15
223000 -- (-1698.358) [-1693.432] (-1706.342) (-1697.837) * [-1694.289] (-1708.283) (-1694.351) (-1704.898) -- 0:03:15
223500 -- (-1701.713) (-1703.659) [-1696.130] (-1695.810) * (-1700.595) [-1695.527] (-1697.139) (-1695.412) -- 0:03:14
224000 -- (-1706.439) (-1701.975) (-1696.204) [-1693.382] * (-1699.149) (-1699.557) [-1691.277] (-1694.314) -- 0:03:14
224500 -- (-1700.233) (-1697.100) (-1699.213) [-1703.314] * (-1700.809) (-1693.901) [-1696.035] (-1697.443) -- 0:03:13
225000 -- (-1699.533) (-1693.470) [-1696.637] (-1699.301) * [-1695.603] (-1693.520) (-1694.340) (-1696.184) -- 0:03:12
Average standard deviation of split frequencies: 0.008343
225500 -- (-1701.062) [-1697.194] (-1708.180) (-1700.948) * [-1696.669] (-1695.706) (-1695.064) (-1692.198) -- 0:03:12
226000 -- (-1704.915) (-1697.819) [-1697.257] (-1697.820) * (-1698.057) (-1699.340) [-1694.099] (-1695.752) -- 0:03:11
226500 -- (-1702.145) (-1700.724) [-1697.751] (-1696.424) * (-1703.036) [-1692.153] (-1697.358) (-1695.178) -- 0:03:14
227000 -- (-1704.793) (-1703.756) (-1695.036) [-1696.892] * (-1699.629) (-1693.341) (-1693.334) [-1697.289] -- 0:03:14
227500 -- (-1699.682) [-1697.078] (-1698.059) (-1706.218) * [-1696.936] (-1696.695) (-1698.878) (-1701.551) -- 0:03:13
228000 -- [-1694.771] (-1690.362) (-1700.550) (-1695.053) * (-1703.352) (-1698.187) (-1691.742) [-1694.976] -- 0:03:13
228500 -- (-1697.336) (-1693.221) [-1693.605] (-1699.606) * (-1698.837) (-1698.662) [-1693.323] (-1699.673) -- 0:03:12
229000 -- (-1692.149) [-1701.158] (-1702.498) (-1711.850) * (-1697.603) (-1697.665) (-1693.653) [-1691.955] -- 0:03:11
229500 -- [-1696.444] (-1698.216) (-1696.157) (-1705.730) * (-1700.451) (-1700.669) (-1698.633) [-1700.191] -- 0:03:11
230000 -- [-1689.178] (-1701.536) (-1694.377) (-1699.732) * [-1692.209] (-1699.093) (-1694.423) (-1696.874) -- 0:03:10
Average standard deviation of split frequencies: 0.013795
230500 -- [-1691.985] (-1701.421) (-1698.764) (-1703.433) * (-1692.001) (-1702.562) [-1692.803] (-1694.563) -- 0:03:13
231000 -- [-1695.208] (-1698.138) (-1708.212) (-1695.187) * (-1705.478) [-1699.187] (-1692.791) (-1701.650) -- 0:03:13
231500 -- (-1697.333) (-1699.005) (-1700.435) [-1692.951] * (-1702.992) (-1702.310) (-1698.336) [-1695.528] -- 0:03:12
232000 -- [-1702.706] (-1702.864) (-1696.852) (-1695.865) * (-1702.731) [-1694.464] (-1692.935) (-1703.668) -- 0:03:12
232500 -- (-1700.520) (-1698.404) [-1691.801] (-1694.708) * (-1695.994) (-1690.856) [-1693.150] (-1696.309) -- 0:03:11
233000 -- [-1694.108] (-1694.282) (-1696.544) (-1703.097) * (-1701.555) [-1695.509] (-1696.787) (-1695.271) -- 0:03:10
233500 -- (-1695.350) (-1697.984) (-1701.439) [-1699.867] * [-1691.802] (-1692.960) (-1693.190) (-1696.101) -- 0:03:10
234000 -- [-1703.006] (-1696.180) (-1697.099) (-1700.418) * (-1697.562) (-1697.489) [-1698.043] (-1696.542) -- 0:03:13
234500 -- (-1696.712) (-1693.130) [-1694.189] (-1698.965) * [-1693.682] (-1696.222) (-1695.580) (-1701.601) -- 0:03:12
235000 -- [-1699.976] (-1695.494) (-1700.991) (-1703.966) * (-1695.071) [-1693.494] (-1695.174) (-1720.982) -- 0:03:12
Average standard deviation of split frequencies: 0.010986
235500 -- (-1700.986) [-1693.628] (-1694.624) (-1701.286) * (-1695.202) (-1697.705) [-1693.574] (-1703.278) -- 0:03:11
236000 -- (-1702.860) (-1705.464) [-1698.736] (-1705.999) * (-1693.573) (-1693.458) [-1695.885] (-1703.180) -- 0:03:11
236500 -- (-1699.174) [-1695.819] (-1692.486) (-1702.157) * (-1695.886) (-1691.521) (-1694.784) [-1697.558] -- 0:03:10
237000 -- (-1699.517) (-1694.767) [-1697.767] (-1701.558) * (-1702.766) (-1697.542) [-1691.827] (-1702.085) -- 0:03:09
237500 -- (-1699.545) (-1694.109) [-1696.541] (-1708.881) * (-1702.755) (-1706.956) [-1695.858] (-1702.435) -- 0:03:09
238000 -- (-1700.465) [-1694.909] (-1694.637) (-1694.400) * (-1706.612) (-1697.314) (-1699.930) [-1699.339] -- 0:03:12
238500 -- (-1698.376) [-1696.069] (-1694.752) (-1700.302) * (-1697.168) [-1694.846] (-1698.263) (-1707.717) -- 0:03:11
239000 -- (-1700.249) (-1693.931) (-1695.868) [-1694.565] * (-1696.073) (-1695.212) [-1696.215] (-1696.229) -- 0:03:11
239500 -- (-1699.857) [-1692.997] (-1697.097) (-1698.088) * (-1693.896) [-1703.778] (-1696.452) (-1696.961) -- 0:03:10
240000 -- (-1698.380) [-1690.111] (-1693.898) (-1698.331) * (-1696.616) (-1703.443) (-1696.891) [-1692.637] -- 0:03:10
Average standard deviation of split frequencies: 0.013711
240500 -- (-1693.192) (-1693.821) [-1697.068] (-1701.020) * [-1695.673] (-1701.767) (-1696.745) (-1697.962) -- 0:03:09
241000 -- (-1696.204) (-1696.664) (-1693.815) [-1697.963] * (-1706.771) [-1696.182] (-1699.769) (-1697.255) -- 0:03:08
241500 -- (-1696.369) (-1701.805) [-1692.512] (-1696.019) * [-1697.762] (-1695.601) (-1705.567) (-1697.972) -- 0:03:08
242000 -- (-1693.751) (-1700.354) [-1696.105] (-1693.697) * [-1696.521] (-1703.251) (-1705.426) (-1703.985) -- 0:03:11
242500 -- [-1693.380] (-1695.549) (-1693.819) (-1702.582) * (-1697.906) (-1698.523) [-1692.986] (-1696.083) -- 0:03:10
243000 -- [-1698.607] (-1694.901) (-1695.820) (-1694.401) * (-1698.597) [-1696.611] (-1695.501) (-1703.597) -- 0:03:10
243500 -- (-1699.904) [-1692.508] (-1697.862) (-1698.826) * (-1698.769) (-1695.939) [-1693.248] (-1692.521) -- 0:03:09
244000 -- (-1700.539) (-1691.197) [-1694.245] (-1696.501) * [-1692.142] (-1698.663) (-1694.770) (-1698.941) -- 0:03:09
244500 -- (-1698.421) (-1695.850) (-1693.961) [-1696.521] * (-1696.553) (-1696.499) [-1694.457] (-1698.116) -- 0:03:08
245000 -- (-1696.279) [-1697.118] (-1702.707) (-1693.427) * (-1696.685) (-1702.780) (-1701.247) [-1690.228] -- 0:03:07
Average standard deviation of split frequencies: 0.011019
245500 -- (-1702.708) [-1694.945] (-1695.589) (-1698.394) * (-1692.579) (-1695.297) [-1694.126] (-1700.609) -- 0:03:10
246000 -- [-1696.780] (-1696.381) (-1694.765) (-1700.335) * [-1691.269] (-1699.220) (-1694.019) (-1699.575) -- 0:03:10
246500 -- (-1702.729) (-1695.624) [-1694.838] (-1691.797) * (-1695.463) [-1699.177] (-1699.563) (-1697.878) -- 0:03:09
247000 -- (-1702.378) (-1704.867) [-1695.473] (-1703.997) * (-1697.920) (-1698.584) [-1694.408] (-1700.382) -- 0:03:09
247500 -- (-1691.698) [-1693.316] (-1699.013) (-1698.642) * (-1699.088) [-1695.291] (-1695.191) (-1699.780) -- 0:03:08
248000 -- (-1697.401) [-1696.062] (-1697.768) (-1694.745) * [-1699.641] (-1696.905) (-1698.088) (-1696.638) -- 0:03:08
248500 -- (-1712.354) [-1690.649] (-1693.688) (-1697.228) * (-1694.685) [-1700.671] (-1696.978) (-1704.099) -- 0:03:07
249000 -- [-1704.601] (-1698.871) (-1699.599) (-1701.872) * (-1701.435) [-1690.600] (-1700.441) (-1697.484) -- 0:03:06
249500 -- [-1699.907] (-1690.776) (-1691.805) (-1693.714) * (-1695.942) (-1692.933) (-1695.051) [-1708.568] -- 0:03:09
250000 -- (-1696.532) (-1698.946) (-1696.600) [-1698.513] * (-1698.004) [-1703.639] (-1694.368) (-1701.460) -- 0:03:09
Average standard deviation of split frequencies: 0.014105
250500 -- (-1698.450) [-1691.463] (-1706.026) (-1698.045) * (-1696.395) (-1694.714) (-1699.093) [-1697.117] -- 0:03:08
251000 -- (-1704.500) (-1698.173) (-1697.874) [-1702.222] * [-1696.240] (-1695.618) (-1692.278) (-1701.719) -- 0:03:07
251500 -- (-1693.515) (-1702.969) (-1695.019) [-1697.380] * [-1691.417] (-1698.407) (-1692.379) (-1703.391) -- 0:03:07
252000 -- [-1694.428] (-1698.563) (-1695.047) (-1697.960) * (-1694.250) (-1696.692) [-1698.232] (-1698.711) -- 0:03:07
252500 -- (-1697.125) (-1704.708) [-1693.550] (-1693.480) * [-1694.727] (-1697.029) (-1692.897) (-1695.957) -- 0:03:06
253000 -- (-1695.409) [-1696.947] (-1696.467) (-1702.516) * (-1691.699) (-1694.256) (-1701.905) [-1693.521] -- 0:03:06
253500 -- (-1697.925) [-1692.075] (-1692.274) (-1696.412) * (-1704.208) (-1691.884) [-1696.708] (-1695.377) -- 0:03:08
254000 -- [-1700.473] (-1702.090) (-1695.228) (-1696.507) * [-1694.553] (-1698.486) (-1698.546) (-1698.907) -- 0:03:07
254500 -- (-1695.383) [-1696.806] (-1696.677) (-1694.680) * [-1692.806] (-1697.408) (-1696.350) (-1697.320) -- 0:03:07
255000 -- (-1689.920) [-1690.231] (-1695.331) (-1694.246) * [-1693.357] (-1693.452) (-1695.892) (-1702.905) -- 0:03:06
Average standard deviation of split frequencies: 0.012430
255500 -- (-1696.577) (-1693.531) [-1692.849] (-1702.460) * [-1692.622] (-1693.309) (-1696.637) (-1701.875) -- 0:03:06
256000 -- (-1694.305) (-1697.955) [-1695.184] (-1702.189) * (-1691.209) [-1697.801] (-1701.069) (-1709.957) -- 0:03:06
256500 -- (-1703.570) (-1699.281) [-1695.835] (-1698.529) * (-1698.938) (-1692.375) [-1699.479] (-1699.372) -- 0:03:05
257000 -- (-1705.793) (-1694.351) (-1696.997) [-1697.486] * (-1697.702) (-1694.523) [-1691.408] (-1692.749) -- 0:03:05
257500 -- (-1701.010) [-1695.210] (-1700.280) (-1697.567) * [-1692.440] (-1697.428) (-1696.651) (-1698.388) -- 0:03:07
258000 -- (-1697.347) (-1698.207) [-1695.932] (-1704.573) * [-1695.192] (-1695.579) (-1697.188) (-1707.220) -- 0:03:06
258500 -- [-1695.838] (-1695.793) (-1704.847) (-1694.974) * (-1699.026) [-1696.358] (-1707.780) (-1703.408) -- 0:03:06
259000 -- (-1697.229) (-1702.108) (-1702.441) [-1697.883] * (-1692.936) [-1699.525] (-1697.186) (-1697.327) -- 0:03:05
259500 -- (-1702.814) [-1698.557] (-1698.488) (-1695.760) * (-1698.354) (-1701.550) [-1695.924] (-1701.085) -- 0:03:05
260000 -- [-1693.266] (-1702.034) (-1699.199) (-1698.540) * (-1700.567) (-1701.840) [-1694.138] (-1698.018) -- 0:03:05
Average standard deviation of split frequencies: 0.013563
260500 -- [-1698.394] (-1703.991) (-1700.818) (-1699.363) * [-1694.998] (-1702.793) (-1703.075) (-1696.752) -- 0:03:04
261000 -- (-1695.590) (-1699.811) (-1692.711) [-1697.271] * [-1695.986] (-1695.232) (-1698.624) (-1700.493) -- 0:03:04
261500 -- [-1692.349] (-1702.781) (-1695.460) (-1698.489) * [-1691.211] (-1695.685) (-1694.524) (-1696.419) -- 0:03:06
262000 -- (-1698.793) (-1699.225) (-1704.163) [-1700.595] * (-1699.826) (-1699.672) (-1695.727) [-1698.967] -- 0:03:05
262500 -- (-1696.956) (-1697.460) (-1720.593) [-1695.177] * (-1695.792) (-1698.497) (-1698.898) [-1695.519] -- 0:03:05
263000 -- (-1701.632) [-1696.440] (-1703.648) (-1699.286) * [-1692.625] (-1693.927) (-1702.183) (-1694.966) -- 0:03:04
263500 -- (-1704.820) (-1698.588) [-1695.396] (-1694.247) * [-1694.745] (-1697.934) (-1694.555) (-1695.134) -- 0:03:04
264000 -- (-1702.086) [-1694.056] (-1703.874) (-1703.935) * (-1701.275) [-1692.302] (-1702.422) (-1694.295) -- 0:03:04
264500 -- (-1699.671) (-1705.052) (-1693.519) [-1697.383] * (-1696.678) [-1695.996] (-1700.164) (-1698.345) -- 0:03:03
265000 -- (-1695.718) (-1694.783) (-1697.693) [-1697.542] * (-1700.615) (-1695.230) (-1695.124) [-1697.753] -- 0:03:03
Average standard deviation of split frequencies: 0.014178
265500 -- (-1697.911) (-1693.636) [-1692.686] (-1706.589) * (-1703.920) (-1700.196) [-1694.111] (-1698.045) -- 0:03:05
266000 -- (-1696.941) (-1694.896) [-1694.385] (-1694.528) * (-1699.922) [-1694.468] (-1696.306) (-1701.902) -- 0:03:04
266500 -- (-1700.770) (-1694.982) (-1708.087) [-1695.666] * (-1695.034) [-1694.400] (-1698.887) (-1703.426) -- 0:03:04
267000 -- [-1698.831] (-1695.172) (-1693.144) (-1692.699) * [-1691.464] (-1691.710) (-1704.622) (-1695.954) -- 0:03:03
267500 -- (-1706.864) (-1699.638) [-1696.062] (-1706.075) * [-1696.802] (-1694.298) (-1694.770) (-1697.806) -- 0:03:03
268000 -- (-1691.314) (-1697.494) [-1700.647] (-1703.230) * (-1697.227) (-1694.363) [-1693.962] (-1705.746) -- 0:03:03
268500 -- [-1694.583] (-1701.455) (-1704.025) (-1705.684) * (-1701.706) [-1692.783] (-1704.431) (-1695.442) -- 0:03:02
269000 -- (-1698.345) (-1697.219) (-1700.384) [-1697.975] * (-1699.595) [-1699.658] (-1698.069) (-1695.178) -- 0:03:02
269500 -- (-1698.468) [-1697.084] (-1694.726) (-1697.091) * (-1696.284) (-1700.265) [-1697.984] (-1696.717) -- 0:03:04
270000 -- (-1696.555) [-1694.401] (-1700.911) (-1703.666) * (-1694.577) [-1696.343] (-1694.681) (-1694.186) -- 0:03:03
Average standard deviation of split frequencies: 0.014369
270500 -- (-1700.814) [-1696.952] (-1701.730) (-1704.241) * (-1694.080) (-1700.150) (-1699.995) [-1692.958] -- 0:03:03
271000 -- [-1696.639] (-1707.193) (-1702.079) (-1702.464) * [-1697.571] (-1699.619) (-1705.600) (-1699.669) -- 0:03:02
271500 -- [-1692.176] (-1703.580) (-1699.315) (-1704.031) * (-1697.174) [-1701.000] (-1694.629) (-1693.828) -- 0:03:02
272000 -- (-1696.002) (-1700.877) [-1694.135] (-1694.620) * (-1693.573) (-1701.969) [-1693.771] (-1693.223) -- 0:03:02
272500 -- [-1693.666] (-1707.837) (-1698.854) (-1695.848) * (-1692.852) [-1696.552] (-1710.384) (-1695.656) -- 0:03:01
273000 -- (-1702.110) (-1703.604) [-1693.538] (-1702.866) * [-1693.007] (-1703.707) (-1694.335) (-1704.084) -- 0:03:03
273500 -- (-1711.281) (-1699.310) (-1701.360) [-1696.588] * (-1698.489) (-1701.961) (-1693.385) [-1692.301] -- 0:03:03
274000 -- (-1696.374) (-1699.843) [-1693.935] (-1692.255) * (-1697.226) [-1701.381] (-1698.889) (-1690.236) -- 0:03:02
274500 -- (-1709.171) (-1701.392) (-1697.386) [-1690.708] * [-1695.824] (-1698.567) (-1697.598) (-1691.308) -- 0:03:02
275000 -- (-1700.537) (-1704.246) (-1701.426) [-1690.980] * (-1695.164) (-1697.066) (-1702.742) [-1691.291] -- 0:03:01
Average standard deviation of split frequencies: 0.012383
275500 -- (-1705.348) (-1695.846) [-1693.942] (-1696.444) * [-1696.041] (-1706.209) (-1698.457) (-1696.344) -- 0:03:01
276000 -- (-1703.366) [-1689.849] (-1702.326) (-1702.589) * [-1697.242] (-1699.427) (-1700.744) (-1697.740) -- 0:03:01
276500 -- (-1708.566) (-1696.314) [-1695.584] (-1694.438) * (-1695.073) (-1701.875) (-1697.466) [-1691.814] -- 0:03:00
277000 -- (-1695.165) (-1695.527) [-1695.477] (-1699.519) * (-1702.535) [-1698.270] (-1706.715) (-1695.459) -- 0:03:02
277500 -- (-1695.305) (-1699.989) [-1695.958] (-1698.392) * (-1696.600) (-1697.542) (-1702.593) [-1696.354] -- 0:03:02
278000 -- (-1695.758) (-1700.115) [-1697.813] (-1695.435) * (-1696.754) (-1694.335) (-1697.159) [-1697.601] -- 0:03:01
278500 -- (-1696.849) (-1696.622) (-1699.706) [-1703.244] * [-1696.356] (-1695.495) (-1703.167) (-1707.174) -- 0:03:01
279000 -- (-1693.252) [-1693.772] (-1699.793) (-1699.007) * (-1692.756) (-1703.515) (-1695.474) [-1701.752] -- 0:03:00
279500 -- (-1697.909) (-1696.258) [-1694.884] (-1708.037) * [-1694.575] (-1701.346) (-1700.387) (-1694.669) -- 0:03:00
280000 -- (-1697.311) (-1693.615) (-1698.214) [-1699.217] * (-1700.804) (-1695.340) (-1695.063) [-1696.437] -- 0:03:00
Average standard deviation of split frequencies: 0.007138
280500 -- (-1692.072) [-1693.210] (-1695.547) (-1698.486) * (-1698.450) (-1693.411) (-1690.988) [-1696.255] -- 0:02:59
281000 -- [-1692.976] (-1700.260) (-1694.504) (-1695.102) * (-1693.808) (-1698.297) [-1697.090] (-1698.090) -- 0:03:01
281500 -- (-1707.332) [-1696.014] (-1695.181) (-1691.143) * [-1699.653] (-1699.023) (-1700.756) (-1696.738) -- 0:03:01
282000 -- (-1697.279) (-1706.095) (-1700.513) [-1691.762] * (-1698.068) (-1693.754) (-1701.505) [-1690.214] -- 0:03:00
282500 -- (-1695.487) (-1703.650) (-1699.926) [-1694.223] * (-1691.681) (-1698.326) (-1696.445) [-1692.658] -- 0:03:00
283000 -- (-1687.686) (-1697.847) [-1698.869] (-1693.379) * (-1693.265) [-1700.650] (-1694.711) (-1697.567) -- 0:02:59
283500 -- [-1700.232] (-1701.256) (-1691.317) (-1694.911) * (-1694.517) (-1695.921) (-1696.395) [-1702.536] -- 0:02:59
284000 -- (-1701.281) (-1694.314) (-1698.229) [-1693.156] * (-1698.278) (-1699.533) [-1694.749] (-1697.093) -- 0:02:59
284500 -- [-1700.169] (-1694.678) (-1696.933) (-1696.920) * (-1707.620) (-1693.585) [-1694.771] (-1696.322) -- 0:02:58
285000 -- (-1702.208) (-1696.940) (-1703.739) [-1694.009] * (-1691.136) (-1695.114) (-1697.747) [-1695.044] -- 0:03:00
Average standard deviation of split frequencies: 0.006181
285500 -- (-1693.547) [-1698.219] (-1705.140) (-1697.314) * (-1695.322) (-1693.368) [-1695.840] (-1703.639) -- 0:03:00
286000 -- (-1695.333) (-1701.123) [-1699.113] (-1697.115) * (-1705.853) (-1703.996) [-1692.056] (-1697.030) -- 0:02:59
286500 -- (-1696.618) (-1693.299) (-1696.585) [-1688.907] * [-1696.959] (-1700.715) (-1696.510) (-1697.394) -- 0:02:59
287000 -- (-1697.839) [-1697.979] (-1703.430) (-1698.804) * (-1698.869) [-1694.065] (-1694.240) (-1696.521) -- 0:02:58
287500 -- (-1698.875) [-1696.091] (-1701.235) (-1700.249) * (-1696.390) (-1692.783) (-1697.100) [-1699.749] -- 0:02:58
288000 -- [-1692.972] (-1695.755) (-1702.911) (-1698.299) * (-1696.011) (-1697.288) [-1692.745] (-1698.979) -- 0:02:58
288500 -- (-1696.043) (-1695.251) (-1698.274) [-1693.652] * (-1696.353) (-1692.360) (-1702.947) [-1693.920] -- 0:02:57
289000 -- [-1694.883] (-1695.843) (-1698.987) (-1691.897) * (-1697.170) (-1696.383) (-1698.531) [-1698.795] -- 0:02:59
289500 -- [-1695.491] (-1693.509) (-1694.975) (-1696.366) * [-1694.763] (-1702.416) (-1714.982) (-1698.054) -- 0:02:59
290000 -- (-1692.067) (-1704.879) (-1700.345) [-1700.409] * [-1696.154] (-1695.647) (-1699.400) (-1698.258) -- 0:02:58
Average standard deviation of split frequencies: 0.005676
290500 -- (-1690.982) (-1700.008) (-1701.591) [-1694.356] * (-1698.780) (-1704.553) [-1690.503] (-1694.142) -- 0:02:58
291000 -- (-1697.614) (-1699.483) (-1692.918) [-1693.584] * (-1692.809) (-1702.518) [-1699.729] (-1692.882) -- 0:02:57
291500 -- (-1698.098) [-1695.433] (-1697.462) (-1694.791) * (-1703.402) [-1690.725] (-1699.845) (-1694.699) -- 0:02:57
292000 -- (-1695.198) [-1697.442] (-1694.487) (-1704.409) * (-1694.851) [-1692.874] (-1693.387) (-1700.806) -- 0:02:57
292500 -- [-1696.443] (-1699.059) (-1698.673) (-1699.919) * (-1702.214) (-1699.789) [-1693.069] (-1698.724) -- 0:02:56
293000 -- (-1696.226) (-1701.744) [-1694.222] (-1696.550) * (-1694.185) [-1696.091] (-1691.786) (-1700.968) -- 0:02:58
293500 -- [-1692.775] (-1698.271) (-1704.974) (-1698.697) * (-1697.065) (-1701.894) [-1698.835] (-1700.193) -- 0:02:58
294000 -- [-1694.603] (-1702.224) (-1700.550) (-1702.261) * [-1695.011] (-1692.370) (-1692.909) (-1696.672) -- 0:02:57
294500 -- (-1700.267) (-1702.438) (-1690.830) [-1696.126] * (-1695.250) (-1698.438) (-1696.951) [-1695.343] -- 0:02:57
295000 -- (-1694.308) [-1695.005] (-1698.873) (-1694.208) * (-1697.184) [-1690.539] (-1695.421) (-1697.417) -- 0:02:56
Average standard deviation of split frequencies: 0.005972
295500 -- (-1703.676) (-1699.226) [-1693.260] (-1696.094) * (-1697.173) (-1699.187) (-1696.942) [-1692.313] -- 0:02:56
296000 -- [-1692.973] (-1697.796) (-1696.459) (-1703.029) * (-1693.733) (-1698.755) (-1705.649) [-1693.029] -- 0:02:56
296500 -- (-1692.205) (-1700.334) (-1695.653) [-1693.978] * (-1693.246) (-1698.235) (-1703.141) [-1694.068] -- 0:02:55
297000 -- (-1694.488) (-1699.430) [-1694.632] (-1698.368) * (-1701.046) (-1695.693) [-1695.686] (-1697.855) -- 0:02:57
297500 -- [-1694.953] (-1706.505) (-1693.534) (-1701.344) * (-1702.551) (-1697.499) [-1691.998] (-1699.910) -- 0:02:57
298000 -- [-1694.106] (-1693.846) (-1696.040) (-1701.760) * (-1701.012) (-1700.071) [-1690.530] (-1693.375) -- 0:02:56
298500 -- (-1692.133) (-1694.207) (-1694.249) [-1694.325] * (-1701.007) (-1700.847) (-1692.995) [-1695.562] -- 0:02:56
299000 -- [-1693.030] (-1696.407) (-1698.137) (-1697.348) * (-1698.750) (-1697.908) [-1693.669] (-1701.930) -- 0:02:55
299500 -- (-1700.970) [-1693.885] (-1703.795) (-1696.176) * [-1697.471] (-1707.689) (-1702.377) (-1697.878) -- 0:02:55
300000 -- (-1699.514) (-1692.077) (-1703.659) [-1697.129] * (-1698.286) [-1695.923] (-1700.070) (-1700.763) -- 0:02:55
Average standard deviation of split frequencies: 0.004704
300500 -- (-1694.517) (-1695.076) [-1701.470] (-1697.614) * (-1698.438) (-1694.932) [-1697.445] (-1690.632) -- 0:02:54
301000 -- [-1695.853] (-1696.422) (-1699.532) (-1697.922) * (-1703.948) (-1694.766) [-1697.364] (-1704.643) -- 0:02:56
301500 -- [-1701.038] (-1694.565) (-1696.743) (-1691.791) * (-1702.392) (-1692.482) [-1700.658] (-1695.844) -- 0:02:56
302000 -- [-1693.723] (-1706.931) (-1700.639) (-1691.044) * (-1697.997) (-1692.806) [-1701.735] (-1698.024) -- 0:02:55
302500 -- (-1695.251) (-1698.439) (-1699.934) [-1695.129] * (-1708.343) (-1696.611) [-1696.831] (-1691.216) -- 0:02:55
303000 -- (-1693.691) [-1697.713] (-1695.274) (-1702.408) * [-1699.862] (-1701.519) (-1700.917) (-1691.706) -- 0:02:54
303500 -- (-1690.600) [-1696.771] (-1695.755) (-1699.790) * (-1693.751) [-1692.981] (-1697.575) (-1703.710) -- 0:02:54
304000 -- [-1691.742] (-1697.300) (-1700.129) (-1700.362) * (-1697.481) (-1692.835) (-1699.813) [-1694.391] -- 0:02:54
304500 -- (-1695.835) [-1694.784] (-1695.319) (-1697.607) * (-1697.942) (-1692.678) [-1697.408] (-1694.061) -- 0:02:53
305000 -- (-1706.260) (-1695.087) [-1697.213] (-1691.986) * (-1699.007) (-1694.863) (-1699.739) [-1691.280] -- 0:02:55
Average standard deviation of split frequencies: 0.004622
305500 -- (-1694.215) [-1694.009] (-1696.285) (-1694.125) * (-1696.996) (-1693.444) (-1699.533) [-1690.170] -- 0:02:55
306000 -- [-1693.663] (-1694.076) (-1698.031) (-1701.514) * [-1700.630] (-1695.248) (-1702.401) (-1696.261) -- 0:02:54
306500 -- (-1689.720) (-1694.120) [-1694.139] (-1696.391) * (-1701.062) (-1703.069) [-1698.448] (-1698.389) -- 0:02:54
307000 -- [-1689.272] (-1695.849) (-1696.333) (-1703.277) * [-1702.940] (-1696.865) (-1694.682) (-1690.913) -- 0:02:53
307500 -- (-1692.983) [-1694.820] (-1694.254) (-1698.687) * (-1703.254) [-1697.072] (-1702.288) (-1706.868) -- 0:02:53
308000 -- (-1700.914) (-1692.800) [-1697.939] (-1700.008) * (-1701.024) (-1697.415) [-1695.088] (-1698.839) -- 0:02:53
308500 -- [-1696.421] (-1705.647) (-1699.234) (-1697.151) * (-1708.888) (-1694.531) [-1694.047] (-1698.745) -- 0:02:54
309000 -- (-1701.446) [-1695.866] (-1697.205) (-1700.315) * (-1703.663) (-1695.281) [-1699.838] (-1699.582) -- 0:02:54
309500 -- (-1702.046) [-1697.869] (-1698.825) (-1700.823) * (-1697.950) [-1700.396] (-1695.429) (-1696.827) -- 0:02:54
310000 -- [-1695.801] (-1695.413) (-1692.499) (-1700.227) * (-1701.953) (-1701.121) (-1698.060) [-1696.365] -- 0:02:53
Average standard deviation of split frequencies: 0.004552
310500 -- (-1703.220) [-1700.319] (-1697.246) (-1693.823) * [-1695.203] (-1696.935) (-1696.592) (-1702.286) -- 0:02:53
311000 -- (-1697.972) [-1692.850] (-1700.382) (-1692.597) * [-1692.762] (-1695.200) (-1696.158) (-1700.289) -- 0:02:52
311500 -- [-1693.366] (-1699.410) (-1692.423) (-1698.557) * (-1693.018) (-1695.071) (-1695.977) [-1692.442] -- 0:02:52
312000 -- [-1694.958] (-1696.869) (-1698.570) (-1691.941) * (-1692.769) (-1694.584) (-1699.925) [-1707.527] -- 0:02:52
312500 -- (-1693.506) (-1710.230) [-1694.911] (-1700.682) * (-1695.893) (-1696.836) [-1697.244] (-1703.842) -- 0:02:53
313000 -- (-1699.928) (-1701.648) [-1697.245] (-1703.718) * (-1692.388) (-1699.108) (-1694.726) [-1701.770] -- 0:02:53
313500 -- (-1695.293) [-1699.618] (-1700.770) (-1712.319) * (-1696.329) (-1697.997) [-1697.535] (-1695.567) -- 0:02:52
314000 -- (-1700.691) (-1705.683) [-1698.626] (-1720.382) * [-1695.247] (-1695.513) (-1693.966) (-1697.211) -- 0:02:52
314500 -- [-1692.997] (-1693.741) (-1691.692) (-1711.789) * (-1698.461) (-1694.104) [-1696.820] (-1696.037) -- 0:02:52
315000 -- (-1701.193) [-1698.624] (-1696.749) (-1708.931) * (-1703.350) (-1691.671) [-1697.910] (-1701.770) -- 0:02:51
Average standard deviation of split frequencies: 0.003729
315500 -- (-1692.333) (-1703.193) [-1699.340] (-1701.885) * (-1705.362) [-1694.867] (-1698.382) (-1697.530) -- 0:02:51
316000 -- (-1693.972) [-1702.443] (-1695.196) (-1699.833) * (-1699.010) [-1697.160] (-1696.815) (-1696.179) -- 0:02:53
316500 -- [-1700.753] (-1693.114) (-1696.937) (-1697.899) * [-1694.676] (-1698.828) (-1705.907) (-1698.895) -- 0:02:52
317000 -- (-1695.814) (-1703.643) [-1698.893] (-1695.531) * (-1693.072) [-1693.151] (-1700.588) (-1695.506) -- 0:02:52
317500 -- [-1694.760] (-1701.637) (-1700.090) (-1698.542) * (-1695.171) (-1701.375) [-1695.999] (-1698.285) -- 0:02:51
318000 -- [-1695.839] (-1698.278) (-1700.301) (-1699.599) * (-1696.859) (-1693.657) [-1696.828] (-1698.531) -- 0:02:51
318500 -- [-1693.096] (-1702.679) (-1697.476) (-1695.746) * [-1694.711] (-1696.361) (-1694.606) (-1692.816) -- 0:02:51
319000 -- (-1701.462) (-1703.530) [-1695.211] (-1697.000) * (-1692.545) (-1703.501) (-1701.135) [-1692.879] -- 0:02:50
319500 -- (-1697.855) (-1700.624) (-1693.252) [-1695.563] * (-1705.310) (-1697.363) (-1705.947) [-1696.370] -- 0:02:50
320000 -- (-1699.368) [-1697.189] (-1699.098) (-1699.097) * (-1694.829) (-1698.574) [-1703.682] (-1694.545) -- 0:02:52
Average standard deviation of split frequencies: 0.003675
320500 -- (-1707.373) (-1695.343) (-1694.730) [-1696.792] * [-1694.661] (-1701.173) (-1698.203) (-1690.158) -- 0:02:51
321000 -- [-1695.358] (-1695.739) (-1693.747) (-1695.807) * (-1699.301) (-1700.588) [-1691.660] (-1694.271) -- 0:02:51
321500 -- [-1698.876] (-1703.236) (-1698.174) (-1691.279) * [-1695.355] (-1706.534) (-1697.222) (-1699.611) -- 0:02:50
322000 -- (-1695.150) (-1696.994) (-1699.346) [-1694.197] * (-1696.900) (-1700.933) (-1693.215) [-1699.193] -- 0:02:50
322500 -- (-1703.917) (-1695.467) (-1692.481) [-1692.472] * (-1693.538) (-1693.466) [-1690.954] (-1701.815) -- 0:02:50
323000 -- (-1697.880) (-1695.552) (-1691.237) [-1694.188] * [-1692.290] (-1699.286) (-1694.293) (-1697.506) -- 0:02:49
323500 -- (-1696.914) [-1699.772] (-1697.615) (-1698.035) * [-1693.530] (-1697.559) (-1694.448) (-1701.541) -- 0:02:49
324000 -- [-1694.296] (-1696.062) (-1701.271) (-1698.235) * (-1699.072) (-1701.545) [-1695.433] (-1699.972) -- 0:02:51
324500 -- [-1692.593] (-1695.088) (-1698.055) (-1698.552) * [-1694.476] (-1709.660) (-1700.238) (-1701.422) -- 0:02:50
325000 -- (-1697.491) [-1700.648] (-1703.911) (-1699.246) * [-1693.711] (-1704.606) (-1702.050) (-1705.775) -- 0:02:50
Average standard deviation of split frequencies: 0.003615
325500 -- [-1697.511] (-1702.383) (-1698.669) (-1701.134) * (-1691.799) (-1703.931) (-1696.139) [-1697.812] -- 0:02:49
326000 -- (-1695.018) (-1700.295) (-1696.518) [-1696.866] * (-1700.033) (-1710.588) (-1702.942) [-1693.353] -- 0:02:49
326500 -- (-1710.283) (-1696.312) (-1701.003) [-1696.776] * (-1701.995) (-1698.600) [-1697.705] (-1699.595) -- 0:02:49
327000 -- (-1699.649) [-1697.593] (-1697.161) (-1697.616) * (-1693.664) (-1701.789) [-1698.439] (-1701.689) -- 0:02:48
327500 -- (-1702.962) (-1698.419) (-1697.389) [-1695.805] * (-1698.524) (-1707.943) (-1695.521) [-1697.680] -- 0:02:48
328000 -- [-1697.710] (-1699.613) (-1694.436) (-1692.291) * [-1692.742] (-1697.679) (-1691.349) (-1703.722) -- 0:02:50
328500 -- [-1696.649] (-1705.407) (-1696.967) (-1693.675) * (-1692.487) (-1695.860) [-1690.504] (-1699.416) -- 0:02:49
329000 -- (-1697.085) [-1700.882] (-1698.806) (-1709.898) * (-1694.589) (-1703.792) [-1693.978] (-1696.307) -- 0:02:49
329500 -- (-1701.356) (-1692.805) [-1703.822] (-1706.111) * (-1692.218) [-1704.380] (-1695.076) (-1695.678) -- 0:02:48
330000 -- (-1700.035) (-1700.723) (-1700.110) [-1700.052] * [-1689.535] (-1699.482) (-1696.043) (-1695.995) -- 0:02:48
Average standard deviation of split frequencies: 0.003564
330500 -- (-1696.005) (-1693.831) (-1702.516) [-1694.204] * (-1691.690) (-1707.368) (-1707.978) [-1696.052] -- 0:02:48
331000 -- (-1697.853) [-1695.712] (-1695.273) (-1694.196) * [-1689.316] (-1696.969) (-1698.585) (-1695.103) -- 0:02:47
331500 -- [-1694.054] (-1693.560) (-1704.483) (-1699.311) * (-1695.068) [-1696.103] (-1693.347) (-1694.945) -- 0:02:47
332000 -- [-1694.171] (-1699.210) (-1699.752) (-1693.691) * (-1698.120) (-1692.634) (-1701.785) [-1696.470] -- 0:02:49
332500 -- [-1689.947] (-1699.289) (-1697.032) (-1702.519) * (-1702.719) [-1697.104] (-1699.995) (-1693.775) -- 0:02:48
333000 -- (-1690.488) (-1695.110) [-1695.339] (-1694.353) * (-1703.978) (-1694.441) (-1701.148) [-1698.686] -- 0:02:48
333500 -- (-1698.653) (-1699.747) [-1694.464] (-1695.766) * (-1691.911) (-1692.349) [-1702.098] (-1699.112) -- 0:02:47
334000 -- (-1693.039) (-1704.048) (-1695.526) [-1694.403] * (-1693.313) (-1695.683) [-1695.521] (-1702.092) -- 0:02:47
334500 -- (-1691.916) (-1702.195) (-1698.952) [-1694.475] * [-1699.209] (-1697.909) (-1692.759) (-1698.578) -- 0:02:47
335000 -- (-1693.722) [-1699.030] (-1700.331) (-1695.356) * (-1702.519) (-1701.801) [-1698.206] (-1700.129) -- 0:02:46
Average standard deviation of split frequencies: 0.003507
335500 -- [-1691.151] (-1700.092) (-1698.134) (-1692.142) * [-1694.852] (-1696.988) (-1700.086) (-1696.337) -- 0:02:46
336000 -- (-1700.619) (-1706.648) [-1699.581] (-1698.105) * (-1698.617) [-1695.342] (-1702.419) (-1697.011) -- 0:02:47
336500 -- (-1694.941) [-1696.983] (-1709.036) (-1698.494) * [-1700.318] (-1693.527) (-1695.514) (-1693.453) -- 0:02:47
337000 -- (-1700.203) (-1693.333) (-1695.736) [-1701.483] * [-1698.984] (-1702.407) (-1695.733) (-1697.519) -- 0:02:47
337500 -- [-1695.364] (-1696.899) (-1695.077) (-1701.642) * [-1693.551] (-1700.687) (-1699.698) (-1701.362) -- 0:02:46
338000 -- (-1700.138) (-1695.034) [-1702.938] (-1698.290) * (-1696.697) [-1694.608] (-1693.022) (-1702.338) -- 0:02:46
338500 -- (-1702.120) [-1691.874] (-1700.342) (-1692.972) * (-1701.988) (-1699.384) [-1698.520] (-1694.254) -- 0:02:46
339000 -- (-1699.893) (-1693.153) [-1697.667] (-1707.990) * (-1696.974) (-1692.363) [-1696.436] (-1696.671) -- 0:02:45
339500 -- [-1699.198] (-1691.836) (-1693.581) (-1706.808) * (-1699.695) (-1694.108) [-1697.644] (-1699.325) -- 0:02:45
340000 -- (-1699.191) [-1691.253] (-1696.396) (-1700.513) * (-1700.984) (-1696.330) [-1696.446] (-1696.516) -- 0:02:46
Average standard deviation of split frequencies: 0.003459
340500 -- (-1705.995) (-1700.062) (-1692.964) [-1697.307] * (-1697.598) (-1695.232) (-1692.851) [-1695.172] -- 0:02:46
341000 -- (-1704.650) (-1693.423) [-1694.433] (-1696.504) * (-1702.603) [-1702.292] (-1694.196) (-1694.578) -- 0:02:46
341500 -- (-1697.138) (-1705.200) (-1697.030) [-1696.552] * (-1696.333) [-1692.515] (-1689.169) (-1699.727) -- 0:02:45
342000 -- (-1694.161) (-1701.603) (-1699.731) [-1698.463] * (-1696.845) (-1699.130) [-1694.723] (-1695.792) -- 0:02:45
342500 -- (-1694.518) (-1698.235) (-1699.272) [-1696.599] * (-1696.064) (-1699.693) (-1701.187) [-1696.727] -- 0:02:45
343000 -- (-1701.141) (-1700.913) (-1698.188) [-1695.209] * [-1697.378] (-1700.835) (-1707.283) (-1698.755) -- 0:02:44
343500 -- [-1697.584] (-1696.560) (-1695.051) (-1698.750) * [-1700.921] (-1698.444) (-1695.099) (-1699.470) -- 0:02:44
344000 -- [-1695.962] (-1697.542) (-1700.635) (-1704.630) * (-1701.590) [-1693.766] (-1693.086) (-1696.094) -- 0:02:45
344500 -- [-1695.588] (-1698.631) (-1700.959) (-1692.216) * (-1695.243) (-1695.533) [-1695.164] (-1712.184) -- 0:02:45
345000 -- (-1693.923) (-1700.524) (-1704.269) [-1696.902] * [-1695.137] (-1702.737) (-1699.688) (-1694.831) -- 0:02:45
Average standard deviation of split frequencies: 0.005790
345500 -- (-1700.191) (-1698.095) [-1693.810] (-1696.549) * (-1709.973) [-1700.028] (-1697.324) (-1692.904) -- 0:02:44
346000 -- (-1699.184) (-1703.404) [-1695.284] (-1696.127) * (-1699.969) (-1693.559) [-1698.763] (-1698.306) -- 0:02:44
346500 -- [-1694.119] (-1704.676) (-1692.315) (-1696.017) * (-1698.092) [-1695.695] (-1704.033) (-1692.145) -- 0:02:44
347000 -- [-1697.345] (-1699.168) (-1693.616) (-1706.211) * [-1700.388] (-1696.813) (-1701.408) (-1693.783) -- 0:02:43
347500 -- (-1697.155) (-1699.089) [-1697.800] (-1701.782) * (-1698.046) [-1697.421] (-1701.371) (-1690.272) -- 0:02:43
348000 -- (-1696.984) (-1697.827) [-1706.229] (-1704.351) * (-1693.607) [-1690.837] (-1693.886) (-1691.885) -- 0:02:44
348500 -- (-1699.353) (-1697.468) [-1690.942] (-1705.041) * (-1697.647) (-1699.219) (-1690.256) [-1692.031] -- 0:02:44
349000 -- (-1696.064) [-1694.408] (-1694.954) (-1708.139) * (-1701.692) (-1697.886) [-1695.140] (-1695.389) -- 0:02:44
349500 -- (-1694.179) (-1697.343) (-1695.550) [-1706.763] * (-1703.722) [-1694.196] (-1696.123) (-1696.067) -- 0:02:43
350000 -- (-1704.614) (-1693.082) [-1697.444] (-1696.027) * (-1699.870) [-1695.150] (-1698.825) (-1695.338) -- 0:02:43
Average standard deviation of split frequencies: 0.008402
350500 -- (-1695.963) [-1694.660] (-1696.872) (-1701.346) * (-1698.486) [-1694.381] (-1702.812) (-1702.953) -- 0:02:43
351000 -- (-1702.595) (-1691.884) (-1700.666) [-1699.943] * (-1705.187) (-1696.392) (-1691.536) [-1697.934] -- 0:02:42
351500 -- (-1696.543) (-1703.062) [-1694.375] (-1699.171) * (-1704.260) (-1696.302) (-1692.125) [-1696.613] -- 0:02:42
352000 -- (-1705.697) [-1694.716] (-1692.633) (-1701.166) * (-1701.551) [-1697.681] (-1693.852) (-1698.507) -- 0:02:43
352500 -- (-1696.635) [-1692.037] (-1693.314) (-1700.192) * (-1699.700) (-1702.317) (-1703.186) [-1697.669] -- 0:02:43
353000 -- (-1696.699) (-1700.077) [-1695.607] (-1706.569) * [-1701.556] (-1696.671) (-1701.513) (-1698.273) -- 0:02:43
353500 -- [-1694.728] (-1697.085) (-1694.252) (-1700.213) * (-1698.964) (-1698.637) (-1690.678) [-1691.442] -- 0:02:42
354000 -- (-1704.858) (-1697.836) [-1692.945] (-1700.468) * (-1695.709) (-1709.768) (-1694.128) [-1691.882] -- 0:02:42
354500 -- (-1697.167) (-1701.483) (-1694.704) [-1705.724] * [-1696.074] (-1698.380) (-1696.511) (-1692.976) -- 0:02:42
355000 -- (-1707.632) (-1701.757) [-1695.376] (-1706.410) * [-1699.297] (-1699.886) (-1697.307) (-1693.877) -- 0:02:41
Average standard deviation of split frequencies: 0.004966
355500 -- (-1695.152) (-1706.017) [-1693.559] (-1696.695) * (-1694.365) (-1706.345) (-1695.339) [-1699.537] -- 0:02:41
356000 -- (-1700.228) (-1691.871) (-1697.308) [-1696.495] * [-1694.461] (-1698.765) (-1698.274) (-1701.321) -- 0:02:42
356500 -- (-1699.840) (-1696.459) [-1696.105] (-1698.252) * [-1695.672] (-1697.951) (-1699.493) (-1700.146) -- 0:02:42
357000 -- (-1698.025) [-1695.169] (-1698.312) (-1695.018) * [-1698.140] (-1704.523) (-1695.407) (-1698.316) -- 0:02:42
357500 -- (-1706.486) (-1693.326) (-1695.003) [-1698.324] * (-1700.484) (-1703.190) [-1699.555] (-1694.879) -- 0:02:41
358000 -- (-1699.560) (-1703.333) [-1697.134] (-1699.452) * (-1696.213) [-1693.434] (-1698.704) (-1693.869) -- 0:02:41
358500 -- (-1697.445) (-1705.165) (-1698.422) [-1697.008] * (-1697.522) (-1697.971) (-1694.699) [-1699.110] -- 0:02:41
359000 -- [-1697.951] (-1699.600) (-1701.456) (-1695.965) * (-1693.571) [-1696.198] (-1700.024) (-1699.414) -- 0:02:40
359500 -- (-1695.459) (-1697.632) (-1693.382) [-1694.301] * (-1694.182) (-1699.290) (-1692.630) [-1691.611] -- 0:02:42
360000 -- (-1696.170) (-1693.261) [-1695.740] (-1694.384) * (-1700.227) [-1700.382] (-1693.719) (-1694.675) -- 0:02:41
Average standard deviation of split frequencies: 0.004575
360500 -- (-1696.082) (-1705.052) (-1694.769) [-1700.244] * (-1700.960) [-1696.526] (-1698.376) (-1692.776) -- 0:02:41
361000 -- (-1700.897) [-1706.708] (-1697.945) (-1704.357) * (-1703.539) (-1705.624) [-1692.796] (-1697.294) -- 0:02:41
361500 -- (-1694.028) (-1703.461) [-1696.312] (-1694.988) * [-1694.834] (-1700.759) (-1693.851) (-1699.990) -- 0:02:40
362000 -- (-1700.202) (-1708.083) [-1699.435] (-1695.715) * (-1696.828) (-1697.371) (-1698.105) [-1701.497] -- 0:02:40
362500 -- (-1695.945) [-1695.722] (-1699.836) (-1698.479) * (-1702.161) (-1702.938) (-1691.974) [-1703.186] -- 0:02:40
363000 -- (-1701.608) (-1695.772) [-1695.611] (-1694.000) * (-1705.532) [-1696.461] (-1697.847) (-1695.886) -- 0:02:39
363500 -- (-1698.916) (-1692.993) (-1692.777) [-1692.766] * (-1698.050) [-1694.849] (-1697.256) (-1695.789) -- 0:02:41
364000 -- (-1696.358) [-1696.988] (-1691.837) (-1693.650) * (-1700.987) (-1698.584) [-1693.468] (-1710.359) -- 0:02:40
364500 -- [-1695.827] (-1692.457) (-1695.413) (-1692.744) * (-1705.711) [-1692.446] (-1693.675) (-1697.781) -- 0:02:40
365000 -- (-1700.723) (-1694.714) [-1700.190] (-1698.787) * (-1692.504) (-1695.290) (-1699.760) [-1694.817] -- 0:02:40
Average standard deviation of split frequencies: 0.004830
365500 -- (-1704.814) [-1694.588] (-1698.733) (-1693.485) * (-1701.721) (-1698.432) (-1699.447) [-1691.717] -- 0:02:39
366000 -- (-1704.034) (-1698.061) (-1696.701) [-1689.514] * (-1700.260) [-1698.677] (-1697.426) (-1699.821) -- 0:02:39
366500 -- [-1694.311] (-1695.839) (-1692.129) (-1697.169) * (-1698.745) (-1698.916) [-1697.514] (-1699.682) -- 0:02:39
367000 -- (-1699.416) [-1696.339] (-1695.250) (-1698.735) * (-1695.993) (-1698.179) (-1702.301) [-1695.027] -- 0:02:38
367500 -- [-1694.986] (-1697.846) (-1695.119) (-1696.671) * [-1691.854] (-1695.937) (-1699.184) (-1694.676) -- 0:02:40
368000 -- (-1705.668) [-1695.256] (-1697.563) (-1693.553) * (-1697.163) (-1707.264) [-1696.740] (-1702.604) -- 0:02:39
368500 -- (-1696.804) [-1694.844] (-1697.988) (-1707.416) * (-1696.522) (-1699.951) (-1707.832) [-1697.613] -- 0:02:39
369000 -- [-1696.422] (-1697.018) (-1697.672) (-1699.656) * [-1694.602] (-1695.934) (-1701.379) (-1695.746) -- 0:02:39
369500 -- [-1697.207] (-1702.820) (-1696.754) (-1695.037) * [-1699.766] (-1692.846) (-1697.556) (-1695.981) -- 0:02:38
370000 -- (-1700.363) (-1705.696) (-1702.420) [-1694.733] * [-1690.330] (-1697.784) (-1696.057) (-1695.610) -- 0:02:38
Average standard deviation of split frequencies: 0.004769
370500 -- (-1696.560) (-1694.141) (-1700.730) [-1697.916] * [-1691.028] (-1702.191) (-1695.272) (-1693.028) -- 0:02:38
371000 -- (-1695.508) (-1702.210) [-1693.391] (-1697.172) * (-1693.959) (-1697.587) [-1690.953] (-1695.239) -- 0:02:37
371500 -- (-1694.939) (-1695.796) (-1694.631) [-1696.290] * [-1692.969] (-1705.864) (-1694.606) (-1701.462) -- 0:02:39
372000 -- [-1700.602] (-1698.114) (-1691.367) (-1695.116) * (-1697.219) (-1698.040) [-1691.900] (-1697.199) -- 0:02:38
372500 -- (-1697.177) (-1697.091) [-1695.064] (-1701.802) * (-1698.929) (-1700.078) (-1699.106) [-1693.605] -- 0:02:38
373000 -- (-1695.345) [-1695.669] (-1692.414) (-1698.151) * (-1702.325) (-1698.148) [-1693.318] (-1706.211) -- 0:02:38
373500 -- (-1694.218) (-1699.716) [-1694.746] (-1696.326) * (-1696.743) (-1691.954) [-1695.858] (-1704.773) -- 0:02:37
374000 -- [-1700.272] (-1693.839) (-1697.542) (-1697.349) * [-1700.495] (-1701.930) (-1697.072) (-1706.727) -- 0:02:37
374500 -- (-1703.228) (-1693.167) [-1693.925] (-1692.865) * [-1699.945] (-1700.771) (-1700.274) (-1702.030) -- 0:02:37
375000 -- [-1698.763] (-1697.682) (-1703.618) (-1690.088) * (-1699.706) (-1699.754) [-1692.733] (-1701.698) -- 0:02:36
Average standard deviation of split frequencies: 0.006269
375500 -- (-1697.737) (-1695.307) (-1692.847) [-1699.865] * [-1695.195] (-1695.616) (-1698.928) (-1695.749) -- 0:02:37
376000 -- (-1698.255) (-1709.337) [-1693.085] (-1694.418) * (-1697.724) [-1693.144] (-1702.033) (-1702.907) -- 0:02:37
376500 -- [-1695.474] (-1693.331) (-1706.482) (-1699.836) * (-1700.819) (-1693.782) [-1695.464] (-1695.830) -- 0:02:37
377000 -- (-1697.980) (-1697.855) [-1698.932] (-1695.981) * (-1696.085) [-1695.726] (-1699.997) (-1699.251) -- 0:02:36
377500 -- (-1693.675) (-1702.084) (-1694.465) [-1696.097] * (-1691.869) (-1693.847) [-1694.441] (-1699.567) -- 0:02:36
378000 -- (-1702.672) (-1701.485) [-1689.335] (-1698.766) * (-1702.749) (-1695.117) (-1704.722) [-1700.111] -- 0:02:36
378500 -- [-1696.123] (-1694.650) (-1696.973) (-1693.339) * [-1701.287] (-1693.237) (-1705.576) (-1696.983) -- 0:02:35
379000 -- (-1709.607) (-1697.786) (-1698.270) [-1692.765] * [-1699.627] (-1694.220) (-1704.806) (-1692.881) -- 0:02:35
379500 -- (-1706.196) [-1694.924] (-1700.253) (-1696.544) * (-1700.891) [-1697.063] (-1700.366) (-1694.030) -- 0:02:36
380000 -- (-1701.761) (-1702.072) [-1693.892] (-1706.512) * (-1690.925) (-1693.137) (-1693.993) [-1692.901] -- 0:02:36
Average standard deviation of split frequencies: 0.006192
380500 -- (-1696.716) (-1697.993) (-1689.680) [-1695.491] * (-1696.308) (-1693.137) (-1699.720) [-1692.510] -- 0:02:36
381000 -- (-1689.841) (-1697.973) (-1699.295) [-1694.073] * (-1694.888) [-1695.633] (-1703.933) (-1700.134) -- 0:02:35
381500 -- (-1696.992) (-1702.060) (-1700.201) [-1696.604] * [-1693.874] (-1694.355) (-1698.707) (-1697.932) -- 0:02:35
382000 -- (-1693.165) (-1696.791) [-1691.031] (-1694.705) * [-1693.433] (-1694.630) (-1696.815) (-1709.851) -- 0:02:35
382500 -- [-1693.985] (-1697.884) (-1694.509) (-1701.503) * (-1703.729) [-1695.654] (-1702.328) (-1704.053) -- 0:02:34
383000 -- [-1693.906] (-1696.364) (-1700.854) (-1699.423) * [-1696.695] (-1699.775) (-1698.450) (-1697.685) -- 0:02:34
383500 -- [-1695.729] (-1695.321) (-1704.739) (-1703.652) * (-1701.602) (-1700.157) [-1700.741] (-1699.459) -- 0:02:35
384000 -- (-1692.874) [-1693.736] (-1695.275) (-1701.646) * [-1700.255] (-1703.377) (-1702.160) (-1704.009) -- 0:02:35
384500 -- (-1697.442) [-1693.143] (-1696.037) (-1700.810) * (-1701.300) (-1700.922) (-1694.992) [-1698.918] -- 0:02:35
385000 -- (-1695.216) (-1698.881) [-1693.645] (-1696.787) * (-1699.610) [-1696.424] (-1701.617) (-1692.509) -- 0:02:34
Average standard deviation of split frequencies: 0.004274
385500 -- (-1701.684) (-1698.012) [-1695.135] (-1697.592) * (-1696.218) [-1693.855] (-1693.653) (-1696.820) -- 0:02:34
386000 -- (-1702.927) (-1701.897) (-1703.957) [-1693.078] * [-1697.144] (-1695.126) (-1699.842) (-1694.123) -- 0:02:34
386500 -- [-1696.721] (-1704.580) (-1701.153) (-1699.003) * (-1696.507) (-1696.639) [-1697.155] (-1693.355) -- 0:02:33
387000 -- (-1696.274) [-1694.302] (-1693.306) (-1696.854) * (-1693.657) (-1695.527) (-1696.596) [-1694.252] -- 0:02:33
387500 -- [-1694.266] (-1695.112) (-1703.087) (-1696.928) * (-1699.642) (-1695.464) (-1695.478) [-1695.707] -- 0:02:34
388000 -- (-1696.520) [-1695.985] (-1695.938) (-1694.405) * (-1698.252) (-1699.562) (-1697.774) [-1694.821] -- 0:02:34
388500 -- (-1703.528) [-1697.818] (-1694.717) (-1696.648) * [-1705.387] (-1694.044) (-1694.549) (-1695.519) -- 0:02:34
389000 -- (-1698.784) [-1702.418] (-1696.517) (-1697.426) * (-1697.896) (-1697.401) (-1697.863) [-1692.288] -- 0:02:33
389500 -- [-1698.203] (-1697.807) (-1698.975) (-1703.474) * (-1704.302) (-1698.215) [-1698.268] (-1696.839) -- 0:02:33
390000 -- (-1699.412) (-1695.872) (-1693.307) [-1695.986] * (-1697.454) (-1698.815) (-1694.024) [-1698.414] -- 0:02:33
Average standard deviation of split frequencies: 0.002715
390500 -- [-1703.941] (-1693.166) (-1693.885) (-1701.314) * (-1701.452) [-1699.381] (-1696.233) (-1696.991) -- 0:02:32
391000 -- (-1702.666) (-1700.281) (-1693.573) [-1692.676] * [-1701.073] (-1707.210) (-1699.694) (-1703.698) -- 0:02:32
391500 -- [-1696.136] (-1698.068) (-1697.849) (-1694.667) * (-1690.097) (-1701.829) (-1695.281) [-1692.552] -- 0:02:33
392000 -- (-1700.026) (-1694.751) [-1697.038] (-1705.484) * [-1693.670] (-1697.820) (-1706.470) (-1694.142) -- 0:02:33
392500 -- (-1696.321) [-1698.704] (-1695.822) (-1701.880) * (-1693.790) (-1702.373) (-1705.983) [-1691.673] -- 0:02:33
393000 -- (-1703.645) (-1694.191) [-1697.537] (-1692.755) * (-1701.646) (-1701.572) [-1701.050] (-1694.880) -- 0:02:32
393500 -- (-1693.977) (-1702.258) (-1696.181) [-1691.142] * (-1693.330) (-1693.785) [-1692.832] (-1694.513) -- 0:02:32
394000 -- (-1699.364) (-1698.858) [-1696.813] (-1693.242) * (-1692.488) (-1694.250) [-1695.609] (-1695.252) -- 0:02:32
394500 -- (-1696.360) (-1701.011) (-1696.345) [-1694.190] * (-1700.459) (-1700.146) [-1703.915] (-1697.705) -- 0:02:31
395000 -- (-1700.284) [-1696.334] (-1697.572) (-1698.986) * [-1696.910] (-1694.387) (-1696.413) (-1699.579) -- 0:02:31
Average standard deviation of split frequencies: 0.002381
395500 -- (-1699.784) (-1700.300) [-1696.665] (-1703.197) * (-1697.871) (-1694.033) (-1696.272) [-1692.954] -- 0:02:32
396000 -- [-1699.548] (-1697.970) (-1702.205) (-1698.755) * (-1703.139) [-1699.048] (-1699.536) (-1701.076) -- 0:02:32
396500 -- (-1696.167) (-1694.850) (-1703.288) [-1697.182] * (-1703.163) [-1694.570] (-1699.416) (-1695.535) -- 0:02:32
397000 -- (-1697.224) (-1696.675) [-1695.847] (-1698.962) * (-1701.453) (-1696.048) [-1693.749] (-1693.399) -- 0:02:31
397500 -- (-1698.040) (-1695.726) (-1694.520) [-1695.021] * (-1705.844) (-1698.380) (-1695.745) [-1693.257] -- 0:02:31
398000 -- [-1695.392] (-1694.125) (-1697.618) (-1696.824) * (-1693.537) [-1694.625] (-1693.944) (-1695.536) -- 0:02:31
398500 -- [-1692.149] (-1699.433) (-1698.446) (-1698.397) * (-1696.310) (-1704.145) [-1703.658] (-1696.504) -- 0:02:30
399000 -- (-1703.998) (-1696.648) (-1696.201) [-1700.438] * (-1701.293) (-1700.669) (-1699.421) [-1696.113] -- 0:02:30
399500 -- (-1700.885) (-1694.675) (-1693.876) [-1699.015] * [-1698.454] (-1700.876) (-1697.150) (-1699.001) -- 0:02:31
400000 -- (-1694.318) (-1692.559) (-1698.526) [-1693.342] * [-1701.176] (-1698.739) (-1696.113) (-1699.041) -- 0:02:31
Average standard deviation of split frequencies: 0.002647
400500 -- [-1696.289] (-1703.343) (-1694.527) (-1695.092) * [-1700.659] (-1702.781) (-1694.585) (-1700.997) -- 0:02:31
401000 -- (-1699.535) [-1695.726] (-1694.631) (-1702.674) * (-1699.742) [-1693.941] (-1689.875) (-1702.394) -- 0:02:30
401500 -- (-1698.909) (-1699.473) [-1693.862] (-1708.247) * [-1699.037] (-1698.593) (-1695.588) (-1704.833) -- 0:02:30
402000 -- (-1704.126) [-1703.043] (-1697.951) (-1699.745) * (-1699.705) [-1694.658] (-1700.529) (-1701.227) -- 0:02:30
402500 -- [-1699.095] (-1712.336) (-1694.189) (-1697.635) * (-1697.597) [-1696.757] (-1701.072) (-1700.377) -- 0:02:29
403000 -- (-1698.866) (-1702.506) (-1694.793) [-1697.225] * [-1695.840] (-1698.303) (-1702.609) (-1705.781) -- 0:02:29
403500 -- (-1694.016) [-1695.270] (-1695.315) (-1696.089) * (-1695.127) [-1700.467] (-1697.054) (-1697.801) -- 0:02:30
404000 -- (-1700.060) [-1690.657] (-1692.696) (-1697.564) * [-1697.070] (-1697.811) (-1693.280) (-1700.986) -- 0:02:30
404500 -- (-1698.230) [-1694.658] (-1693.750) (-1695.538) * [-1698.259] (-1713.286) (-1695.473) (-1693.438) -- 0:02:30
405000 -- (-1695.918) (-1696.442) [-1695.158] (-1698.233) * [-1705.782] (-1709.817) (-1696.431) (-1693.813) -- 0:02:29
Average standard deviation of split frequencies: 0.003483
405500 -- (-1700.830) [-1696.782] (-1692.611) (-1699.821) * (-1693.775) [-1696.198] (-1691.354) (-1695.814) -- 0:02:29
406000 -- (-1694.271) (-1693.417) [-1697.071] (-1692.598) * [-1691.852] (-1703.277) (-1694.171) (-1698.726) -- 0:02:29
406500 -- (-1692.552) [-1693.512] (-1701.156) (-1703.590) * (-1698.851) (-1691.035) [-1694.571] (-1700.933) -- 0:02:28
407000 -- (-1697.514) [-1701.283] (-1706.029) (-1700.833) * (-1690.936) [-1695.834] (-1694.706) (-1696.131) -- 0:02:30
407500 -- (-1695.016) (-1699.416) (-1695.728) [-1695.646] * (-1701.866) (-1694.970) (-1692.777) [-1690.213] -- 0:02:29
408000 -- (-1696.548) (-1696.427) [-1702.925] (-1699.971) * [-1700.347] (-1695.987) (-1701.584) (-1695.260) -- 0:02:29
408500 -- (-1695.867) [-1694.583] (-1706.422) (-1695.504) * (-1694.044) [-1694.717] (-1698.739) (-1691.860) -- 0:02:29
409000 -- (-1694.098) [-1696.620] (-1704.868) (-1703.759) * [-1698.519] (-1698.470) (-1693.859) (-1700.380) -- 0:02:28
409500 -- (-1691.858) (-1704.357) [-1695.163] (-1696.299) * (-1692.164) (-1698.528) [-1700.204] (-1696.351) -- 0:02:28
410000 -- (-1698.788) [-1694.883] (-1702.385) (-1692.919) * (-1696.902) [-1698.199] (-1697.727) (-1692.387) -- 0:02:28
Average standard deviation of split frequencies: 0.006313
410500 -- [-1697.108] (-1697.409) (-1703.196) (-1705.068) * (-1697.933) [-1697.328] (-1701.900) (-1698.705) -- 0:02:27
411000 -- (-1695.925) [-1694.504] (-1703.555) (-1702.261) * (-1700.537) (-1702.670) (-1699.221) [-1693.243] -- 0:02:29
411500 -- (-1696.548) (-1696.333) [-1701.237] (-1705.682) * (-1701.002) (-1700.443) (-1692.909) [-1699.249] -- 0:02:28
412000 -- (-1698.456) [-1697.302] (-1698.873) (-1699.493) * (-1695.095) (-1701.086) (-1696.558) [-1691.608] -- 0:02:28
412500 -- (-1694.461) [-1696.068] (-1704.186) (-1699.306) * [-1691.222] (-1692.316) (-1701.148) (-1707.455) -- 0:02:28
413000 -- [-1695.965] (-1700.529) (-1697.936) (-1700.519) * (-1699.351) [-1695.398] (-1701.841) (-1703.497) -- 0:02:27
413500 -- (-1703.772) (-1694.192) [-1697.935] (-1699.087) * (-1694.393) (-1693.007) [-1700.388] (-1696.130) -- 0:02:27
414000 -- [-1696.618] (-1700.733) (-1702.293) (-1697.443) * (-1692.003) (-1696.761) (-1700.006) [-1698.791] -- 0:02:27
414500 -- (-1695.293) (-1698.500) (-1699.749) [-1693.428] * [-1694.286] (-1697.154) (-1699.410) (-1697.765) -- 0:02:26
415000 -- (-1696.900) (-1702.340) [-1706.767] (-1695.644) * (-1700.307) (-1696.329) [-1700.450] (-1707.367) -- 0:02:28
Average standard deviation of split frequencies: 0.004816
415500 -- (-1692.603) (-1702.662) (-1705.170) [-1696.029] * (-1694.190) [-1696.353] (-1694.860) (-1695.993) -- 0:02:27
416000 -- (-1693.090) [-1691.469] (-1708.195) (-1696.245) * (-1693.969) [-1693.390] (-1698.878) (-1698.481) -- 0:02:27
416500 -- [-1693.348] (-1700.765) (-1703.449) (-1703.042) * (-1694.836) [-1692.940] (-1696.253) (-1694.103) -- 0:02:27
417000 -- (-1699.566) (-1695.033) (-1702.725) [-1703.694] * (-1699.525) (-1700.660) (-1693.502) [-1694.487] -- 0:02:26
417500 -- (-1697.838) (-1699.233) (-1702.371) [-1695.346] * (-1694.841) (-1698.514) (-1700.524) [-1696.984] -- 0:02:26
418000 -- [-1694.060] (-1695.666) (-1696.581) (-1693.805) * (-1701.662) (-1694.272) (-1691.249) [-1691.547] -- 0:02:26
418500 -- (-1691.686) [-1698.851] (-1698.812) (-1692.530) * (-1696.951) (-1695.866) [-1695.756] (-1693.256) -- 0:02:25
419000 -- [-1695.313] (-1696.986) (-1697.987) (-1701.164) * (-1694.341) [-1691.892] (-1696.336) (-1699.329) -- 0:02:26
419500 -- (-1700.771) [-1698.354] (-1690.863) (-1695.912) * (-1697.741) [-1694.199] (-1704.108) (-1697.012) -- 0:02:26
420000 -- (-1698.618) (-1696.019) (-1694.650) [-1692.669] * [-1692.754] (-1700.645) (-1689.919) (-1701.632) -- 0:02:26
Average standard deviation of split frequencies: 0.005043
420500 -- (-1691.291) (-1693.690) (-1698.361) [-1694.880] * [-1694.066] (-1703.699) (-1697.309) (-1699.799) -- 0:02:26
421000 -- (-1694.797) (-1697.293) [-1694.208] (-1699.820) * (-1692.900) (-1705.134) (-1700.625) [-1694.311] -- 0:02:25
421500 -- (-1695.570) (-1691.101) [-1695.881] (-1701.423) * [-1694.633] (-1701.531) (-1701.835) (-1698.375) -- 0:02:25
422000 -- [-1689.394] (-1695.857) (-1699.611) (-1695.250) * [-1694.569] (-1689.955) (-1697.220) (-1697.789) -- 0:02:25
422500 -- (-1693.261) (-1705.602) [-1696.250] (-1699.072) * (-1694.570) (-1704.044) [-1701.187] (-1691.981) -- 0:02:24
423000 -- (-1710.636) (-1697.430) [-1695.673] (-1696.813) * (-1693.384) [-1695.848] (-1698.554) (-1699.036) -- 0:02:25
423500 -- (-1696.934) [-1700.340] (-1694.806) (-1700.954) * [-1691.957] (-1695.953) (-1698.691) (-1698.045) -- 0:02:25
424000 -- (-1694.675) [-1694.089] (-1692.180) (-1698.488) * [-1696.926] (-1691.026) (-1696.378) (-1706.167) -- 0:02:25
424500 -- (-1698.913) (-1694.443) [-1698.656] (-1692.403) * (-1696.348) [-1695.480] (-1697.723) (-1704.772) -- 0:02:25
425000 -- (-1695.952) (-1693.173) [-1698.615] (-1692.874) * (-1698.302) [-1692.739] (-1697.561) (-1694.003) -- 0:02:24
Average standard deviation of split frequencies: 0.006640
425500 -- [-1693.122] (-1695.368) (-1699.302) (-1693.185) * (-1698.319) (-1703.297) (-1699.701) [-1690.186] -- 0:02:24
426000 -- (-1695.539) [-1692.899] (-1699.709) (-1697.865) * [-1696.826] (-1702.351) (-1707.642) (-1695.154) -- 0:02:24
426500 -- (-1693.571) (-1696.573) [-1701.220] (-1696.083) * [-1698.869] (-1692.372) (-1707.260) (-1704.705) -- 0:02:23
427000 -- (-1694.728) (-1693.150) (-1698.491) [-1698.719] * (-1698.260) [-1695.366] (-1693.690) (-1698.438) -- 0:02:24
427500 -- (-1707.371) (-1697.569) (-1702.858) [-1696.124] * (-1697.450) (-1698.991) [-1704.642] (-1697.979) -- 0:02:24
428000 -- (-1702.262) [-1699.738] (-1701.646) (-1696.231) * (-1699.066) (-1706.487) [-1701.119] (-1703.890) -- 0:02:24
428500 -- (-1698.753) (-1699.871) [-1697.284] (-1696.596) * (-1700.336) [-1693.775] (-1694.901) (-1704.585) -- 0:02:24
429000 -- (-1693.214) (-1701.364) (-1699.197) [-1695.235] * (-1694.407) (-1691.861) (-1699.410) [-1696.302] -- 0:02:23
429500 -- [-1697.380] (-1700.880) (-1696.219) (-1703.430) * (-1700.565) [-1694.413] (-1695.255) (-1695.730) -- 0:02:23
430000 -- (-1698.745) (-1699.506) [-1696.816] (-1695.596) * (-1714.321) (-1703.623) (-1701.270) [-1695.918] -- 0:02:23
Average standard deviation of split frequencies: 0.005747
430500 -- (-1700.406) (-1701.439) (-1693.663) [-1702.801] * (-1696.993) (-1700.484) [-1697.499] (-1697.037) -- 0:02:22
431000 -- (-1695.153) (-1695.306) [-1689.656] (-1704.403) * (-1695.052) (-1696.760) (-1694.614) [-1696.507] -- 0:02:23
431500 -- (-1703.515) (-1699.738) (-1693.952) [-1690.355] * [-1695.362] (-1697.361) (-1695.099) (-1697.072) -- 0:02:23
432000 -- (-1703.228) (-1702.374) (-1692.014) [-1694.272] * (-1692.312) [-1700.948] (-1695.504) (-1698.341) -- 0:02:23
432500 -- (-1695.802) [-1704.497] (-1703.398) (-1699.027) * (-1696.150) (-1698.345) (-1700.641) [-1698.946] -- 0:02:23
433000 -- (-1691.747) (-1698.599) (-1700.586) [-1697.443] * (-1694.743) [-1693.644] (-1697.975) (-1702.620) -- 0:02:22
433500 -- [-1692.732] (-1694.250) (-1692.991) (-1701.584) * [-1699.296] (-1694.903) (-1701.920) (-1697.657) -- 0:02:22
434000 -- (-1694.246) [-1702.079] (-1699.027) (-1698.676) * [-1694.929] (-1691.270) (-1691.706) (-1695.973) -- 0:02:22
434500 -- (-1698.054) [-1696.111] (-1701.525) (-1696.007) * [-1697.021] (-1695.808) (-1703.292) (-1695.084) -- 0:02:21
435000 -- (-1697.243) (-1702.484) (-1697.755) [-1702.537] * (-1703.167) (-1697.296) (-1693.820) [-1692.752] -- 0:02:22
Average standard deviation of split frequencies: 0.008109
435500 -- (-1693.464) (-1706.420) [-1693.381] (-1697.170) * (-1694.850) [-1697.517] (-1696.771) (-1694.410) -- 0:02:22
436000 -- [-1694.815] (-1710.780) (-1697.243) (-1698.503) * (-1704.230) [-1695.094] (-1694.940) (-1694.053) -- 0:02:22
436500 -- (-1694.111) (-1699.786) [-1694.782] (-1697.695) * (-1698.362) (-1697.742) (-1696.321) [-1692.716] -- 0:02:22
437000 -- [-1694.027] (-1696.738) (-1691.946) (-1702.671) * [-1698.683] (-1702.668) (-1696.742) (-1692.214) -- 0:02:21
437500 -- (-1691.085) (-1703.016) (-1696.676) [-1691.797] * (-1701.678) [-1697.651] (-1702.213) (-1695.812) -- 0:02:21
438000 -- (-1694.916) (-1694.833) [-1699.426] (-1691.767) * [-1696.063] (-1695.896) (-1697.541) (-1699.297) -- 0:02:21
438500 -- (-1695.281) (-1691.891) (-1696.473) [-1694.531] * (-1700.532) (-1696.260) (-1703.063) [-1692.751] -- 0:02:20
439000 -- [-1692.797] (-1694.838) (-1692.573) (-1705.350) * (-1702.979) [-1695.249] (-1698.555) (-1693.811) -- 0:02:21
439500 -- [-1698.788] (-1694.340) (-1696.072) (-1698.537) * (-1699.829) [-1698.112] (-1700.631) (-1697.443) -- 0:02:21
440000 -- [-1695.067] (-1693.705) (-1699.127) (-1700.575) * (-1699.862) [-1700.969] (-1700.169) (-1702.259) -- 0:02:21
Average standard deviation of split frequencies: 0.008558
440500 -- [-1699.483] (-1692.974) (-1699.785) (-1696.822) * (-1697.048) (-1700.907) [-1695.328] (-1701.844) -- 0:02:20
441000 -- [-1696.791] (-1700.252) (-1697.886) (-1698.809) * (-1695.196) (-1693.898) (-1699.249) [-1692.818] -- 0:02:20
441500 -- [-1693.674] (-1691.427) (-1700.237) (-1695.024) * [-1701.183] (-1690.171) (-1712.514) (-1699.691) -- 0:02:20
442000 -- [-1696.248] (-1692.960) (-1702.447) (-1700.597) * (-1701.730) [-1694.278] (-1699.140) (-1699.432) -- 0:02:20
442500 -- (-1693.982) (-1699.893) (-1694.241) [-1698.010] * (-1699.644) [-1693.108] (-1695.002) (-1692.977) -- 0:02:19
443000 -- (-1694.995) (-1701.197) [-1696.558] (-1698.519) * (-1698.649) (-1697.176) [-1697.820] (-1692.617) -- 0:02:20
443500 -- [-1693.390] (-1702.684) (-1707.352) (-1695.392) * [-1692.515] (-1696.536) (-1694.815) (-1702.360) -- 0:02:20
444000 -- (-1696.647) (-1698.465) [-1697.196] (-1699.799) * (-1705.544) (-1693.575) (-1697.019) [-1701.170] -- 0:02:20
444500 -- [-1697.319] (-1711.576) (-1692.850) (-1698.476) * (-1697.352) (-1703.244) [-1698.849] (-1702.315) -- 0:02:19
445000 -- (-1697.040) [-1702.169] (-1693.744) (-1699.169) * (-1695.998) [-1694.317] (-1692.464) (-1707.929) -- 0:02:19
Average standard deviation of split frequencies: 0.006606
445500 -- (-1702.412) (-1704.733) (-1696.068) [-1698.066] * (-1692.949) (-1692.497) (-1698.022) [-1695.437] -- 0:02:19
446000 -- (-1695.433) (-1694.313) [-1699.955] (-1698.023) * [-1700.603] (-1693.183) (-1695.668) (-1703.989) -- 0:02:19
446500 -- (-1696.921) [-1692.551] (-1699.797) (-1697.625) * (-1699.812) (-1694.663) [-1694.685] (-1693.154) -- 0:02:18
447000 -- (-1695.255) [-1699.464] (-1709.157) (-1699.335) * (-1707.442) (-1692.953) (-1697.659) [-1699.628] -- 0:02:19
447500 -- (-1696.987) (-1697.743) (-1705.870) [-1691.338] * (-1701.890) [-1703.021] (-1696.542) (-1701.901) -- 0:02:19
448000 -- (-1699.733) (-1696.401) (-1698.293) [-1693.074] * [-1696.870] (-1699.309) (-1697.378) (-1691.368) -- 0:02:19
448500 -- (-1696.678) (-1702.205) [-1694.275] (-1698.999) * [-1696.754] (-1692.868) (-1699.693) (-1704.426) -- 0:02:18
449000 -- (-1699.297) (-1694.562) (-1700.494) [-1691.896] * (-1699.223) [-1695.098] (-1700.657) (-1699.658) -- 0:02:18
449500 -- [-1698.945] (-1702.176) (-1699.239) (-1694.017) * [-1690.877] (-1695.723) (-1699.744) (-1696.599) -- 0:02:18
450000 -- (-1698.534) (-1700.369) [-1694.678] (-1700.076) * [-1697.585] (-1693.163) (-1695.064) (-1692.462) -- 0:02:18
Average standard deviation of split frequencies: 0.004707
450500 -- (-1697.208) (-1697.033) (-1692.044) [-1696.726] * (-1691.771) [-1695.180] (-1695.166) (-1704.428) -- 0:02:17
451000 -- (-1697.460) [-1697.870] (-1691.641) (-1697.758) * (-1699.639) (-1696.359) (-1693.912) [-1695.011] -- 0:02:18
451500 -- (-1697.102) (-1701.178) (-1694.990) [-1690.670] * (-1698.097) [-1694.623] (-1692.300) (-1693.257) -- 0:02:18
452000 -- (-1705.998) (-1694.155) [-1695.049] (-1702.933) * [-1700.320] (-1693.867) (-1701.094) (-1696.258) -- 0:02:18
452500 -- (-1709.559) (-1694.013) (-1696.492) [-1698.921] * [-1698.640] (-1699.996) (-1696.189) (-1698.600) -- 0:02:17
453000 -- [-1694.273] (-1704.472) (-1692.711) (-1699.115) * (-1703.083) (-1693.242) [-1704.295] (-1699.412) -- 0:02:17
453500 -- (-1692.914) (-1703.900) (-1707.592) [-1701.819] * (-1697.749) (-1694.025) (-1694.893) [-1695.639] -- 0:02:17
454000 -- [-1696.358] (-1709.952) (-1701.235) (-1702.119) * (-1694.674) [-1689.721] (-1697.565) (-1694.301) -- 0:02:17
454500 -- (-1697.188) [-1693.810] (-1697.359) (-1706.838) * [-1697.357] (-1694.530) (-1695.158) (-1698.672) -- 0:02:16
455000 -- [-1692.883] (-1699.562) (-1698.811) (-1695.359) * (-1701.918) [-1698.244] (-1706.132) (-1701.553) -- 0:02:17
Average standard deviation of split frequencies: 0.005427
455500 -- (-1699.323) (-1699.738) [-1700.306] (-1694.387) * [-1689.381] (-1694.925) (-1706.402) (-1707.019) -- 0:02:17
456000 -- (-1701.065) (-1704.913) (-1698.050) [-1695.214] * (-1697.669) (-1701.140) (-1698.964) [-1700.309] -- 0:02:17
456500 -- (-1706.366) (-1695.171) (-1694.507) [-1695.111] * (-1695.998) (-1698.690) [-1702.290] (-1698.721) -- 0:02:16
457000 -- (-1696.390) (-1693.110) [-1695.586] (-1699.350) * (-1702.217) [-1702.199] (-1700.824) (-1699.331) -- 0:02:16
457500 -- [-1694.432] (-1703.633) (-1694.689) (-1703.962) * (-1703.540) (-1702.547) [-1699.690] (-1695.934) -- 0:02:16
458000 -- (-1698.359) (-1698.222) (-1698.814) [-1695.110] * (-1691.358) [-1695.607] (-1699.647) (-1696.927) -- 0:02:16
458500 -- (-1698.245) (-1696.753) [-1703.573] (-1696.628) * (-1693.251) (-1690.902) (-1696.100) [-1698.000] -- 0:02:15
459000 -- [-1695.757] (-1695.907) (-1703.196) (-1696.109) * [-1691.040] (-1690.694) (-1700.340) (-1698.304) -- 0:02:16
459500 -- (-1695.317) (-1694.171) [-1700.817] (-1695.024) * (-1693.769) [-1692.175] (-1696.792) (-1695.567) -- 0:02:16
460000 -- (-1697.529) [-1700.940] (-1709.711) (-1694.774) * [-1700.499] (-1699.476) (-1701.945) (-1694.540) -- 0:02:16
Average standard deviation of split frequencies: 0.005117
460500 -- (-1697.261) [-1693.595] (-1700.621) (-1697.246) * [-1698.220] (-1696.146) (-1700.012) (-1698.113) -- 0:02:15
461000 -- (-1696.621) [-1698.023] (-1699.938) (-1695.138) * (-1706.651) (-1701.734) (-1694.404) [-1696.789] -- 0:02:15
461500 -- (-1706.647) (-1701.290) [-1698.368] (-1697.575) * (-1711.045) [-1697.943] (-1701.351) (-1699.379) -- 0:02:15
462000 -- [-1701.733] (-1696.468) (-1694.539) (-1695.543) * (-1701.954) (-1700.467) [-1696.521] (-1711.404) -- 0:02:15
462500 -- [-1696.964] (-1697.499) (-1694.833) (-1701.226) * (-1703.349) (-1705.705) [-1691.630] (-1701.681) -- 0:02:14
463000 -- (-1695.426) (-1700.918) [-1699.296] (-1696.163) * [-1694.964] (-1705.042) (-1703.351) (-1701.245) -- 0:02:15
463500 -- (-1700.368) (-1697.422) [-1700.208] (-1693.145) * (-1698.309) (-1695.122) (-1697.864) [-1693.238] -- 0:02:15
464000 -- (-1704.225) [-1695.937] (-1697.842) (-1698.436) * (-1696.132) [-1697.493] (-1696.380) (-1695.197) -- 0:02:15
464500 -- (-1700.712) [-1696.737] (-1701.614) (-1699.504) * (-1695.638) (-1703.571) (-1698.415) [-1697.499] -- 0:02:14
465000 -- (-1695.958) (-1702.341) [-1700.358] (-1698.531) * [-1698.349] (-1694.637) (-1697.573) (-1696.743) -- 0:02:14
Average standard deviation of split frequencies: 0.006070
465500 -- (-1695.107) [-1693.715] (-1701.427) (-1699.047) * (-1690.578) (-1697.574) [-1693.704] (-1697.399) -- 0:02:14
466000 -- (-1701.470) (-1695.865) (-1696.911) [-1694.134] * [-1696.958] (-1696.868) (-1697.632) (-1695.711) -- 0:02:14
466500 -- (-1695.398) [-1692.426] (-1699.370) (-1695.584) * (-1693.245) (-1696.090) (-1698.721) [-1699.224] -- 0:02:13
467000 -- (-1701.642) (-1699.623) (-1701.187) [-1695.037] * (-1696.827) (-1694.424) [-1693.156] (-1702.909) -- 0:02:14
467500 -- [-1698.301] (-1694.277) (-1703.861) (-1707.051) * [-1692.026] (-1693.867) (-1700.200) (-1706.240) -- 0:02:14
468000 -- [-1700.024] (-1699.542) (-1699.814) (-1697.861) * (-1696.891) (-1699.796) [-1698.420] (-1696.851) -- 0:02:14
468500 -- [-1699.354] (-1702.279) (-1698.387) (-1693.039) * (-1694.336) (-1697.496) (-1692.421) [-1693.988] -- 0:02:13
469000 -- (-1695.141) (-1699.419) [-1690.890] (-1696.613) * (-1694.784) [-1694.217] (-1691.743) (-1694.016) -- 0:02:13
469500 -- [-1696.175] (-1693.459) (-1693.966) (-1695.479) * (-1695.236) (-1693.287) (-1694.004) [-1692.977] -- 0:02:13
470000 -- (-1698.664) (-1705.438) (-1701.305) [-1695.162] * (-1697.422) (-1697.023) (-1694.572) [-1692.708] -- 0:02:13
Average standard deviation of split frequencies: 0.007512
470500 -- (-1694.400) (-1699.510) [-1695.307] (-1693.727) * (-1694.933) (-1698.311) [-1695.474] (-1694.779) -- 0:02:12
471000 -- (-1697.442) [-1698.169] (-1706.241) (-1696.795) * (-1699.372) (-1694.333) [-1700.804] (-1694.450) -- 0:02:13
471500 -- (-1694.634) (-1700.455) [-1695.825] (-1702.427) * (-1705.403) (-1702.780) [-1697.245] (-1698.549) -- 0:02:13
472000 -- [-1694.409] (-1701.040) (-1689.946) (-1698.186) * (-1698.262) [-1694.261] (-1693.245) (-1700.099) -- 0:02:13
472500 -- (-1698.093) (-1699.016) [-1698.363] (-1694.792) * (-1706.058) [-1697.738] (-1700.627) (-1694.883) -- 0:02:12
473000 -- (-1694.710) (-1697.750) (-1692.159) [-1697.550] * (-1697.139) [-1694.010] (-1696.843) (-1702.314) -- 0:02:12
473500 -- (-1702.589) [-1700.024] (-1698.039) (-1694.873) * (-1697.709) [-1694.291] (-1699.839) (-1694.935) -- 0:02:12
474000 -- [-1704.950] (-1704.652) (-1692.953) (-1700.384) * [-1694.694] (-1696.001) (-1699.221) (-1702.851) -- 0:02:12
474500 -- [-1699.004] (-1704.825) (-1696.528) (-1696.973) * [-1690.982] (-1693.946) (-1699.821) (-1695.796) -- 0:02:12
475000 -- (-1702.538) (-1696.525) [-1699.217] (-1704.700) * [-1696.178] (-1696.074) (-1704.240) (-1699.211) -- 0:02:12
Average standard deviation of split frequencies: 0.006437
475500 -- (-1698.303) (-1696.272) (-1702.247) [-1695.996] * [-1695.361] (-1694.721) (-1709.996) (-1698.490) -- 0:02:12
476000 -- (-1699.019) (-1698.213) (-1700.070) [-1706.614] * [-1697.125] (-1696.396) (-1696.560) (-1692.163) -- 0:02:12
476500 -- (-1695.079) [-1700.677] (-1701.077) (-1698.321) * (-1698.356) [-1698.401] (-1697.814) (-1698.756) -- 0:02:11
477000 -- (-1693.436) [-1690.829] (-1692.434) (-1700.137) * [-1704.363] (-1690.071) (-1694.627) (-1698.169) -- 0:02:11
477500 -- (-1702.076) (-1698.794) [-1691.419] (-1697.947) * (-1698.539) [-1695.468] (-1692.445) (-1699.851) -- 0:02:11
478000 -- [-1692.002] (-1694.147) (-1698.232) (-1703.118) * (-1698.621) (-1699.954) (-1697.690) [-1697.572] -- 0:02:11
478500 -- (-1696.407) [-1695.237] (-1698.835) (-1699.078) * [-1694.667] (-1696.082) (-1698.350) (-1699.307) -- 0:02:11
479000 -- (-1699.780) [-1694.803] (-1698.079) (-1696.827) * [-1696.630] (-1695.522) (-1701.966) (-1697.701) -- 0:02:11
479500 -- (-1697.721) [-1694.166] (-1697.890) (-1699.090) * (-1696.261) (-1702.744) [-1697.405] (-1696.602) -- 0:02:11
480000 -- (-1697.637) (-1694.795) [-1692.958] (-1703.484) * [-1694.669] (-1696.108) (-1696.239) (-1699.440) -- 0:02:11
Average standard deviation of split frequencies: 0.004168
480500 -- (-1694.201) (-1694.865) [-1694.147] (-1697.093) * (-1691.874) [-1697.665] (-1695.570) (-1696.247) -- 0:02:10
481000 -- (-1694.243) (-1696.124) [-1694.195] (-1698.673) * (-1702.093) (-1703.623) (-1696.900) [-1700.576] -- 0:02:10
481500 -- [-1691.282] (-1697.338) (-1695.891) (-1697.922) * [-1702.102] (-1698.232) (-1697.349) (-1702.744) -- 0:02:10
482000 -- (-1692.179) [-1695.685] (-1698.409) (-1700.521) * [-1698.966] (-1698.927) (-1702.204) (-1698.478) -- 0:02:10
482500 -- [-1691.668] (-1691.044) (-1691.643) (-1696.078) * (-1697.915) (-1703.732) (-1695.497) [-1698.972] -- 0:02:10
483000 -- (-1698.397) (-1697.799) (-1696.718) [-1698.803] * (-1703.667) [-1699.880] (-1698.097) (-1700.357) -- 0:02:10
483500 -- (-1696.269) (-1694.697) (-1699.902) [-1698.422] * [-1690.397] (-1698.286) (-1697.734) (-1701.580) -- 0:02:10
484000 -- [-1694.321] (-1698.650) (-1696.254) (-1698.490) * [-1695.163] (-1698.199) (-1705.323) (-1700.495) -- 0:02:10
484500 -- (-1696.372) (-1696.134) [-1698.906] (-1699.484) * [-1696.984] (-1693.888) (-1695.245) (-1708.106) -- 0:02:09
485000 -- (-1694.923) (-1697.853) [-1697.450] (-1701.461) * (-1706.010) (-1690.279) (-1696.581) [-1702.090] -- 0:02:09
Average standard deviation of split frequencies: 0.003880
485500 -- (-1697.712) [-1695.442] (-1695.604) (-1702.495) * (-1698.188) (-1691.300) [-1694.242] (-1697.274) -- 0:02:09
486000 -- (-1692.752) [-1693.155] (-1695.093) (-1716.471) * [-1696.401] (-1693.265) (-1691.136) (-1706.448) -- 0:02:09
486500 -- (-1696.317) (-1694.883) [-1697.955] (-1714.469) * [-1694.094] (-1699.163) (-1707.712) (-1697.165) -- 0:02:09
487000 -- [-1692.657] (-1699.285) (-1699.303) (-1710.654) * (-1694.984) (-1693.631) [-1693.160] (-1697.493) -- 0:02:09
487500 -- (-1693.382) [-1698.468] (-1697.659) (-1703.867) * (-1691.944) [-1692.716] (-1698.165) (-1709.827) -- 0:02:09
488000 -- (-1697.432) (-1700.011) (-1700.733) [-1701.380] * (-1693.498) (-1692.497) (-1696.599) [-1696.341] -- 0:02:09
488500 -- (-1701.678) [-1690.795] (-1703.893) (-1702.718) * (-1699.432) (-1696.423) [-1692.979] (-1697.389) -- 0:02:08
489000 -- (-1705.261) (-1700.693) [-1701.320] (-1701.260) * (-1699.722) (-1692.878) [-1695.384] (-1696.148) -- 0:02:08
489500 -- (-1694.603) [-1695.520] (-1699.472) (-1701.014) * (-1697.198) (-1690.646) (-1699.291) [-1695.191] -- 0:02:08
490000 -- (-1703.770) (-1696.457) [-1698.451] (-1701.476) * [-1694.880] (-1692.223) (-1700.802) (-1693.308) -- 0:02:08
Average standard deviation of split frequencies: 0.002642
490500 -- [-1695.231] (-1697.692) (-1694.005) (-1702.852) * (-1703.270) (-1702.994) (-1694.344) [-1692.587] -- 0:02:08
491000 -- (-1695.156) (-1696.485) [-1693.411] (-1699.646) * (-1694.564) [-1693.641] (-1700.508) (-1693.713) -- 0:02:08
491500 -- [-1697.363] (-1701.809) (-1704.234) (-1698.392) * (-1699.512) (-1700.991) [-1693.433] (-1696.460) -- 0:02:08
492000 -- [-1699.766] (-1700.823) (-1693.697) (-1706.230) * [-1702.722] (-1701.811) (-1697.909) (-1700.493) -- 0:02:08
492500 -- (-1707.030) [-1697.219] (-1698.993) (-1698.884) * [-1691.852] (-1698.072) (-1699.220) (-1689.350) -- 0:02:07
493000 -- [-1692.988] (-1703.274) (-1697.835) (-1694.678) * (-1692.323) [-1695.638] (-1691.649) (-1701.969) -- 0:02:07
493500 -- [-1694.551] (-1706.174) (-1694.960) (-1695.262) * (-1693.879) (-1691.936) (-1696.964) [-1695.936] -- 0:02:07
494000 -- (-1696.105) (-1709.776) (-1698.414) [-1696.602] * (-1697.678) (-1696.652) [-1695.284] (-1702.594) -- 0:02:07
494500 -- (-1696.371) (-1706.037) (-1696.222) [-1698.709] * (-1699.921) (-1700.182) [-1696.736] (-1697.318) -- 0:02:07
495000 -- (-1694.218) [-1697.190] (-1698.664) (-1696.322) * (-1694.099) (-1694.957) (-1700.088) [-1692.701] -- 0:02:07
Average standard deviation of split frequencies: 0.002138
495500 -- (-1698.318) (-1703.919) (-1693.848) [-1700.616] * (-1693.058) [-1695.336] (-1695.863) (-1699.832) -- 0:02:07
496000 -- [-1698.258] (-1696.766) (-1694.086) (-1698.957) * (-1696.481) [-1704.487] (-1699.692) (-1698.398) -- 0:02:07
496500 -- (-1700.498) (-1698.448) [-1696.968] (-1698.543) * (-1705.335) [-1700.246] (-1708.607) (-1696.345) -- 0:02:06
497000 -- (-1703.128) (-1703.306) (-1694.076) [-1695.662] * [-1692.873] (-1691.059) (-1697.023) (-1695.723) -- 0:02:06
497500 -- [-1690.236] (-1697.425) (-1695.974) (-1695.109) * (-1701.097) (-1694.079) [-1695.184] (-1697.507) -- 0:02:06
498000 -- (-1694.158) (-1700.345) (-1694.202) [-1701.429] * [-1699.899] (-1702.039) (-1692.129) (-1696.315) -- 0:02:06
498500 -- [-1691.956] (-1699.757) (-1693.565) (-1701.493) * [-1695.073] (-1695.942) (-1699.768) (-1702.196) -- 0:02:06
499000 -- (-1695.674) (-1693.246) (-1694.056) [-1692.343] * (-1695.580) [-1695.611] (-1693.302) (-1702.950) -- 0:02:06
499500 -- (-1699.385) (-1694.337) (-1695.212) [-1696.811] * (-1697.208) (-1698.042) (-1698.117) [-1698.357] -- 0:02:06
500000 -- (-1700.387) (-1701.873) [-1692.650] (-1694.956) * [-1703.521] (-1694.063) (-1698.860) (-1699.908) -- 0:02:06
Average standard deviation of split frequencies: 0.002354
500500 -- (-1710.125) [-1691.604] (-1700.263) (-1695.934) * [-1698.891] (-1693.984) (-1696.402) (-1693.711) -- 0:02:05
501000 -- (-1701.030) (-1700.755) (-1693.773) [-1692.163] * [-1697.013] (-1698.427) (-1692.568) (-1701.099) -- 0:02:05
501500 -- (-1706.326) [-1692.090] (-1703.501) (-1700.867) * [-1697.512] (-1697.222) (-1694.310) (-1691.613) -- 0:02:05
502000 -- [-1697.610] (-1708.149) (-1697.608) (-1702.384) * (-1699.715) (-1694.481) [-1696.580] (-1696.932) -- 0:02:04
502500 -- (-1697.269) (-1703.490) [-1698.406] (-1700.650) * (-1692.417) [-1696.312] (-1694.951) (-1706.111) -- 0:02:05
503000 -- (-1700.823) (-1696.438) [-1697.483] (-1702.506) * (-1693.633) [-1693.971] (-1706.784) (-1699.173) -- 0:02:05
503500 -- (-1706.818) [-1692.234] (-1693.385) (-1699.428) * [-1694.944] (-1700.692) (-1694.517) (-1696.184) -- 0:02:05
504000 -- (-1698.508) (-1695.545) (-1698.390) [-1696.681] * (-1698.727) (-1697.619) (-1699.978) [-1698.784] -- 0:02:04
504500 -- (-1694.753) [-1691.594] (-1698.694) (-1691.488) * [-1696.573] (-1697.293) (-1695.396) (-1696.841) -- 0:02:04
505000 -- (-1697.979) (-1700.568) (-1699.896) [-1693.251] * (-1696.791) (-1701.360) [-1701.897] (-1701.407) -- 0:02:04
Average standard deviation of split frequencies: 0.002096
505500 -- [-1695.405] (-1703.133) (-1700.218) (-1693.014) * (-1701.230) (-1699.814) (-1700.245) [-1693.170] -- 0:02:04
506000 -- (-1697.925) (-1695.480) (-1695.281) [-1688.580] * (-1694.880) (-1695.589) [-1694.853] (-1700.230) -- 0:02:03
506500 -- (-1694.161) [-1702.296] (-1696.155) (-1697.472) * (-1698.604) (-1696.322) [-1694.146] (-1700.052) -- 0:02:04
507000 -- [-1697.472] (-1701.676) (-1695.868) (-1703.253) * (-1700.834) [-1695.732] (-1698.531) (-1704.396) -- 0:02:04
507500 -- (-1694.467) (-1697.890) (-1698.603) [-1692.428] * (-1704.047) [-1693.914] (-1695.620) (-1696.077) -- 0:02:04
508000 -- (-1698.892) (-1698.816) [-1695.603] (-1704.995) * (-1702.662) (-1700.585) [-1694.277] (-1703.964) -- 0:02:03
508500 -- (-1699.509) (-1695.130) (-1700.542) [-1699.745] * (-1701.189) [-1696.411] (-1694.168) (-1702.259) -- 0:02:03
509000 -- (-1700.659) (-1694.626) [-1695.015] (-1692.872) * (-1704.694) (-1701.434) [-1693.092] (-1701.757) -- 0:02:03
509500 -- (-1701.929) (-1697.360) (-1703.120) [-1695.274] * (-1692.530) [-1693.023] (-1694.554) (-1705.607) -- 0:02:03
510000 -- (-1697.229) [-1696.052] (-1697.656) (-1695.630) * (-1704.331) (-1694.324) (-1694.609) [-1694.549] -- 0:02:02
Average standard deviation of split frequencies: 0.002308
510500 -- [-1699.668] (-1692.802) (-1701.095) (-1695.177) * (-1695.975) (-1698.620) (-1697.478) [-1691.379] -- 0:02:03
511000 -- (-1699.252) (-1695.160) [-1697.952] (-1696.215) * (-1701.471) [-1695.427] (-1699.416) (-1699.083) -- 0:02:03
511500 -- (-1700.111) (-1697.303) (-1695.462) [-1695.176] * (-1694.283) (-1696.266) (-1699.726) [-1695.461] -- 0:02:03
512000 -- (-1700.088) (-1703.798) (-1692.716) [-1690.972] * (-1698.766) [-1699.659] (-1699.818) (-1692.767) -- 0:02:02
512500 -- (-1701.741) (-1692.846) [-1699.941] (-1695.713) * (-1701.120) (-1696.315) (-1709.547) [-1694.056] -- 0:02:02
513000 -- (-1703.000) (-1698.937) (-1694.270) [-1694.204] * (-1695.989) (-1696.643) (-1695.030) [-1696.458] -- 0:02:02
513500 -- (-1696.807) (-1696.560) [-1689.499] (-1698.265) * (-1702.635) (-1690.571) (-1694.749) [-1699.124] -- 0:02:02
514000 -- (-1696.782) [-1696.169] (-1695.256) (-1699.195) * (-1702.716) (-1695.628) [-1702.077] (-1702.367) -- 0:02:01
514500 -- (-1700.303) (-1694.911) (-1703.068) [-1698.471] * (-1703.459) (-1700.259) [-1695.731] (-1697.871) -- 0:02:02
515000 -- (-1693.399) (-1697.676) (-1701.519) [-1699.320] * (-1699.895) (-1696.411) [-1691.479] (-1693.800) -- 0:02:02
Average standard deviation of split frequencies: 0.002284
515500 -- (-1697.446) (-1705.494) (-1698.393) [-1704.940] * (-1701.306) [-1693.249] (-1697.527) (-1692.227) -- 0:02:02
516000 -- [-1693.660] (-1699.327) (-1701.783) (-1693.951) * (-1701.866) (-1688.790) [-1699.253] (-1696.314) -- 0:02:01
516500 -- (-1699.769) (-1697.111) [-1696.207] (-1699.225) * (-1695.555) (-1695.458) (-1693.291) [-1691.566] -- 0:02:01
517000 -- [-1695.503] (-1693.202) (-1699.398) (-1700.073) * (-1700.915) (-1691.539) (-1698.103) [-1695.201] -- 0:02:01
517500 -- [-1695.850] (-1702.562) (-1703.415) (-1695.813) * (-1698.492) (-1702.781) [-1698.009] (-1695.002) -- 0:02:01
518000 -- [-1695.326] (-1695.557) (-1697.796) (-1697.884) * (-1702.331) [-1693.279] (-1697.908) (-1705.847) -- 0:02:00
518500 -- (-1702.115) (-1700.872) [-1698.919] (-1699.418) * (-1699.047) (-1696.117) (-1696.485) [-1693.875] -- 0:02:01
519000 -- (-1696.722) [-1698.224] (-1699.180) (-1697.837) * (-1694.665) [-1694.053] (-1694.125) (-1691.469) -- 0:02:01
519500 -- [-1697.968] (-1700.135) (-1702.196) (-1693.823) * (-1696.623) [-1698.139] (-1693.690) (-1691.982) -- 0:02:01
520000 -- [-1699.639] (-1693.188) (-1700.154) (-1699.625) * (-1698.210) (-1694.981) (-1693.423) [-1695.559] -- 0:02:00
Average standard deviation of split frequencies: 0.002490
520500 -- (-1696.222) [-1694.601] (-1699.035) (-1694.679) * (-1690.070) (-1701.346) (-1695.132) [-1698.322] -- 0:02:00
521000 -- (-1694.045) (-1698.775) (-1695.369) [-1690.790] * (-1693.139) (-1696.322) (-1701.015) [-1693.693] -- 0:02:00
521500 -- (-1702.849) [-1699.688] (-1700.714) (-1692.920) * [-1700.520] (-1702.229) (-1694.920) (-1698.966) -- 0:02:00
522000 -- [-1699.179] (-1695.143) (-1695.025) (-1691.877) * (-1703.725) (-1704.684) [-1695.005] (-1696.271) -- 0:01:59
522500 -- [-1694.070] (-1695.187) (-1702.594) (-1701.351) * (-1695.176) (-1696.042) [-1690.594] (-1699.688) -- 0:02:00
523000 -- (-1695.323) [-1694.816] (-1695.754) (-1697.622) * (-1703.799) [-1699.277] (-1694.453) (-1696.887) -- 0:02:00
523500 -- (-1691.193) (-1698.421) (-1696.487) [-1695.187] * (-1695.321) [-1701.898] (-1698.220) (-1704.321) -- 0:02:00
524000 -- (-1694.118) [-1700.942] (-1699.860) (-1691.801) * (-1694.940) (-1697.001) [-1697.278] (-1699.301) -- 0:01:59
524500 -- (-1706.349) (-1696.624) (-1695.743) [-1695.989] * [-1701.275] (-1700.849) (-1695.097) (-1701.226) -- 0:01:59
525000 -- (-1697.279) (-1696.933) [-1702.138] (-1695.278) * (-1694.336) (-1701.481) [-1695.207] (-1700.030) -- 0:01:59
Average standard deviation of split frequencies: 0.004033
525500 -- [-1693.185] (-1695.939) (-1705.093) (-1704.268) * (-1694.697) (-1703.058) [-1695.898] (-1695.820) -- 0:01:59
526000 -- (-1696.892) (-1695.503) (-1698.398) [-1696.405] * (-1705.368) (-1693.726) [-1695.708] (-1693.017) -- 0:01:59
526500 -- [-1701.123] (-1694.804) (-1693.360) (-1694.300) * (-1697.251) [-1696.852] (-1692.025) (-1694.669) -- 0:01:59
527000 -- (-1700.404) (-1694.109) (-1697.788) [-1701.969] * (-1697.721) [-1697.436] (-1693.511) (-1690.600) -- 0:01:59
527500 -- (-1694.483) (-1690.224) [-1697.256] (-1692.949) * (-1693.826) [-1696.065] (-1695.425) (-1693.665) -- 0:01:59
528000 -- (-1699.368) (-1690.747) (-1699.369) [-1698.010] * (-1705.187) (-1702.770) (-1690.803) [-1696.389] -- 0:01:58
528500 -- [-1695.681] (-1699.958) (-1694.818) (-1700.047) * (-1701.048) (-1700.931) (-1695.594) [-1696.556] -- 0:01:58
529000 -- [-1697.643] (-1699.163) (-1697.989) (-1702.277) * (-1696.867) [-1696.057] (-1699.060) (-1693.677) -- 0:01:58
529500 -- (-1695.989) (-1695.301) (-1702.244) [-1696.560] * (-1696.528) (-1694.231) [-1692.783] (-1693.664) -- 0:01:58
530000 -- (-1697.670) (-1701.009) [-1699.467] (-1700.973) * (-1698.831) (-1694.243) [-1689.926] (-1690.727) -- 0:01:58
Average standard deviation of split frequencies: 0.004664
530500 -- (-1701.663) (-1695.700) (-1695.806) [-1693.890] * (-1704.819) (-1696.055) (-1695.477) [-1694.321] -- 0:01:58
531000 -- (-1696.424) [-1693.089] (-1701.917) (-1700.867) * (-1700.419) [-1702.380] (-1699.755) (-1698.058) -- 0:01:58
531500 -- (-1695.194) (-1694.393) (-1705.267) [-1695.840] * (-1705.679) (-1701.665) [-1696.389] (-1696.015) -- 0:01:58
532000 -- (-1704.916) (-1691.677) (-1691.924) [-1694.844] * (-1696.525) [-1699.045] (-1696.052) (-1698.727) -- 0:01:57
532500 -- (-1707.878) (-1702.357) [-1697.148] (-1700.680) * [-1692.515] (-1697.043) (-1698.010) (-1699.808) -- 0:01:57
533000 -- (-1700.452) (-1699.973) [-1701.469] (-1697.762) * (-1695.545) (-1697.282) [-1691.061] (-1700.600) -- 0:01:57
533500 -- (-1701.923) (-1700.485) (-1697.457) [-1696.742] * (-1705.886) (-1694.886) (-1698.770) [-1696.759] -- 0:01:57
534000 -- (-1705.208) [-1695.162] (-1698.136) (-1704.524) * (-1702.342) (-1701.706) (-1704.363) [-1698.859] -- 0:01:57
534500 -- [-1691.437] (-1701.787) (-1694.701) (-1704.171) * [-1693.794] (-1690.361) (-1698.557) (-1697.796) -- 0:01:57
535000 -- (-1695.997) [-1700.512] (-1705.204) (-1698.675) * (-1698.133) (-1697.617) [-1692.593] (-1711.349) -- 0:01:57
Average standard deviation of split frequencies: 0.004178
535500 -- (-1692.725) (-1693.842) (-1699.827) [-1693.559] * (-1697.519) [-1698.136] (-1697.261) (-1697.653) -- 0:01:57
536000 -- (-1695.033) (-1693.015) (-1699.554) [-1693.851] * (-1696.809) [-1695.610] (-1702.929) (-1689.427) -- 0:01:56
536500 -- (-1695.667) [-1697.966] (-1696.434) (-1702.880) * [-1696.485] (-1693.969) (-1697.637) (-1696.486) -- 0:01:56
537000 -- (-1695.280) (-1692.644) (-1692.873) [-1695.221] * (-1697.068) [-1694.913] (-1701.011) (-1694.320) -- 0:01:56
537500 -- [-1700.188] (-1696.182) (-1697.248) (-1705.824) * [-1694.085] (-1688.741) (-1712.759) (-1700.991) -- 0:01:56
538000 -- (-1696.101) (-1693.489) [-1698.702] (-1701.646) * [-1699.114] (-1695.789) (-1700.477) (-1700.492) -- 0:01:56
538500 -- (-1701.243) [-1689.571] (-1703.113) (-1696.746) * (-1697.723) [-1692.480] (-1697.124) (-1699.940) -- 0:01:56
539000 -- (-1692.675) (-1692.844) (-1692.125) [-1698.525] * (-1696.482) (-1706.432) [-1693.668] (-1699.324) -- 0:01:56
539500 -- (-1699.278) (-1697.963) [-1695.842] (-1694.619) * (-1696.744) (-1698.579) (-1695.552) [-1692.902] -- 0:01:56
540000 -- (-1694.823) [-1694.983] (-1702.293) (-1699.478) * [-1691.067] (-1700.251) (-1697.429) (-1695.062) -- 0:01:55
Average standard deviation of split frequencies: 0.003488
540500 -- [-1695.051] (-1693.787) (-1697.715) (-1694.022) * [-1693.013] (-1698.893) (-1696.390) (-1700.747) -- 0:01:55
541000 -- (-1695.433) (-1694.625) [-1695.514] (-1701.163) * [-1694.204] (-1700.950) (-1692.868) (-1702.269) -- 0:01:55
541500 -- (-1693.820) (-1693.624) (-1699.804) [-1695.459] * [-1694.191] (-1699.794) (-1696.288) (-1698.821) -- 0:01:55
542000 -- [-1694.698] (-1697.481) (-1702.844) (-1697.450) * (-1698.385) [-1700.503] (-1701.791) (-1699.699) -- 0:01:55
542500 -- (-1694.345) [-1690.921] (-1697.792) (-1698.155) * (-1698.287) (-1704.459) [-1696.669] (-1701.232) -- 0:01:55
543000 -- (-1693.322) (-1701.110) [-1697.170] (-1692.771) * (-1692.779) (-1701.486) [-1697.204] (-1700.281) -- 0:01:55
543500 -- (-1701.760) (-1699.104) [-1697.398] (-1697.054) * (-1695.197) [-1696.109] (-1705.883) (-1700.147) -- 0:01:55
544000 -- [-1696.410] (-1694.843) (-1698.594) (-1697.430) * (-1697.462) (-1692.321) (-1695.554) [-1695.728] -- 0:01:54
544500 -- [-1694.173] (-1703.236) (-1701.494) (-1696.510) * (-1693.296) [-1691.300] (-1692.435) (-1695.510) -- 0:01:54
545000 -- (-1696.035) (-1702.654) (-1701.135) [-1703.864] * (-1693.495) (-1696.616) [-1698.919] (-1697.689) -- 0:01:54
Average standard deviation of split frequencies: 0.004533
545500 -- (-1705.753) (-1696.628) (-1700.244) [-1699.720] * (-1701.112) (-1696.417) [-1702.067] (-1697.988) -- 0:01:54
546000 -- [-1698.209] (-1695.898) (-1698.435) (-1697.565) * (-1696.361) (-1695.169) [-1696.019] (-1701.061) -- 0:01:54
546500 -- (-1698.396) (-1703.624) [-1696.917] (-1698.819) * (-1696.653) (-1694.680) [-1699.646] (-1695.604) -- 0:01:54
547000 -- (-1703.195) (-1701.619) [-1695.394] (-1696.051) * (-1697.212) (-1694.951) (-1692.072) [-1693.382] -- 0:01:54
547500 -- (-1709.964) (-1697.720) (-1694.791) [-1697.446] * (-1699.081) [-1696.501] (-1693.537) (-1700.770) -- 0:01:54
548000 -- [-1697.427] (-1695.249) (-1696.357) (-1706.852) * (-1702.434) (-1699.920) [-1701.753] (-1699.736) -- 0:01:53
548500 -- (-1695.782) (-1707.366) (-1700.842) [-1701.509] * (-1698.684) [-1694.749] (-1699.879) (-1693.885) -- 0:01:53
549000 -- [-1692.395] (-1696.982) (-1697.930) (-1703.509) * (-1693.668) (-1694.616) (-1696.511) [-1698.057] -- 0:01:53
549500 -- (-1694.448) (-1697.473) [-1705.494] (-1695.189) * [-1700.891] (-1691.525) (-1701.822) (-1695.337) -- 0:01:53
550000 -- (-1701.152) (-1692.072) [-1695.628] (-1699.650) * (-1705.480) [-1694.828] (-1702.487) (-1695.349) -- 0:01:53
Average standard deviation of split frequencies: 0.005136
550500 -- (-1699.148) (-1701.827) [-1694.706] (-1699.148) * (-1695.739) (-1696.775) [-1690.711] (-1701.359) -- 0:01:53
551000 -- (-1698.800) [-1697.117] (-1696.296) (-1695.011) * (-1692.848) [-1693.506] (-1695.258) (-1694.419) -- 0:01:53
551500 -- (-1698.041) (-1698.132) [-1699.164] (-1699.965) * [-1694.864] (-1695.091) (-1700.999) (-1695.036) -- 0:01:53
552000 -- (-1695.088) (-1694.982) [-1693.560] (-1692.024) * [-1696.622] (-1705.470) (-1695.360) (-1695.799) -- 0:01:52
552500 -- (-1697.785) (-1701.893) [-1691.964] (-1697.671) * (-1694.884) [-1698.440] (-1692.207) (-1696.911) -- 0:01:52
553000 -- (-1695.426) (-1698.225) [-1698.247] (-1700.206) * (-1695.023) (-1700.463) [-1698.343] (-1696.890) -- 0:01:52
553500 -- (-1699.046) (-1705.939) [-1695.332] (-1705.789) * (-1698.659) (-1694.984) (-1705.844) [-1693.989] -- 0:01:52
554000 -- [-1695.357] (-1697.515) (-1701.026) (-1709.073) * (-1698.701) (-1694.571) (-1696.117) [-1700.740] -- 0:01:52
554500 -- (-1696.334) (-1696.538) [-1694.028] (-1702.213) * (-1694.471) (-1692.230) (-1697.403) [-1694.222] -- 0:01:52
555000 -- (-1696.188) [-1694.464] (-1692.532) (-1692.432) * (-1699.977) [-1694.657] (-1704.878) (-1698.878) -- 0:01:52
Average standard deviation of split frequencies: 0.003603
555500 -- (-1695.004) (-1696.998) (-1701.278) [-1693.300] * (-1701.670) (-1692.568) (-1694.490) [-1692.742] -- 0:01:52
556000 -- (-1701.358) (-1696.835) (-1703.032) [-1691.247] * (-1697.947) [-1699.476] (-1698.998) (-1693.311) -- 0:01:51
556500 -- (-1701.089) [-1693.405] (-1698.654) (-1692.586) * (-1702.240) (-1703.463) [-1699.379] (-1695.598) -- 0:01:51
557000 -- (-1699.100) (-1699.154) [-1694.733] (-1691.475) * (-1699.532) (-1691.768) [-1699.720] (-1698.926) -- 0:01:51
557500 -- (-1694.693) (-1699.032) (-1695.416) [-1694.967] * (-1698.193) (-1701.301) [-1693.818] (-1698.726) -- 0:01:51
558000 -- (-1694.569) [-1696.150] (-1697.965) (-1696.035) * (-1692.452) [-1691.959] (-1693.936) (-1699.931) -- 0:01:51
558500 -- (-1698.203) (-1697.210) (-1699.049) [-1696.268] * [-1697.333] (-1695.079) (-1694.582) (-1699.189) -- 0:01:51
559000 -- [-1691.240] (-1697.424) (-1690.766) (-1705.318) * [-1692.823] (-1698.898) (-1701.290) (-1694.496) -- 0:01:51
559500 -- (-1705.458) [-1696.764] (-1695.904) (-1693.165) * [-1694.894] (-1691.653) (-1692.565) (-1693.528) -- 0:01:51
560000 -- (-1698.829) (-1697.424) [-1693.893] (-1698.586) * [-1698.816] (-1695.508) (-1700.907) (-1696.976) -- 0:01:50
Average standard deviation of split frequencies: 0.003363
560500 -- (-1702.744) [-1694.223] (-1700.353) (-1695.744) * [-1695.409] (-1699.504) (-1704.759) (-1696.673) -- 0:01:50
561000 -- (-1698.827) (-1697.076) [-1700.176] (-1700.059) * (-1700.599) (-1695.661) (-1692.800) [-1696.955] -- 0:01:50
561500 -- [-1696.335] (-1695.956) (-1697.904) (-1696.395) * (-1694.582) [-1693.640] (-1696.717) (-1702.360) -- 0:01:50
562000 -- (-1700.925) [-1695.709] (-1698.057) (-1693.714) * (-1697.498) [-1695.206] (-1698.239) (-1697.523) -- 0:01:50
562500 -- [-1698.931] (-1701.551) (-1701.165) (-1698.660) * (-1694.548) [-1699.608] (-1694.381) (-1703.833) -- 0:01:50
563000 -- [-1695.694] (-1710.142) (-1700.921) (-1694.214) * (-1697.529) [-1697.986] (-1703.378) (-1698.507) -- 0:01:50
563500 -- (-1690.994) (-1697.903) (-1697.681) [-1693.888] * [-1694.540] (-1694.935) (-1695.534) (-1695.901) -- 0:01:49
564000 -- (-1698.240) (-1694.210) (-1701.368) [-1693.559] * (-1696.764) [-1696.782] (-1697.621) (-1695.981) -- 0:01:49
564500 -- (-1700.061) [-1697.423] (-1702.076) (-1694.695) * (-1691.219) [-1697.996] (-1698.360) (-1697.429) -- 0:01:49
565000 -- [-1688.862] (-1697.685) (-1696.972) (-1696.128) * (-1693.812) [-1699.785] (-1702.131) (-1695.843) -- 0:01:49
Average standard deviation of split frequencies: 0.003540
565500 -- (-1695.058) [-1690.060] (-1699.753) (-1693.760) * [-1692.274] (-1695.550) (-1702.151) (-1695.537) -- 0:01:49
566000 -- [-1691.656] (-1694.380) (-1696.993) (-1693.279) * [-1688.916] (-1695.992) (-1694.866) (-1702.895) -- 0:01:49
566500 -- (-1692.862) [-1693.261] (-1695.357) (-1695.952) * (-1701.539) (-1698.367) (-1700.029) [-1696.849] -- 0:01:49
567000 -- [-1694.199] (-1707.832) (-1696.461) (-1714.451) * [-1695.952] (-1703.839) (-1698.771) (-1701.593) -- 0:01:49
567500 -- (-1695.848) (-1698.933) (-1701.249) [-1692.909] * (-1702.551) [-1694.147] (-1694.386) (-1694.599) -- 0:01:48
568000 -- (-1690.587) [-1695.166] (-1693.338) (-1709.149) * [-1704.515] (-1699.197) (-1693.352) (-1694.575) -- 0:01:48
568500 -- [-1695.409] (-1701.121) (-1695.750) (-1699.794) * (-1700.206) (-1698.478) [-1694.288] (-1690.985) -- 0:01:48
569000 -- (-1697.236) (-1693.850) [-1696.328] (-1703.028) * (-1694.364) (-1698.201) (-1696.625) [-1694.104] -- 0:01:48
569500 -- (-1705.293) (-1699.813) [-1689.846] (-1698.359) * (-1696.259) (-1700.122) [-1697.160] (-1693.186) -- 0:01:48
570000 -- (-1697.594) [-1698.050] (-1697.457) (-1703.251) * (-1699.930) [-1694.531] (-1696.370) (-1697.895) -- 0:01:48
Average standard deviation of split frequencies: 0.004337
570500 -- (-1692.307) (-1693.512) (-1703.929) [-1693.022] * (-1698.994) [-1696.924] (-1705.556) (-1697.334) -- 0:01:48
571000 -- (-1695.991) (-1697.966) (-1705.848) [-1693.971] * (-1702.786) (-1704.055) [-1693.423] (-1695.663) -- 0:01:48
571500 -- (-1691.383) (-1698.255) (-1697.067) [-1691.555] * (-1697.819) (-1700.074) [-1699.584] (-1707.895) -- 0:01:47
572000 -- (-1698.039) (-1699.153) (-1697.873) [-1697.848] * (-1697.100) (-1702.849) (-1699.460) [-1693.279] -- 0:01:47
572500 -- [-1698.271] (-1695.998) (-1698.484) (-1694.759) * (-1698.993) (-1699.287) (-1695.313) [-1696.867] -- 0:01:47
573000 -- (-1698.340) [-1697.137] (-1693.186) (-1694.548) * (-1690.950) (-1702.100) (-1698.210) [-1694.889] -- 0:01:47
573500 -- (-1690.885) (-1696.659) [-1692.453] (-1703.085) * [-1696.606] (-1696.266) (-1693.300) (-1701.494) -- 0:01:47
574000 -- [-1692.958] (-1696.554) (-1696.112) (-1699.326) * (-1695.262) (-1698.243) (-1695.302) [-1692.609] -- 0:01:47
574500 -- (-1697.183) (-1696.508) (-1692.829) [-1698.731] * [-1696.862] (-1697.059) (-1700.986) (-1700.105) -- 0:01:47
575000 -- (-1703.323) [-1693.479] (-1695.685) (-1697.840) * (-1696.140) (-1700.523) (-1693.015) [-1695.555] -- 0:01:47
Average standard deviation of split frequencies: 0.004910
575500 -- (-1703.300) (-1692.839) (-1700.454) [-1696.325] * (-1693.452) (-1701.524) (-1694.076) [-1692.142] -- 0:01:46
576000 -- [-1701.821] (-1703.401) (-1694.210) (-1697.146) * (-1694.296) [-1703.593] (-1697.949) (-1691.149) -- 0:01:46
576500 -- (-1697.377) [-1695.863] (-1698.820) (-1702.670) * (-1692.763) [-1699.411] (-1700.719) (-1700.516) -- 0:01:46
577000 -- (-1704.292) (-1701.631) [-1695.800] (-1697.056) * [-1692.891] (-1702.458) (-1702.890) (-1694.511) -- 0:01:46
577500 -- (-1701.534) (-1697.498) [-1695.255] (-1701.119) * (-1696.121) (-1694.330) [-1693.024] (-1704.090) -- 0:01:46
578000 -- (-1695.052) (-1692.807) (-1705.252) [-1694.492] * (-1707.352) [-1706.870] (-1700.090) (-1698.397) -- 0:01:46
578500 -- (-1700.640) (-1693.015) [-1692.017] (-1701.348) * (-1698.265) [-1697.229] (-1699.610) (-1693.444) -- 0:01:46
579000 -- [-1698.693] (-1691.572) (-1702.611) (-1698.359) * [-1693.257] (-1694.131) (-1703.107) (-1692.776) -- 0:01:46
579500 -- (-1695.623) [-1695.764] (-1690.721) (-1696.598) * [-1695.621] (-1704.379) (-1699.680) (-1693.471) -- 0:01:45
580000 -- (-1698.851) (-1696.926) (-1698.043) [-1696.021] * [-1699.835] (-1699.700) (-1700.000) (-1701.788) -- 0:01:45
Average standard deviation of split frequencies: 0.005480
580500 -- [-1694.019] (-1695.022) (-1696.244) (-1700.642) * (-1697.105) (-1694.414) [-1696.501] (-1696.936) -- 0:01:45
581000 -- (-1691.643) (-1700.859) (-1700.290) [-1700.625] * [-1696.390] (-1698.330) (-1702.625) (-1692.641) -- 0:01:45
581500 -- (-1698.668) [-1706.288] (-1696.708) (-1698.813) * [-1694.762] (-1693.631) (-1702.226) (-1691.605) -- 0:01:45
582000 -- [-1693.631] (-1699.547) (-1700.662) (-1698.065) * (-1697.699) [-1689.918] (-1699.079) (-1702.934) -- 0:01:45
582500 -- [-1696.782] (-1702.267) (-1706.495) (-1706.685) * (-1693.232) (-1697.114) (-1693.520) [-1699.775] -- 0:01:45
583000 -- (-1702.431) (-1696.014) (-1699.288) [-1696.821] * (-1697.892) [-1699.032] (-1695.545) (-1696.966) -- 0:01:45
583500 -- (-1696.302) [-1693.558] (-1693.924) (-1697.362) * (-1694.968) (-1718.592) [-1693.844] (-1702.979) -- 0:01:44
584000 -- (-1696.311) (-1698.807) [-1693.955] (-1697.166) * (-1702.565) (-1695.373) (-1693.843) [-1695.087] -- 0:01:44
584500 -- (-1696.442) [-1693.672] (-1697.886) (-1697.868) * (-1696.838) [-1693.569] (-1698.587) (-1696.248) -- 0:01:44
585000 -- (-1694.939) (-1697.157) [-1696.590] (-1692.011) * (-1694.988) (-1693.766) (-1706.248) [-1696.859] -- 0:01:44
Average standard deviation of split frequencies: 0.005430
585500 -- (-1695.547) [-1696.585] (-1693.028) (-1691.024) * (-1693.610) (-1696.391) (-1691.986) [-1701.818] -- 0:01:44
586000 -- (-1697.779) (-1696.721) [-1698.889] (-1702.624) * (-1690.889) [-1695.033] (-1694.647) (-1706.543) -- 0:01:44
586500 -- (-1697.107) (-1698.167) (-1706.178) [-1691.008] * (-1695.946) (-1695.625) (-1695.338) [-1698.050] -- 0:01:44
587000 -- (-1699.538) [-1691.879] (-1697.158) (-1694.744) * (-1700.522) [-1695.109] (-1702.024) (-1698.667) -- 0:01:44
587500 -- (-1700.254) (-1692.520) [-1695.150] (-1695.655) * (-1694.454) [-1699.376] (-1695.898) (-1703.060) -- 0:01:43
588000 -- (-1698.660) [-1700.421] (-1695.885) (-1701.468) * (-1701.885) (-1702.891) (-1697.249) [-1692.248] -- 0:01:43
588500 -- (-1697.797) (-1694.928) [-1693.677] (-1696.411) * [-1694.591] (-1694.740) (-1699.364) (-1698.005) -- 0:01:43
589000 -- (-1693.693) (-1698.141) [-1695.889] (-1697.545) * (-1698.187) [-1702.455] (-1699.102) (-1697.685) -- 0:01:43
589500 -- (-1696.047) (-1702.740) [-1690.298] (-1695.723) * (-1696.498) (-1693.874) (-1697.325) [-1696.002] -- 0:01:43
590000 -- (-1691.964) [-1693.034] (-1697.706) (-1696.163) * (-1700.802) (-1698.910) (-1693.024) [-1698.865] -- 0:01:43
Average standard deviation of split frequencies: 0.006584
590500 -- (-1700.599) (-1694.383) (-1696.984) [-1695.381] * (-1698.381) [-1698.819] (-1700.384) (-1691.890) -- 0:01:43
591000 -- (-1702.521) [-1692.704] (-1700.769) (-1689.715) * (-1694.294) (-1695.526) [-1693.862] (-1699.045) -- 0:01:43
591500 -- (-1706.609) (-1703.395) [-1712.404] (-1696.704) * (-1693.812) [-1695.250] (-1695.119) (-1711.158) -- 0:01:42
592000 -- (-1697.821) (-1695.700) (-1700.684) [-1698.203] * (-1697.724) [-1692.593] (-1689.995) (-1699.336) -- 0:01:42
592500 -- (-1698.365) (-1689.747) [-1697.848] (-1699.419) * [-1704.464] (-1695.995) (-1694.110) (-1697.489) -- 0:01:42
593000 -- (-1698.952) [-1692.743] (-1695.951) (-1698.746) * (-1697.262) (-1694.647) [-1701.110] (-1695.952) -- 0:01:42
593500 -- (-1696.733) [-1697.097] (-1701.952) (-1702.117) * (-1695.417) (-1695.486) [-1692.749] (-1699.163) -- 0:01:42
594000 -- [-1697.572] (-1699.213) (-1695.992) (-1701.074) * (-1700.075) (-1700.199) [-1695.098] (-1703.998) -- 0:01:42
594500 -- (-1698.220) (-1699.364) (-1697.477) [-1702.559] * (-1692.880) [-1693.530] (-1704.700) (-1696.808) -- 0:01:42
595000 -- (-1693.184) [-1691.546] (-1698.729) (-1699.184) * (-1690.172) (-1701.015) [-1696.284] (-1695.105) -- 0:01:42
Average standard deviation of split frequencies: 0.005932
595500 -- (-1695.906) (-1701.962) [-1699.441] (-1693.559) * (-1697.750) (-1706.309) (-1702.342) [-1691.694] -- 0:01:41
596000 -- [-1697.097] (-1693.182) (-1699.876) (-1698.744) * (-1695.830) [-1702.885] (-1696.532) (-1693.172) -- 0:01:41
596500 -- (-1695.389) (-1695.654) [-1697.835] (-1695.675) * [-1692.851] (-1700.932) (-1695.047) (-1694.503) -- 0:01:41
597000 -- (-1698.390) (-1706.804) [-1699.625] (-1700.416) * [-1695.280] (-1700.982) (-1694.712) (-1698.329) -- 0:01:41
597500 -- (-1704.454) (-1695.313) (-1702.945) [-1695.796] * (-1693.045) (-1699.304) (-1702.066) [-1693.590] -- 0:01:41
598000 -- (-1689.903) [-1692.457] (-1695.608) (-1698.094) * (-1700.739) [-1707.591] (-1701.593) (-1700.299) -- 0:01:41
598500 -- (-1700.514) [-1697.455] (-1696.648) (-1695.680) * (-1692.971) (-1697.534) [-1694.357] (-1705.141) -- 0:01:41
599000 -- (-1702.955) [-1697.314] (-1698.851) (-1689.552) * (-1694.802) (-1694.478) (-1697.661) [-1696.794] -- 0:01:41
599500 -- (-1690.700) [-1697.479] (-1693.348) (-1696.667) * [-1697.243] (-1696.555) (-1693.918) (-1706.353) -- 0:01:40
600000 -- [-1696.687] (-1691.483) (-1695.261) (-1697.542) * (-1696.222) (-1696.358) [-1691.160] (-1691.942) -- 0:01:40
Average standard deviation of split frequencies: 0.005690
600500 -- (-1697.003) (-1692.616) [-1696.201] (-1694.098) * (-1703.356) (-1704.983) [-1694.958] (-1696.962) -- 0:01:40
601000 -- (-1701.212) (-1699.821) [-1698.572] (-1699.127) * (-1697.231) (-1700.007) (-1701.838) [-1696.934] -- 0:01:40
601500 -- (-1701.935) [-1694.353] (-1703.398) (-1704.672) * (-1698.027) [-1701.164] (-1698.244) (-1693.581) -- 0:01:40
602000 -- [-1697.313] (-1697.194) (-1699.556) (-1703.902) * (-1697.001) (-1696.979) (-1693.926) [-1696.193] -- 0:01:40
602500 -- (-1696.785) [-1693.029] (-1697.492) (-1716.580) * (-1696.391) (-1692.711) (-1698.553) [-1695.715] -- 0:01:40
603000 -- [-1691.980] (-1699.064) (-1694.189) (-1699.791) * (-1697.831) (-1695.831) (-1696.641) [-1702.887] -- 0:01:40
603500 -- [-1696.112] (-1693.590) (-1691.319) (-1694.328) * [-1691.464] (-1702.862) (-1700.271) (-1703.934) -- 0:01:39
604000 -- (-1695.545) [-1697.331] (-1690.147) (-1694.180) * [-1693.632] (-1692.640) (-1704.465) (-1700.099) -- 0:01:39
604500 -- (-1699.753) (-1703.713) [-1693.542] (-1695.894) * (-1695.659) (-1700.992) [-1693.038] (-1695.121) -- 0:01:39
605000 -- [-1700.357] (-1696.911) (-1699.832) (-1703.906) * (-1695.963) (-1696.749) (-1690.902) [-1693.952] -- 0:01:39
Average standard deviation of split frequencies: 0.006418
605500 -- (-1700.395) [-1697.788] (-1704.408) (-1696.618) * (-1703.136) (-1698.002) (-1698.934) [-1696.574] -- 0:01:39
606000 -- (-1699.405) [-1696.089] (-1697.925) (-1698.801) * (-1695.461) (-1703.755) [-1697.983] (-1690.863) -- 0:01:39
606500 -- (-1701.685) (-1691.180) [-1698.875] (-1698.633) * (-1702.789) (-1693.986) (-1697.423) [-1698.232] -- 0:01:39
607000 -- (-1700.244) (-1695.696) (-1703.103) [-1695.563] * (-1703.707) (-1697.016) [-1698.164] (-1701.000) -- 0:01:39
607500 -- (-1701.937) [-1696.429] (-1695.195) (-1696.193) * (-1698.973) (-1701.218) (-1698.758) [-1695.714] -- 0:01:38
608000 -- (-1704.737) (-1697.494) (-1699.865) [-1695.680] * [-1699.733] (-1692.798) (-1693.164) (-1697.289) -- 0:01:38
608500 -- [-1697.494] (-1696.736) (-1695.217) (-1695.188) * (-1695.418) (-1694.247) [-1693.965] (-1697.905) -- 0:01:38
609000 -- (-1694.882) (-1696.681) (-1696.374) [-1701.473] * [-1694.778] (-1697.866) (-1697.509) (-1700.457) -- 0:01:38
609500 -- [-1692.998] (-1693.248) (-1699.200) (-1698.673) * (-1693.887) [-1695.839] (-1700.164) (-1695.975) -- 0:01:38
610000 -- (-1690.893) (-1694.055) [-1691.934] (-1703.048) * (-1693.392) [-1691.373] (-1693.231) (-1693.177) -- 0:01:38
Average standard deviation of split frequencies: 0.007527
610500 -- [-1692.030] (-1693.427) (-1697.080) (-1698.731) * (-1694.698) (-1689.490) (-1697.417) [-1697.183] -- 0:01:38
611000 -- [-1696.050] (-1696.769) (-1690.927) (-1705.152) * (-1697.312) (-1694.524) (-1697.902) [-1696.101] -- 0:01:38
611500 -- [-1698.628] (-1697.817) (-1699.354) (-1702.586) * (-1694.800) (-1697.829) [-1697.838] (-1698.285) -- 0:01:37
612000 -- (-1693.966) (-1698.135) (-1696.837) [-1699.151] * (-1692.390) [-1699.613] (-1693.316) (-1696.050) -- 0:01:37
612500 -- (-1696.657) [-1697.362] (-1697.809) (-1701.848) * [-1699.145] (-1699.086) (-1696.917) (-1701.916) -- 0:01:37
613000 -- (-1699.596) (-1697.493) [-1693.057] (-1694.163) * [-1696.296] (-1698.756) (-1694.296) (-1697.782) -- 0:01:37
613500 -- [-1695.815] (-1698.238) (-1693.305) (-1697.649) * (-1700.311) (-1708.650) [-1694.705] (-1698.899) -- 0:01:37
614000 -- (-1692.963) (-1692.934) (-1695.907) [-1692.029] * (-1695.637) (-1697.166) [-1695.225] (-1696.115) -- 0:01:37
614500 -- [-1694.650] (-1694.996) (-1701.104) (-1699.320) * (-1690.519) (-1698.057) [-1699.023] (-1696.146) -- 0:01:37
615000 -- [-1696.948] (-1696.026) (-1692.696) (-1699.873) * (-1700.371) (-1693.994) [-1698.370] (-1699.494) -- 0:01:37
Average standard deviation of split frequencies: 0.006696
615500 -- (-1698.779) (-1704.090) [-1696.393] (-1697.578) * (-1695.488) [-1695.179] (-1692.315) (-1697.860) -- 0:01:36
616000 -- (-1696.475) (-1698.239) (-1692.061) [-1694.147] * (-1692.740) [-1689.668] (-1691.463) (-1694.966) -- 0:01:36
616500 -- [-1696.481] (-1698.551) (-1693.454) (-1695.245) * (-1693.244) [-1697.658] (-1696.421) (-1703.002) -- 0:01:36
617000 -- [-1693.435] (-1700.091) (-1699.931) (-1696.428) * [-1696.216] (-1695.687) (-1695.545) (-1699.377) -- 0:01:36
617500 -- [-1694.731] (-1697.261) (-1695.649) (-1701.807) * [-1701.191] (-1693.072) (-1696.247) (-1695.062) -- 0:01:36
618000 -- (-1695.273) (-1701.394) [-1696.510] (-1693.878) * [-1699.894] (-1697.998) (-1698.924) (-1697.383) -- 0:01:36
618500 -- [-1700.004] (-1701.992) (-1691.996) (-1697.048) * (-1708.119) (-1701.348) [-1695.250] (-1698.925) -- 0:01:36
619000 -- (-1697.784) [-1695.533] (-1689.198) (-1693.423) * [-1697.400] (-1697.900) (-1700.806) (-1696.366) -- 0:01:36
619500 -- (-1695.712) (-1699.944) [-1694.721] (-1693.830) * (-1704.570) (-1698.349) (-1695.503) [-1695.628] -- 0:01:35
620000 -- (-1698.154) (-1703.228) [-1693.867] (-1695.087) * (-1700.590) (-1698.268) [-1691.324] (-1696.376) -- 0:01:35
Average standard deviation of split frequencies: 0.006456
620500 -- (-1692.943) (-1701.328) [-1694.351] (-1699.096) * (-1701.510) (-1703.176) (-1695.893) [-1697.382] -- 0:01:35
621000 -- [-1697.466] (-1708.255) (-1694.435) (-1699.679) * (-1703.334) (-1705.182) [-1694.283] (-1689.901) -- 0:01:35
621500 -- (-1702.676) [-1703.325] (-1694.826) (-1697.139) * (-1707.380) (-1706.957) (-1696.100) [-1697.664] -- 0:01:35
622000 -- (-1695.507) (-1703.295) [-1691.411] (-1695.818) * (-1699.494) (-1699.016) [-1697.304] (-1696.319) -- 0:01:35
622500 -- (-1697.481) (-1697.843) (-1700.808) [-1695.557] * (-1698.837) (-1693.219) (-1695.040) [-1694.774] -- 0:01:35
623000 -- (-1695.416) (-1695.510) [-1695.321] (-1706.114) * (-1694.766) [-1695.780] (-1699.243) (-1692.660) -- 0:01:35
623500 -- (-1713.788) [-1693.320] (-1693.208) (-1697.668) * [-1691.676] (-1696.192) (-1701.954) (-1703.840) -- 0:01:34
624000 -- (-1704.646) (-1702.062) [-1693.128] (-1696.509) * [-1691.359] (-1702.302) (-1704.516) (-1702.186) -- 0:01:34
624500 -- [-1699.525] (-1694.656) (-1692.312) (-1694.923) * [-1699.004] (-1694.589) (-1692.981) (-1704.922) -- 0:01:34
625000 -- (-1708.915) (-1691.174) [-1701.346] (-1698.347) * (-1700.030) [-1699.736] (-1693.141) (-1701.580) -- 0:01:34
Average standard deviation of split frequencies: 0.007907
625500 -- (-1692.399) [-1694.818] (-1706.782) (-1696.914) * [-1696.780] (-1699.034) (-1696.856) (-1694.168) -- 0:01:34
626000 -- [-1700.524] (-1691.965) (-1705.199) (-1691.985) * (-1698.637) [-1693.517] (-1699.381) (-1697.487) -- 0:01:34
626500 -- (-1696.452) (-1705.453) [-1703.944] (-1694.510) * (-1695.919) [-1696.825] (-1692.098) (-1695.182) -- 0:01:34
627000 -- (-1701.186) (-1699.953) (-1702.515) [-1696.694] * (-1700.603) (-1700.470) [-1694.817] (-1699.299) -- 0:01:33
627500 -- [-1695.972] (-1699.361) (-1703.325) (-1697.273) * (-1698.996) (-1701.668) (-1698.384) [-1695.972] -- 0:01:33
628000 -- [-1693.988] (-1701.003) (-1702.621) (-1697.569) * [-1694.458] (-1699.440) (-1696.686) (-1695.956) -- 0:01:33
628500 -- (-1698.585) (-1696.243) [-1700.308] (-1698.757) * (-1697.568) [-1699.425] (-1699.887) (-1694.269) -- 0:01:33
629000 -- [-1693.308] (-1704.946) (-1698.128) (-1694.428) * [-1694.760] (-1696.064) (-1698.472) (-1697.017) -- 0:01:33
629500 -- (-1693.352) (-1697.970) (-1694.546) [-1695.839] * [-1700.193] (-1695.932) (-1693.204) (-1700.060) -- 0:01:33
630000 -- (-1692.540) (-1694.493) (-1695.165) [-1700.380] * (-1699.798) (-1690.684) [-1694.843] (-1697.890) -- 0:01:33
Average standard deviation of split frequencies: 0.007475
630500 -- [-1694.286] (-1699.220) (-1696.498) (-1697.304) * (-1692.737) (-1698.405) (-1700.912) [-1696.652] -- 0:01:33
631000 -- [-1699.359] (-1698.441) (-1699.530) (-1700.408) * (-1694.226) (-1697.633) [-1695.756] (-1695.558) -- 0:01:32
631500 -- [-1693.237] (-1692.920) (-1698.893) (-1702.484) * (-1695.498) [-1694.215] (-1699.642) (-1697.517) -- 0:01:32
632000 -- (-1697.381) [-1694.051] (-1697.023) (-1704.342) * (-1698.476) (-1701.478) (-1695.528) [-1700.585] -- 0:01:32
632500 -- (-1698.251) (-1691.147) (-1693.520) [-1694.531] * (-1698.199) (-1694.117) [-1696.149] (-1694.516) -- 0:01:32
633000 -- [-1694.031] (-1699.271) (-1701.192) (-1698.261) * [-1694.939] (-1696.100) (-1702.344) (-1700.735) -- 0:01:32
633500 -- [-1702.494] (-1703.632) (-1696.814) (-1695.223) * (-1696.309) (-1695.954) (-1693.021) [-1695.563] -- 0:01:32
634000 -- (-1696.470) (-1698.991) (-1698.558) [-1694.804] * (-1696.905) (-1697.853) [-1700.296] (-1695.309) -- 0:01:32
634500 -- (-1699.263) [-1689.576] (-1692.798) (-1696.194) * (-1700.270) (-1697.420) [-1698.792] (-1690.455) -- 0:01:32
635000 -- (-1699.028) [-1700.619] (-1694.605) (-1695.122) * (-1696.475) (-1701.009) [-1696.354] (-1698.708) -- 0:01:31
Average standard deviation of split frequencies: 0.007041
635500 -- (-1695.958) (-1696.190) (-1695.275) [-1697.030] * (-1693.293) (-1695.268) (-1694.547) [-1692.757] -- 0:01:31
636000 -- [-1696.835] (-1697.837) (-1692.592) (-1702.288) * (-1695.843) (-1695.470) [-1698.839] (-1696.694) -- 0:01:31
636500 -- (-1696.400) (-1698.124) [-1695.925] (-1696.169) * (-1701.549) (-1694.229) [-1692.749] (-1701.691) -- 0:01:31
637000 -- [-1698.657] (-1695.136) (-1696.539) (-1700.764) * (-1701.598) [-1697.868] (-1697.272) (-1695.803) -- 0:01:31
637500 -- [-1693.804] (-1699.194) (-1698.577) (-1699.363) * (-1701.396) (-1703.332) [-1699.581] (-1693.991) -- 0:01:31
638000 -- (-1696.284) (-1700.277) [-1707.510] (-1699.003) * (-1697.002) (-1699.087) (-1700.672) [-1691.140] -- 0:01:31
638500 -- (-1694.246) (-1701.854) (-1701.176) [-1691.131] * (-1697.110) (-1701.289) [-1694.980] (-1694.675) -- 0:01:31
639000 -- [-1695.711] (-1695.674) (-1707.511) (-1699.938) * [-1698.142] (-1698.564) (-1699.884) (-1696.012) -- 0:01:30
639500 -- (-1697.886) [-1699.514] (-1695.335) (-1704.413) * [-1701.025] (-1704.148) (-1695.709) (-1691.140) -- 0:01:30
640000 -- [-1700.063] (-1697.923) (-1699.820) (-1703.775) * [-1700.098] (-1696.875) (-1701.333) (-1701.081) -- 0:01:30
Average standard deviation of split frequencies: 0.006070
640500 -- (-1706.962) [-1691.496] (-1696.320) (-1700.875) * (-1694.354) (-1703.182) [-1694.591] (-1700.340) -- 0:01:30
641000 -- (-1698.713) [-1696.205] (-1695.109) (-1701.005) * (-1694.677) (-1703.811) [-1694.176] (-1699.708) -- 0:01:30
641500 -- (-1692.449) [-1690.817] (-1696.110) (-1699.712) * (-1699.813) [-1700.601] (-1697.225) (-1701.467) -- 0:01:30
642000 -- (-1690.957) [-1692.176] (-1699.300) (-1696.498) * (-1693.312) (-1694.856) [-1694.660] (-1697.650) -- 0:01:30
642500 -- [-1693.052] (-1699.361) (-1704.984) (-1700.299) * (-1697.218) (-1694.005) [-1697.252] (-1696.605) -- 0:01:30
643000 -- [-1699.730] (-1695.315) (-1697.922) (-1700.167) * (-1698.324) (-1694.082) [-1699.108] (-1697.052) -- 0:01:29
643500 -- (-1703.422) [-1698.318] (-1700.026) (-1695.771) * (-1696.814) (-1696.291) (-1696.173) [-1693.583] -- 0:01:29
644000 -- (-1701.994) [-1695.070] (-1700.975) (-1696.340) * (-1695.025) [-1701.712] (-1696.578) (-1697.429) -- 0:01:29
644500 -- (-1696.385) (-1698.227) (-1696.815) [-1698.900] * (-1699.570) (-1695.276) [-1697.332] (-1692.796) -- 0:01:29
645000 -- (-1694.499) [-1693.271] (-1698.189) (-1704.505) * (-1701.955) (-1698.380) (-1707.352) [-1697.881] -- 0:01:29
Average standard deviation of split frequencies: 0.006568
645500 -- [-1694.637] (-1693.804) (-1696.798) (-1696.913) * (-1706.178) [-1691.575] (-1699.140) (-1700.818) -- 0:01:29
646000 -- (-1693.881) (-1693.447) (-1699.900) [-1700.070] * (-1700.654) (-1698.721) [-1700.874] (-1700.819) -- 0:01:29
646500 -- [-1698.042] (-1692.359) (-1701.211) (-1691.659) * (-1701.038) (-1696.939) [-1701.316] (-1696.230) -- 0:01:29
647000 -- (-1696.026) (-1694.079) (-1698.864) [-1692.844] * [-1693.411] (-1700.917) (-1700.488) (-1697.477) -- 0:01:28
647500 -- (-1702.828) [-1695.245] (-1700.303) (-1697.830) * [-1702.163] (-1700.486) (-1695.179) (-1697.588) -- 0:01:28
648000 -- (-1705.635) (-1695.421) (-1695.570) [-1694.948] * (-1701.879) (-1699.176) [-1691.595] (-1700.593) -- 0:01:28
648500 -- (-1696.370) (-1698.162) (-1702.325) [-1695.321] * (-1695.421) (-1701.180) [-1694.564] (-1696.322) -- 0:01:28
649000 -- (-1700.989) (-1698.032) [-1700.090] (-1703.246) * (-1698.827) [-1693.560] (-1704.761) (-1705.038) -- 0:01:28
649500 -- (-1702.061) [-1696.176] (-1696.554) (-1700.318) * [-1697.569] (-1698.091) (-1704.426) (-1700.771) -- 0:01:28
650000 -- (-1700.880) (-1699.001) [-1697.783] (-1700.523) * (-1702.366) (-1697.623) [-1697.629] (-1702.714) -- 0:01:28
Average standard deviation of split frequencies: 0.006883
650500 -- (-1703.734) [-1700.183] (-1697.985) (-1702.698) * [-1698.377] (-1691.735) (-1695.241) (-1702.062) -- 0:01:28
651000 -- (-1700.904) (-1703.525) (-1695.981) [-1694.907] * (-1694.834) [-1691.207] (-1698.335) (-1699.908) -- 0:01:27
651500 -- (-1705.551) [-1691.769] (-1699.080) (-1696.067) * (-1697.117) (-1693.471) [-1695.228] (-1701.852) -- 0:01:27
652000 -- (-1703.654) [-1693.135] (-1698.251) (-1694.928) * (-1702.755) [-1692.847] (-1703.960) (-1701.235) -- 0:01:27
652500 -- (-1701.089) [-1692.444] (-1701.352) (-1696.205) * [-1694.955] (-1697.314) (-1700.306) (-1699.977) -- 0:01:27
653000 -- (-1697.742) (-1697.870) [-1700.551] (-1701.992) * (-1702.097) [-1695.607] (-1691.212) (-1701.234) -- 0:01:27
653500 -- (-1700.651) (-1692.316) (-1701.610) [-1702.681] * (-1701.224) (-1703.717) (-1701.767) [-1700.656] -- 0:01:27
654000 -- [-1692.333] (-1699.303) (-1698.435) (-1692.703) * (-1698.324) (-1695.072) [-1697.678] (-1700.126) -- 0:01:27
654500 -- (-1695.603) (-1695.530) [-1696.353] (-1701.380) * (-1702.610) [-1696.620] (-1697.052) (-1695.768) -- 0:01:27
655000 -- (-1705.833) (-1691.640) [-1692.931] (-1697.599) * (-1692.526) (-1699.453) (-1692.119) [-1695.910] -- 0:01:26
Average standard deviation of split frequencies: 0.007905
655500 -- (-1708.688) (-1697.487) (-1698.006) [-1697.205] * [-1693.411] (-1693.951) (-1700.443) (-1695.591) -- 0:01:26
656000 -- (-1699.701) (-1703.200) (-1699.125) [-1691.469] * [-1698.837] (-1704.071) (-1694.749) (-1695.653) -- 0:01:26
656500 -- (-1698.743) [-1700.741] (-1706.392) (-1694.246) * (-1701.071) [-1705.926] (-1697.246) (-1696.024) -- 0:01:26
657000 -- (-1695.871) (-1696.511) [-1698.296] (-1698.006) * (-1703.125) (-1702.414) (-1695.285) [-1696.838] -- 0:01:26
657500 -- (-1702.510) (-1707.049) (-1696.684) [-1708.058] * (-1700.650) (-1699.922) [-1697.491] (-1694.643) -- 0:01:26
658000 -- [-1696.002] (-1703.614) (-1700.005) (-1698.256) * [-1699.534] (-1697.238) (-1696.156) (-1698.151) -- 0:01:26
658500 -- (-1702.946) [-1696.001] (-1698.789) (-1698.156) * (-1704.102) (-1698.514) (-1693.501) [-1692.166] -- 0:01:26
659000 -- (-1703.014) [-1698.329] (-1698.770) (-1708.588) * (-1699.747) (-1699.740) [-1694.928] (-1699.391) -- 0:01:25
659500 -- (-1699.904) [-1695.307] (-1693.419) (-1702.737) * (-1696.171) (-1695.042) [-1695.753] (-1702.679) -- 0:01:25
660000 -- [-1701.885] (-1696.528) (-1703.101) (-1698.328) * [-1696.930] (-1693.532) (-1694.216) (-1698.963) -- 0:01:25
Average standard deviation of split frequencies: 0.008027
660500 -- (-1692.524) (-1700.598) (-1696.337) [-1692.684] * (-1698.501) [-1701.783] (-1694.011) (-1700.996) -- 0:01:25
661000 -- (-1698.529) (-1692.116) [-1698.994] (-1701.121) * [-1698.612] (-1697.924) (-1700.447) (-1698.858) -- 0:01:25
661500 -- (-1697.485) (-1694.364) (-1700.721) [-1697.962] * [-1701.240] (-1698.990) (-1704.510) (-1697.190) -- 0:01:25
662000 -- (-1697.223) [-1698.249] (-1697.307) (-1699.133) * (-1701.763) (-1695.103) [-1699.516] (-1700.455) -- 0:01:25
662500 -- (-1698.027) (-1701.908) [-1695.396] (-1692.229) * (-1704.412) (-1699.330) [-1692.882] (-1700.278) -- 0:01:25
663000 -- (-1693.688) (-1697.157) [-1698.995] (-1699.545) * (-1692.335) [-1696.788] (-1696.377) (-1705.017) -- 0:01:24
663500 -- (-1700.802) (-1692.058) [-1691.583] (-1701.167) * (-1695.847) [-1696.078] (-1695.102) (-1700.928) -- 0:01:24
664000 -- (-1692.679) [-1693.121] (-1698.292) (-1694.880) * (-1702.108) [-1690.717] (-1697.708) (-1694.445) -- 0:01:24
664500 -- (-1696.075) (-1698.725) [-1693.737] (-1712.135) * [-1692.703] (-1698.071) (-1694.775) (-1694.975) -- 0:01:24
665000 -- [-1694.132] (-1695.685) (-1694.127) (-1701.096) * [-1693.047] (-1699.935) (-1694.769) (-1703.842) -- 0:01:24
Average standard deviation of split frequencies: 0.006016
665500 -- (-1696.867) [-1694.406] (-1692.889) (-1695.078) * [-1693.632] (-1691.841) (-1698.375) (-1692.590) -- 0:01:24
666000 -- (-1694.255) (-1692.145) (-1693.765) [-1701.908] * (-1701.604) (-1695.523) (-1696.067) [-1699.859] -- 0:01:24
666500 -- (-1697.350) (-1698.967) (-1694.474) [-1688.477] * (-1696.912) (-1696.535) (-1694.310) [-1695.516] -- 0:01:24
667000 -- (-1703.373) (-1701.626) [-1697.342] (-1692.110) * (-1693.512) (-1695.511) (-1697.621) [-1694.962] -- 0:01:23
667500 -- (-1705.057) (-1705.525) [-1695.786] (-1694.052) * (-1695.583) (-1700.534) [-1696.346] (-1698.845) -- 0:01:23
668000 -- (-1713.431) (-1708.066) [-1693.829] (-1696.498) * (-1699.126) [-1702.848] (-1698.877) (-1698.289) -- 0:01:23
668500 -- [-1697.577] (-1696.960) (-1697.089) (-1699.594) * (-1698.342) (-1696.845) [-1692.393] (-1696.819) -- 0:01:23
669000 -- [-1692.921] (-1694.426) (-1699.000) (-1695.180) * [-1695.721] (-1698.241) (-1694.808) (-1694.813) -- 0:01:23
669500 -- [-1694.433] (-1695.490) (-1696.079) (-1693.964) * (-1697.273) (-1708.359) (-1694.978) [-1696.251] -- 0:01:23
670000 -- (-1694.767) [-1698.113] (-1700.262) (-1698.068) * (-1691.769) (-1698.953) (-1693.955) [-1696.070] -- 0:01:23
Average standard deviation of split frequencies: 0.005447
670500 -- (-1697.112) (-1696.355) (-1698.813) [-1703.280] * (-1698.778) (-1699.156) (-1696.758) [-1692.559] -- 0:01:23
671000 -- [-1694.465] (-1700.450) (-1705.112) (-1695.184) * [-1699.515] (-1694.563) (-1694.368) (-1696.118) -- 0:01:22
671500 -- (-1703.450) (-1696.278) [-1696.998] (-1697.436) * (-1696.003) (-1689.269) [-1696.371] (-1693.979) -- 0:01:22
672000 -- [-1702.909] (-1695.801) (-1698.414) (-1706.497) * (-1698.397) [-1689.121] (-1704.310) (-1697.087) -- 0:01:22
672500 -- (-1698.269) (-1696.271) (-1700.899) [-1698.522] * [-1694.581] (-1694.142) (-1692.571) (-1690.944) -- 0:01:22
673000 -- (-1697.679) [-1689.723] (-1697.173) (-1702.017) * (-1700.505) (-1701.787) [-1694.258] (-1695.531) -- 0:01:22
673500 -- [-1697.887] (-1695.684) (-1694.677) (-1694.149) * (-1694.292) (-1698.932) (-1694.664) [-1700.399] -- 0:01:22
674000 -- (-1702.444) (-1693.982) [-1695.222] (-1695.957) * (-1695.680) [-1695.339] (-1693.243) (-1694.710) -- 0:01:22
674500 -- (-1696.019) [-1693.543] (-1699.847) (-1693.672) * (-1695.387) (-1698.090) [-1700.805] (-1696.796) -- 0:01:22
675000 -- (-1693.503) (-1698.586) [-1696.300] (-1700.924) * (-1695.086) (-1693.984) (-1698.105) [-1691.571] -- 0:01:21
Average standard deviation of split frequencies: 0.006625
675500 -- (-1699.735) (-1698.047) (-1704.130) [-1692.549] * [-1692.853] (-1693.701) (-1707.907) (-1694.201) -- 0:01:21
676000 -- (-1695.041) (-1695.638) (-1700.013) [-1695.458] * [-1699.098] (-1691.367) (-1697.976) (-1698.974) -- 0:01:21
676500 -- (-1697.487) (-1699.173) (-1698.633) [-1700.627] * (-1701.891) [-1695.699] (-1700.417) (-1696.772) -- 0:01:21
677000 -- [-1695.050] (-1703.150) (-1706.688) (-1695.703) * [-1695.648] (-1702.136) (-1701.329) (-1695.029) -- 0:01:21
677500 -- [-1695.181] (-1700.933) (-1699.245) (-1694.524) * [-1692.160] (-1694.251) (-1696.351) (-1698.067) -- 0:01:21
678000 -- [-1696.390] (-1699.898) (-1701.743) (-1695.126) * (-1694.798) (-1706.832) (-1693.020) [-1692.411] -- 0:01:21
678500 -- (-1696.641) (-1697.164) [-1696.503] (-1702.122) * (-1694.170) (-1697.271) [-1696.354] (-1694.639) -- 0:01:21
679000 -- (-1699.864) (-1704.286) (-1692.591) [-1693.909] * (-1697.808) (-1702.050) [-1696.465] (-1698.654) -- 0:01:20
679500 -- (-1702.629) (-1699.751) [-1694.442] (-1700.845) * (-1704.931) (-1698.919) (-1695.295) [-1697.912] -- 0:01:20
680000 -- (-1694.439) (-1695.380) (-1694.689) [-1700.287] * (-1699.089) (-1697.631) (-1697.781) [-1692.827] -- 0:01:20
Average standard deviation of split frequencies: 0.006060
680500 -- (-1693.114) (-1694.763) [-1694.585] (-1698.318) * (-1699.824) (-1694.325) [-1697.544] (-1705.535) -- 0:01:20
681000 -- (-1702.879) [-1691.324] (-1695.543) (-1700.877) * (-1706.381) [-1691.286] (-1697.893) (-1692.530) -- 0:01:20
681500 -- (-1693.767) [-1696.269] (-1698.870) (-1700.293) * (-1699.364) (-1696.721) [-1700.077] (-1695.458) -- 0:01:20
682000 -- (-1702.412) [-1691.609] (-1696.519) (-1696.046) * (-1694.136) (-1697.856) (-1695.063) [-1699.759] -- 0:01:20
682500 -- [-1692.442] (-1696.561) (-1697.668) (-1698.529) * (-1700.698) (-1692.922) [-1694.916] (-1699.835) -- 0:01:20
683000 -- [-1694.366] (-1692.726) (-1699.676) (-1695.451) * (-1693.982) (-1696.566) [-1693.256] (-1704.581) -- 0:01:19
683500 -- [-1697.278] (-1697.989) (-1702.615) (-1699.804) * (-1696.911) [-1699.566] (-1693.889) (-1696.636) -- 0:01:19
684000 -- (-1695.463) (-1703.059) [-1698.501] (-1695.874) * [-1693.258] (-1691.047) (-1689.744) (-1699.611) -- 0:01:19
684500 -- (-1695.205) [-1694.149] (-1695.842) (-1698.009) * (-1696.555) (-1696.436) [-1698.302] (-1692.841) -- 0:01:19
685000 -- (-1699.720) (-1698.028) (-1698.284) [-1694.136] * (-1705.894) [-1694.388] (-1694.558) (-1695.930) -- 0:01:19
Average standard deviation of split frequencies: 0.008246
685500 -- (-1692.537) (-1691.785) (-1704.407) [-1693.359] * [-1702.660] (-1701.575) (-1697.730) (-1700.861) -- 0:01:19
686000 -- (-1709.987) (-1697.070) [-1698.184] (-1699.555) * [-1694.286] (-1695.883) (-1699.878) (-1695.466) -- 0:01:19
686500 -- (-1694.606) (-1701.884) (-1708.435) [-1695.517] * (-1696.520) (-1699.239) [-1696.999] (-1694.962) -- 0:01:19
687000 -- (-1701.815) (-1697.218) [-1695.949] (-1696.027) * (-1702.468) [-1701.199] (-1693.897) (-1693.336) -- 0:01:18
687500 -- (-1695.806) (-1696.635) (-1698.679) [-1692.258] * [-1692.693] (-1695.170) (-1697.949) (-1698.215) -- 0:01:18
688000 -- (-1705.115) (-1692.013) (-1701.232) [-1697.815] * [-1699.688] (-1697.837) (-1694.006) (-1699.103) -- 0:01:18
688500 -- (-1697.672) (-1693.634) (-1704.913) [-1691.698] * (-1696.355) [-1695.721] (-1701.231) (-1701.511) -- 0:01:18
689000 -- (-1696.356) (-1698.347) (-1705.037) [-1694.891] * (-1692.847) (-1703.377) (-1696.429) [-1699.678] -- 0:01:18
689500 -- [-1694.139] (-1698.012) (-1703.433) (-1694.209) * [-1697.179] (-1706.746) (-1697.420) (-1693.582) -- 0:01:18
690000 -- (-1703.407) (-1699.319) (-1700.918) [-1696.013] * (-1697.291) (-1706.878) (-1700.584) [-1693.954] -- 0:01:18
Average standard deviation of split frequencies: 0.008361
690500 -- (-1696.845) [-1696.916] (-1690.584) (-1696.192) * (-1703.168) [-1694.504] (-1693.478) (-1697.204) -- 0:01:17
691000 -- (-1701.964) (-1701.687) (-1694.254) [-1694.168] * (-1697.942) (-1704.603) [-1699.682] (-1700.393) -- 0:01:17
691500 -- (-1700.859) (-1698.414) [-1692.631] (-1696.424) * (-1690.740) (-1696.822) (-1693.671) [-1694.033] -- 0:01:17
692000 -- (-1697.891) (-1697.732) [-1701.169] (-1696.415) * (-1693.453) [-1696.240] (-1694.864) (-1699.786) -- 0:01:17
692500 -- [-1700.553] (-1692.183) (-1699.946) (-1693.169) * (-1705.842) [-1701.552] (-1692.615) (-1696.383) -- 0:01:17
693000 -- (-1694.602) (-1694.719) (-1699.717) [-1693.847] * [-1702.534] (-1702.394) (-1700.609) (-1698.366) -- 0:01:17
693500 -- [-1699.103] (-1700.608) (-1695.834) (-1694.826) * [-1697.732] (-1698.100) (-1697.668) (-1698.970) -- 0:01:17
694000 -- (-1709.832) (-1701.213) (-1693.346) [-1697.216] * (-1703.120) (-1703.957) (-1696.677) [-1693.081] -- 0:01:17
694500 -- [-1693.290] (-1697.441) (-1693.439) (-1701.374) * (-1699.019) [-1696.706] (-1702.026) (-1689.366) -- 0:01:16
695000 -- (-1697.134) (-1695.946) [-1694.976] (-1700.973) * (-1698.352) (-1700.161) (-1698.178) [-1695.955] -- 0:01:16
Average standard deviation of split frequencies: 0.008128
695500 -- (-1703.351) (-1699.333) [-1694.639] (-1699.035) * (-1697.302) (-1693.862) (-1698.515) [-1692.352] -- 0:01:16
696000 -- (-1705.420) (-1697.520) [-1690.018] (-1695.878) * [-1696.536] (-1695.381) (-1698.596) (-1699.972) -- 0:01:16
696500 -- [-1697.149] (-1697.198) (-1690.962) (-1699.379) * [-1695.628] (-1699.433) (-1699.165) (-1697.120) -- 0:01:16
697000 -- (-1700.200) [-1696.213] (-1695.665) (-1700.529) * [-1691.801] (-1700.984) (-1699.786) (-1698.120) -- 0:01:16
697500 -- (-1695.087) [-1693.771] (-1696.577) (-1700.617) * (-1693.923) (-1705.970) [-1693.589] (-1691.580) -- 0:01:16
698000 -- [-1693.359] (-1696.357) (-1697.080) (-1691.385) * [-1694.546] (-1704.773) (-1697.454) (-1701.754) -- 0:01:16
698500 -- (-1705.306) (-1695.932) (-1697.276) [-1704.558] * (-1697.075) [-1693.994] (-1698.070) (-1698.870) -- 0:01:15
699000 -- (-1697.163) (-1693.449) [-1693.472] (-1699.567) * (-1698.742) (-1699.799) (-1701.221) [-1697.330] -- 0:01:15
699500 -- (-1699.865) [-1692.695] (-1695.946) (-1700.573) * (-1699.610) (-1701.879) [-1697.719] (-1696.760) -- 0:01:15
700000 -- (-1694.387) (-1699.840) [-1698.551] (-1698.159) * [-1698.611] (-1700.387) (-1694.499) (-1697.303) -- 0:01:15
Average standard deviation of split frequencies: 0.007905
700500 -- (-1694.620) [-1694.257] (-1694.089) (-1695.524) * (-1702.816) (-1700.609) [-1692.462] (-1700.585) -- 0:01:15
701000 -- (-1695.789) (-1693.937) [-1698.241] (-1701.563) * (-1703.931) (-1689.257) (-1691.898) [-1697.660] -- 0:01:15
701500 -- (-1694.501) [-1697.982] (-1695.498) (-1699.762) * (-1702.762) [-1702.266] (-1694.553) (-1706.054) -- 0:01:15
702000 -- (-1694.974) (-1698.550) (-1695.144) [-1701.374] * [-1696.296] (-1708.283) (-1697.572) (-1695.304) -- 0:01:15
702500 -- [-1696.521] (-1697.484) (-1702.052) (-1697.387) * [-1689.926] (-1706.568) (-1694.552) (-1699.604) -- 0:01:14
703000 -- (-1694.242) (-1692.644) (-1708.426) [-1702.733] * [-1695.038] (-1692.532) (-1697.181) (-1698.916) -- 0:01:14
703500 -- (-1696.666) (-1698.924) (-1701.400) [-1696.043] * (-1698.283) (-1699.748) (-1698.347) [-1698.443] -- 0:01:14
704000 -- (-1698.084) (-1693.359) (-1701.460) [-1701.770] * [-1699.105] (-1701.074) (-1694.475) (-1698.710) -- 0:01:14
704500 -- (-1705.225) [-1694.909] (-1696.723) (-1699.652) * (-1698.555) [-1693.187] (-1705.238) (-1710.737) -- 0:01:14
705000 -- (-1703.149) (-1704.678) [-1703.277] (-1698.624) * (-1708.619) (-1696.892) (-1714.606) [-1696.653] -- 0:01:14
Average standard deviation of split frequencies: 0.006510
705500 -- (-1703.112) (-1701.128) (-1706.951) [-1696.811] * (-1704.356) [-1692.654] (-1697.358) (-1692.111) -- 0:01:14
706000 -- (-1698.330) [-1702.471] (-1698.736) (-1694.910) * (-1702.291) (-1696.805) (-1701.109) [-1695.191] -- 0:01:14
706500 -- (-1693.278) (-1694.482) [-1691.594] (-1694.589) * (-1703.246) [-1694.410] (-1697.212) (-1697.332) -- 0:01:13
707000 -- [-1696.176] (-1693.435) (-1702.501) (-1693.520) * (-1707.638) (-1693.398) (-1693.729) [-1700.194] -- 0:01:13
707500 -- (-1699.677) [-1695.755] (-1695.651) (-1693.521) * (-1699.086) (-1696.046) [-1698.616] (-1696.557) -- 0:01:13
708000 -- [-1693.575] (-1702.811) (-1695.180) (-1693.086) * [-1696.774] (-1699.691) (-1695.383) (-1698.634) -- 0:01:13
708500 -- (-1692.943) (-1700.165) [-1694.348] (-1694.129) * (-1699.856) [-1694.051] (-1697.779) (-1698.164) -- 0:01:13
709000 -- (-1699.076) (-1692.873) [-1693.980] (-1698.885) * (-1694.313) (-1697.924) [-1702.354] (-1697.258) -- 0:01:13
709500 -- (-1694.159) [-1692.796] (-1695.100) (-1701.001) * [-1693.456] (-1698.542) (-1690.965) (-1699.664) -- 0:01:13
710000 -- (-1694.254) [-1694.199] (-1694.613) (-1696.375) * [-1695.992] (-1705.545) (-1698.084) (-1700.058) -- 0:01:13
Average standard deviation of split frequencies: 0.006965
710500 -- (-1691.447) (-1701.823) (-1692.634) [-1691.589] * (-1696.451) [-1697.978] (-1695.868) (-1694.119) -- 0:01:12
711000 -- (-1699.882) (-1696.221) [-1700.449] (-1693.778) * (-1704.497) [-1700.743] (-1693.579) (-1694.271) -- 0:01:12
711500 -- (-1701.326) (-1698.856) (-1697.866) [-1698.247] * (-1702.074) [-1695.480] (-1696.037) (-1696.586) -- 0:01:12
712000 -- (-1709.554) (-1699.047) (-1706.840) [-1699.042] * (-1695.903) (-1699.417) [-1694.274] (-1694.663) -- 0:01:12
712500 -- (-1697.539) (-1704.213) (-1694.249) [-1695.508] * (-1699.335) (-1693.806) (-1696.795) [-1696.233] -- 0:01:12
713000 -- (-1693.263) (-1697.489) [-1691.961] (-1699.549) * (-1692.810) (-1702.314) (-1699.353) [-1694.326] -- 0:01:12
713500 -- [-1695.501] (-1695.432) (-1701.114) (-1689.553) * (-1706.504) [-1696.364] (-1695.981) (-1696.436) -- 0:01:12
714000 -- (-1696.164) [-1696.416] (-1699.239) (-1691.239) * (-1698.350) [-1692.928] (-1698.487) (-1696.463) -- 0:01:12
714500 -- (-1706.047) (-1700.133) [-1697.596] (-1689.627) * (-1696.212) (-1705.079) [-1693.645] (-1700.785) -- 0:01:11
715000 -- (-1695.937) (-1699.320) (-1698.034) [-1694.150] * (-1695.013) [-1698.135] (-1701.215) (-1700.812) -- 0:01:11
Average standard deviation of split frequencies: 0.007078
715500 -- (-1691.574) (-1702.187) (-1693.851) [-1694.218] * (-1700.501) (-1701.256) [-1694.731] (-1697.976) -- 0:01:11
716000 -- (-1696.364) (-1703.628) (-1703.830) [-1701.737] * (-1696.571) (-1694.036) (-1692.695) [-1700.769] -- 0:01:11
716500 -- (-1693.818) (-1702.065) (-1694.841) [-1694.195] * (-1693.714) [-1695.580] (-1698.959) (-1697.389) -- 0:01:11
717000 -- (-1692.376) [-1696.624] (-1698.611) (-1695.350) * (-1699.729) (-1694.233) (-1698.222) [-1697.790] -- 0:01:11
717500 -- (-1696.808) (-1699.336) [-1696.526] (-1694.605) * [-1695.141] (-1692.756) (-1696.878) (-1693.853) -- 0:01:11
718000 -- [-1692.106] (-1696.687) (-1696.943) (-1694.374) * [-1694.730] (-1689.364) (-1693.437) (-1695.313) -- 0:01:11
718500 -- (-1694.232) (-1692.242) [-1697.770] (-1699.222) * [-1695.518] (-1691.682) (-1698.193) (-1698.052) -- 0:01:10
719000 -- (-1698.784) (-1696.341) [-1695.299] (-1701.086) * [-1693.691] (-1700.186) (-1692.411) (-1703.075) -- 0:01:10
719500 -- [-1694.318] (-1696.602) (-1701.164) (-1698.542) * (-1692.093) (-1697.292) (-1693.326) [-1693.362] -- 0:01:10
720000 -- (-1690.287) (-1699.402) [-1696.135] (-1699.039) * [-1695.255] (-1700.590) (-1694.941) (-1708.549) -- 0:01:10
Average standard deviation of split frequencies: 0.006541
720500 -- (-1698.747) (-1693.957) (-1692.274) [-1702.477] * (-1695.285) (-1701.042) [-1691.868] (-1695.516) -- 0:01:10
721000 -- (-1692.609) (-1699.191) [-1698.256] (-1702.699) * [-1697.445] (-1707.277) (-1701.388) (-1690.907) -- 0:01:10
721500 -- [-1696.849] (-1702.191) (-1702.034) (-1696.927) * (-1697.940) (-1694.126) (-1699.014) [-1689.972] -- 0:01:10
722000 -- (-1694.058) (-1702.061) (-1695.586) [-1695.761] * (-1692.904) (-1689.726) [-1696.554] (-1699.840) -- 0:01:10
722500 -- (-1695.176) (-1700.681) [-1697.527] (-1704.722) * (-1700.404) (-1694.486) [-1692.054] (-1704.235) -- 0:01:09
723000 -- (-1699.133) [-1697.087] (-1693.780) (-1701.233) * (-1701.644) (-1692.394) [-1695.846] (-1695.681) -- 0:01:09
723500 -- [-1696.312] (-1699.585) (-1696.889) (-1700.148) * (-1697.594) [-1694.217] (-1695.292) (-1704.477) -- 0:01:09
724000 -- (-1696.126) (-1695.109) (-1700.969) [-1699.951] * (-1692.185) (-1695.674) (-1695.524) [-1692.973] -- 0:01:09
724500 -- (-1695.333) [-1697.266] (-1690.404) (-1700.517) * (-1697.899) [-1696.192] (-1698.842) (-1698.217) -- 0:01:09
725000 -- [-1697.139] (-1698.510) (-1693.206) (-1698.289) * (-1699.859) (-1700.427) [-1696.144] (-1699.227) -- 0:01:09
Average standard deviation of split frequencies: 0.006006
725500 -- (-1697.022) (-1691.647) [-1694.007] (-1696.818) * (-1697.253) (-1701.633) [-1691.445] (-1699.466) -- 0:01:09
726000 -- (-1694.390) (-1694.749) [-1699.465] (-1692.754) * (-1694.637) [-1695.371] (-1702.307) (-1698.095) -- 0:01:09
726500 -- (-1693.614) (-1696.800) (-1695.061) [-1690.320] * (-1694.844) (-1691.280) (-1703.918) [-1696.545] -- 0:01:08
727000 -- (-1696.202) (-1699.479) (-1697.326) [-1694.927] * (-1705.196) (-1694.603) [-1696.884] (-1695.116) -- 0:01:08
727500 -- [-1694.625] (-1702.610) (-1703.357) (-1698.676) * (-1697.805) (-1696.285) (-1696.206) [-1696.018] -- 0:01:08
728000 -- [-1696.511] (-1712.314) (-1701.709) (-1698.208) * [-1697.276] (-1698.621) (-1700.999) (-1697.327) -- 0:01:08
728500 -- (-1697.777) (-1696.307) (-1697.871) [-1691.804] * (-1695.036) [-1703.737] (-1698.422) (-1702.934) -- 0:01:08
729000 -- (-1699.345) [-1697.809] (-1705.323) (-1699.178) * [-1699.020] (-1699.510) (-1694.538) (-1691.619) -- 0:01:08
729500 -- (-1700.042) (-1700.685) (-1697.949) [-1694.743] * (-1694.718) [-1693.401] (-1697.767) (-1695.092) -- 0:01:08
730000 -- (-1702.818) (-1699.599) [-1696.810] (-1709.001) * (-1692.257) (-1702.854) (-1697.352) [-1701.566] -- 0:01:08
Average standard deviation of split frequencies: 0.005484
730500 -- (-1704.453) (-1697.024) (-1694.171) [-1695.513] * (-1704.604) [-1695.350] (-1705.339) (-1699.883) -- 0:01:07
731000 -- [-1691.164] (-1696.498) (-1692.983) (-1699.002) * (-1701.826) [-1696.075] (-1696.769) (-1695.673) -- 0:01:07
731500 -- (-1692.072) (-1694.276) [-1693.847] (-1697.659) * [-1697.051] (-1701.080) (-1702.234) (-1693.990) -- 0:01:07
732000 -- [-1696.629] (-1696.275) (-1696.935) (-1693.649) * [-1696.776] (-1700.666) (-1699.433) (-1699.133) -- 0:01:07
732500 -- (-1700.660) [-1696.385] (-1695.661) (-1697.867) * (-1697.761) (-1697.956) (-1696.954) [-1697.058] -- 0:01:07
733000 -- [-1694.338] (-1692.162) (-1695.287) (-1695.735) * (-1694.306) (-1692.699) (-1692.280) [-1695.829] -- 0:01:07
733500 -- (-1690.917) (-1698.482) [-1695.599] (-1699.856) * (-1693.083) (-1701.667) [-1699.165] (-1698.732) -- 0:01:07
734000 -- [-1696.638] (-1705.394) (-1699.848) (-1694.441) * (-1694.570) (-1704.311) [-1696.649] (-1696.332) -- 0:01:07
734500 -- (-1697.643) (-1699.001) [-1696.308] (-1700.003) * (-1700.828) (-1698.872) (-1700.803) [-1695.316] -- 0:01:06
735000 -- [-1697.869] (-1698.810) (-1701.117) (-1703.652) * (-1697.704) (-1703.574) (-1703.687) [-1694.957] -- 0:01:06
Average standard deviation of split frequencies: 0.005444
735500 -- (-1698.367) (-1697.876) (-1700.508) [-1701.609] * (-1696.178) (-1694.254) [-1697.792] (-1705.987) -- 0:01:06
736000 -- (-1702.523) (-1691.043) (-1700.751) [-1693.109] * (-1700.871) (-1696.935) (-1698.608) [-1692.901] -- 0:01:06
736500 -- (-1693.898) (-1696.653) (-1697.330) [-1701.035] * (-1698.240) (-1702.288) [-1697.008] (-1698.928) -- 0:01:06
737000 -- (-1695.517) (-1697.845) (-1695.953) [-1696.385] * [-1693.718] (-1700.757) (-1698.206) (-1702.085) -- 0:01:06
737500 -- (-1695.111) [-1696.930] (-1697.879) (-1700.445) * (-1690.854) (-1692.560) [-1692.747] (-1696.605) -- 0:01:06
738000 -- [-1694.586] (-1713.143) (-1695.619) (-1693.306) * (-1697.489) [-1697.421] (-1698.473) (-1696.903) -- 0:01:06
738500 -- (-1706.912) (-1697.686) [-1696.320] (-1694.155) * (-1697.438) (-1700.029) (-1694.289) [-1692.404] -- 0:01:05
739000 -- (-1708.340) [-1692.058] (-1698.122) (-1695.698) * (-1696.093) (-1698.998) (-1694.417) [-1698.357] -- 0:01:05
739500 -- (-1697.686) (-1695.687) (-1693.359) [-1700.132] * (-1697.181) (-1701.126) [-1704.840] (-1701.704) -- 0:01:05
740000 -- (-1702.678) (-1696.783) (-1699.148) [-1692.094] * [-1695.612] (-1694.628) (-1699.548) (-1702.190) -- 0:01:05
Average standard deviation of split frequencies: 0.005887
740500 -- (-1698.504) (-1697.832) [-1694.807] (-1692.612) * (-1696.823) (-1693.369) [-1695.945] (-1701.134) -- 0:01:05
741000 -- (-1696.838) (-1698.572) [-1693.259] (-1695.055) * [-1694.497] (-1696.770) (-1700.392) (-1692.636) -- 0:01:05
741500 -- [-1697.887] (-1708.349) (-1702.824) (-1693.519) * (-1694.548) (-1694.487) [-1695.678] (-1695.127) -- 0:01:05
742000 -- (-1703.996) (-1706.864) [-1692.850] (-1702.551) * [-1696.207] (-1698.346) (-1702.761) (-1696.010) -- 0:01:05
742500 -- [-1697.223] (-1699.150) (-1709.475) (-1692.106) * [-1694.954] (-1697.494) (-1700.648) (-1699.138) -- 0:01:04
743000 -- (-1697.850) (-1698.914) (-1703.765) [-1695.847] * [-1693.983] (-1695.992) (-1695.448) (-1696.120) -- 0:01:04
743500 -- (-1697.510) (-1705.406) [-1697.108] (-1699.178) * (-1697.821) (-1697.596) (-1692.860) [-1695.433] -- 0:01:04
744000 -- (-1696.192) (-1696.851) (-1695.357) [-1695.885] * (-1702.393) (-1696.099) [-1692.257] (-1693.278) -- 0:01:04
744500 -- (-1692.778) (-1704.744) (-1698.517) [-1694.622] * (-1711.103) (-1697.866) [-1695.282] (-1695.133) -- 0:01:04
745000 -- (-1703.316) (-1697.023) [-1695.186] (-1692.839) * (-1697.323) (-1700.197) [-1699.238] (-1694.659) -- 0:01:04
Average standard deviation of split frequencies: 0.005371
745500 -- (-1701.941) (-1713.119) (-1692.187) [-1695.912] * [-1699.521] (-1695.818) (-1698.422) (-1691.852) -- 0:01:04
746000 -- (-1695.717) (-1694.094) (-1698.953) [-1696.323] * (-1695.785) (-1694.951) (-1692.797) [-1696.203] -- 0:01:04
746500 -- [-1695.142] (-1695.713) (-1692.556) (-1692.489) * (-1692.345) [-1696.390] (-1696.291) (-1692.584) -- 0:01:03
747000 -- (-1697.315) (-1694.404) (-1696.497) [-1694.697] * (-1695.929) (-1703.713) (-1692.920) [-1693.952] -- 0:01:03
747500 -- (-1698.375) [-1692.473] (-1696.186) (-1696.716) * (-1697.985) (-1701.294) [-1692.857] (-1693.492) -- 0:01:03
748000 -- (-1698.647) (-1694.050) (-1695.176) [-1698.304] * (-1694.041) (-1697.599) [-1695.344] (-1710.513) -- 0:01:03
748500 -- (-1695.111) (-1695.471) (-1691.062) [-1693.531] * [-1696.608] (-1696.229) (-1699.675) (-1705.126) -- 0:01:03
749000 -- (-1695.322) (-1692.192) [-1697.775] (-1692.977) * (-1703.610) (-1699.500) (-1703.773) [-1693.436] -- 0:01:03
749500 -- (-1696.845) (-1693.719) (-1697.165) [-1695.754] * (-1693.759) (-1703.183) (-1702.806) [-1696.594] -- 0:01:03
750000 -- (-1696.895) [-1698.238] (-1700.922) (-1698.271) * (-1701.252) (-1696.922) [-1695.609] (-1699.742) -- 0:01:03
Average standard deviation of split frequencies: 0.005181
750500 -- (-1694.330) (-1697.161) (-1699.054) [-1696.938] * (-1703.325) [-1703.961] (-1697.054) (-1696.744) -- 0:01:02
751000 -- [-1699.518] (-1700.580) (-1696.336) (-1696.140) * (-1696.206) [-1700.032] (-1695.032) (-1699.773) -- 0:01:02
751500 -- (-1700.178) (-1701.514) (-1690.456) [-1701.040] * (-1701.269) (-1697.118) [-1696.102] (-1696.080) -- 0:01:02
752000 -- (-1694.917) [-1696.519] (-1700.498) (-1691.473) * (-1698.870) (-1703.723) [-1695.773] (-1698.339) -- 0:01:02
752500 -- (-1697.687) [-1694.066] (-1702.348) (-1705.810) * (-1695.268) (-1701.219) [-1696.559] (-1705.586) -- 0:01:02
753000 -- (-1697.352) (-1693.486) [-1693.834] (-1701.262) * (-1707.229) [-1695.965] (-1695.188) (-1698.981) -- 0:01:02
753500 -- [-1696.024] (-1700.832) (-1693.633) (-1699.885) * [-1694.813] (-1702.565) (-1697.202) (-1702.106) -- 0:01:02
754000 -- [-1697.202] (-1694.899) (-1696.167) (-1700.807) * (-1701.875) (-1697.794) (-1697.716) [-1695.287] -- 0:01:01
754500 -- (-1701.317) [-1694.875] (-1695.227) (-1695.278) * (-1703.809) [-1699.447] (-1700.537) (-1695.450) -- 0:01:01
755000 -- (-1710.534) (-1694.886) [-1692.550] (-1697.295) * [-1700.306] (-1700.341) (-1699.115) (-1693.637) -- 0:01:01
Average standard deviation of split frequencies: 0.004833
755500 -- (-1703.823) [-1696.783] (-1698.666) (-1700.906) * (-1694.108) [-1697.158] (-1702.945) (-1697.858) -- 0:01:01
756000 -- (-1701.467) (-1700.014) [-1693.866] (-1704.696) * (-1696.224) [-1695.175] (-1701.943) (-1701.297) -- 0:01:01
756500 -- (-1697.321) (-1695.478) (-1694.106) [-1691.275] * (-1700.279) (-1690.714) (-1700.120) [-1697.654] -- 0:01:01
757000 -- (-1705.504) (-1701.169) (-1692.068) [-1693.161] * [-1695.818] (-1692.563) (-1700.326) (-1700.291) -- 0:01:01
757500 -- (-1698.056) (-1702.283) (-1695.186) [-1695.108] * (-1695.049) (-1691.776) [-1694.277] (-1698.460) -- 0:01:01
758000 -- [-1696.717] (-1705.595) (-1699.425) (-1699.380) * (-1697.572) [-1695.191] (-1694.065) (-1700.641) -- 0:01:00
758500 -- [-1697.241] (-1700.084) (-1694.851) (-1696.726) * (-1692.832) (-1692.176) [-1695.025] (-1694.634) -- 0:01:00
759000 -- [-1696.496] (-1700.043) (-1702.745) (-1701.343) * (-1699.247) (-1700.738) (-1691.741) [-1694.974] -- 0:01:00
759500 -- (-1694.215) [-1698.186] (-1692.216) (-1709.369) * (-1697.802) (-1702.168) [-1691.401] (-1695.111) -- 0:01:00
760000 -- [-1693.996] (-1694.332) (-1697.816) (-1702.900) * (-1696.282) (-1702.434) [-1698.614] (-1708.095) -- 0:01:00
Average standard deviation of split frequencies: 0.005113
760500 -- (-1694.147) [-1697.379] (-1700.837) (-1701.992) * (-1702.804) (-1696.494) (-1695.290) [-1695.039] -- 0:01:00
761000 -- (-1699.512) (-1697.451) (-1695.103) [-1694.445] * (-1697.577) (-1695.622) [-1704.603] (-1701.889) -- 0:01:00
761500 -- (-1698.313) [-1699.893] (-1694.653) (-1697.966) * (-1697.512) (-1699.793) (-1697.861) [-1695.699] -- 0:01:00
762000 -- (-1703.948) (-1699.500) (-1695.549) [-1694.119] * [-1696.166] (-1693.421) (-1700.008) (-1697.466) -- 0:00:59
762500 -- (-1702.002) (-1696.686) (-1692.942) [-1697.355] * [-1693.812] (-1691.480) (-1697.240) (-1698.318) -- 0:00:59
763000 -- [-1704.554] (-1693.794) (-1694.729) (-1701.527) * [-1694.885] (-1696.584) (-1701.081) (-1702.182) -- 0:00:59
763500 -- [-1696.017] (-1701.952) (-1694.648) (-1692.537) * (-1703.455) (-1692.745) (-1694.655) [-1699.722] -- 0:00:59
764000 -- (-1693.620) (-1696.651) [-1694.610] (-1697.496) * (-1696.908) [-1695.491] (-1696.131) (-1695.067) -- 0:00:59
764500 -- (-1692.007) [-1694.788] (-1695.316) (-1705.092) * (-1697.385) (-1700.689) (-1700.708) [-1696.072] -- 0:00:59
765000 -- [-1695.662] (-1697.634) (-1694.128) (-1692.639) * (-1693.094) [-1697.102] (-1696.309) (-1693.558) -- 0:00:59
Average standard deviation of split frequencies: 0.004769
765500 -- [-1700.198] (-1697.260) (-1697.622) (-1692.537) * [-1697.974] (-1696.117) (-1697.375) (-1696.991) -- 0:00:59
766000 -- (-1708.901) (-1694.693) [-1699.732] (-1694.659) * (-1697.681) [-1695.413] (-1695.088) (-1701.389) -- 0:00:58
766500 -- (-1696.776) (-1697.088) [-1692.816] (-1700.253) * (-1702.858) [-1690.126] (-1691.336) (-1698.748) -- 0:00:58
767000 -- (-1697.400) (-1698.086) (-1697.039) [-1692.463] * [-1696.720] (-1699.404) (-1700.293) (-1698.033) -- 0:00:58
767500 -- (-1700.520) (-1698.694) (-1694.741) [-1691.545] * (-1696.195) [-1698.403] (-1696.062) (-1696.911) -- 0:00:58
768000 -- (-1697.938) (-1695.994) (-1696.295) [-1696.653] * [-1700.009] (-1694.221) (-1692.394) (-1699.250) -- 0:00:58
768500 -- [-1693.028] (-1703.743) (-1700.987) (-1698.475) * (-1694.981) (-1696.090) (-1698.964) [-1698.175] -- 0:00:58
769000 -- (-1693.429) (-1697.506) [-1695.719] (-1693.267) * [-1696.325] (-1699.636) (-1695.307) (-1695.938) -- 0:00:58
769500 -- (-1701.218) [-1695.607] (-1695.310) (-1689.594) * (-1698.455) (-1700.064) [-1699.248] (-1701.840) -- 0:00:58
770000 -- (-1698.049) [-1693.249] (-1699.555) (-1697.564) * [-1698.858] (-1703.309) (-1695.898) (-1696.616) -- 0:00:57
Average standard deviation of split frequencies: 0.005964
770500 -- [-1694.788] (-1690.996) (-1693.818) (-1696.148) * [-1693.957] (-1694.485) (-1697.114) (-1700.174) -- 0:00:57
771000 -- (-1695.517) (-1692.668) (-1695.666) [-1693.870] * [-1694.877] (-1696.243) (-1695.096) (-1694.321) -- 0:00:57
771500 -- [-1698.435] (-1696.281) (-1696.577) (-1697.634) * [-1699.992] (-1699.034) (-1694.034) (-1692.060) -- 0:00:57
772000 -- (-1697.889) (-1695.717) (-1695.877) [-1694.538] * (-1696.526) (-1699.015) (-1694.550) [-1697.535] -- 0:00:57
772500 -- (-1697.097) (-1693.512) (-1693.547) [-1697.741] * [-1695.997] (-1694.825) (-1700.495) (-1697.136) -- 0:00:57
773000 -- (-1697.041) [-1693.871] (-1694.205) (-1703.022) * (-1702.139) [-1694.293] (-1705.214) (-1694.516) -- 0:00:57
773500 -- [-1695.135] (-1691.043) (-1692.929) (-1701.800) * [-1699.791] (-1697.686) (-1693.758) (-1701.107) -- 0:00:57
774000 -- (-1697.333) [-1695.834] (-1701.657) (-1696.802) * (-1692.660) (-1701.922) [-1695.985] (-1702.761) -- 0:00:56
774500 -- (-1695.578) (-1689.475) [-1689.357] (-1697.186) * (-1694.038) (-1699.143) [-1700.500] (-1698.339) -- 0:00:56
775000 -- (-1693.685) [-1692.876] (-1695.940) (-1696.825) * (-1695.252) (-1699.305) (-1693.786) [-1695.871] -- 0:00:56
Average standard deviation of split frequencies: 0.006682
775500 -- (-1696.109) (-1696.453) (-1693.358) [-1694.738] * (-1699.478) (-1699.600) [-1699.253] (-1696.151) -- 0:00:56
776000 -- (-1694.839) (-1707.468) [-1693.272] (-1698.085) * (-1691.399) [-1694.738] (-1702.957) (-1699.629) -- 0:00:56
776500 -- (-1697.905) (-1700.051) [-1697.052] (-1695.310) * [-1691.501] (-1696.560) (-1701.411) (-1699.653) -- 0:00:56
777000 -- (-1701.935) [-1695.397] (-1694.868) (-1699.509) * [-1690.626] (-1695.310) (-1698.250) (-1696.288) -- 0:00:56
777500 -- (-1693.875) (-1694.635) [-1691.679] (-1697.104) * (-1692.959) (-1694.755) [-1697.028] (-1702.449) -- 0:00:56
778000 -- (-1702.639) [-1693.412] (-1698.538) (-1695.772) * [-1693.365] (-1696.704) (-1702.596) (-1692.617) -- 0:00:55
778500 -- (-1704.564) (-1690.734) (-1699.732) [-1688.844] * (-1700.041) [-1694.460] (-1697.041) (-1700.651) -- 0:00:55
779000 -- (-1695.774) (-1694.816) [-1693.427] (-1696.999) * [-1702.367] (-1696.432) (-1697.078) (-1694.387) -- 0:00:55
779500 -- [-1694.588] (-1696.339) (-1701.097) (-1692.495) * (-1704.048) [-1699.677] (-1696.830) (-1698.890) -- 0:00:55
780000 -- (-1701.183) (-1693.853) [-1697.535] (-1703.798) * (-1704.306) (-1693.906) [-1695.534] (-1698.259) -- 0:00:55
Average standard deviation of split frequencies: 0.005737
780500 -- (-1698.605) (-1697.810) (-1700.674) [-1691.235] * (-1699.796) (-1694.673) [-1694.851] (-1696.079) -- 0:00:55
781000 -- (-1689.947) (-1699.833) (-1701.151) [-1695.511] * (-1693.870) (-1693.736) [-1696.973] (-1695.764) -- 0:00:55
781500 -- (-1694.544) [-1693.526] (-1697.327) (-1693.388) * (-1691.302) (-1694.968) [-1696.940] (-1697.297) -- 0:00:55
782000 -- (-1696.624) [-1694.134] (-1700.226) (-1697.687) * (-1698.403) (-1699.683) (-1690.914) [-1691.963] -- 0:00:54
782500 -- [-1699.282] (-1696.972) (-1696.428) (-1694.331) * (-1697.615) (-1701.891) (-1696.819) [-1695.352] -- 0:00:54
783000 -- (-1702.253) [-1692.180] (-1695.875) (-1692.568) * (-1696.490) (-1694.404) (-1699.350) [-1698.074] -- 0:00:54
783500 -- (-1694.028) [-1693.734] (-1692.664) (-1695.551) * [-1691.096] (-1698.246) (-1701.507) (-1693.425) -- 0:00:54
784000 -- (-1703.737) (-1692.576) (-1696.302) [-1692.395] * (-1699.177) [-1694.397] (-1697.911) (-1702.329) -- 0:00:54
784500 -- (-1695.224) (-1693.137) (-1693.678) [-1697.029] * (-1702.589) (-1693.605) (-1698.825) [-1699.418] -- 0:00:54
785000 -- [-1695.972] (-1697.410) (-1701.172) (-1693.803) * (-1697.734) [-1698.494] (-1706.173) (-1698.338) -- 0:00:54
Average standard deviation of split frequencies: 0.005548
785500 -- (-1704.317) (-1691.938) (-1700.692) [-1690.426] * (-1690.387) [-1695.396] (-1703.730) (-1702.605) -- 0:00:54
786000 -- (-1695.101) [-1694.822] (-1697.512) (-1699.151) * (-1696.036) [-1696.360] (-1699.737) (-1695.991) -- 0:00:53
786500 -- (-1695.800) (-1702.813) [-1692.832] (-1698.332) * (-1691.325) (-1696.442) (-1698.927) [-1693.713] -- 0:00:53
787000 -- (-1701.307) (-1694.110) [-1697.139] (-1694.811) * (-1696.512) (-1696.613) [-1694.368] (-1693.939) -- 0:00:53
787500 -- [-1696.644] (-1692.299) (-1702.292) (-1698.175) * [-1694.545] (-1696.153) (-1692.108) (-1696.673) -- 0:00:53
788000 -- (-1695.221) [-1689.797] (-1704.283) (-1701.583) * (-1701.190) (-1698.052) (-1692.877) [-1689.821] -- 0:00:53
788500 -- (-1699.428) [-1697.173] (-1696.942) (-1702.100) * (-1694.992) (-1695.061) [-1692.482] (-1693.795) -- 0:00:53
789000 -- (-1698.501) [-1698.476] (-1703.660) (-1703.259) * (-1696.953) [-1696.510] (-1698.616) (-1700.524) -- 0:00:53
789500 -- (-1698.308) [-1697.146] (-1704.276) (-1697.647) * [-1690.286] (-1695.874) (-1693.318) (-1696.815) -- 0:00:53
790000 -- (-1694.515) (-1698.082) (-1701.842) [-1695.844] * [-1700.218] (-1691.946) (-1703.653) (-1701.252) -- 0:00:52
Average standard deviation of split frequencies: 0.005217
790500 -- (-1701.269) (-1701.731) [-1697.629] (-1700.049) * (-1701.106) [-1708.687] (-1693.959) (-1703.995) -- 0:00:53
791000 -- (-1691.245) [-1696.148] (-1696.213) (-1693.316) * [-1692.436] (-1696.705) (-1699.172) (-1698.538) -- 0:00:52
791500 -- [-1694.526] (-1692.361) (-1698.116) (-1690.265) * (-1696.050) (-1696.575) [-1700.092] (-1697.402) -- 0:00:52
792000 -- (-1700.368) [-1697.341] (-1698.508) (-1692.591) * [-1698.285] (-1693.026) (-1694.436) (-1691.685) -- 0:00:52
792500 -- (-1695.814) (-1691.525) (-1699.688) [-1690.787] * (-1696.857) (-1691.372) [-1692.424] (-1704.587) -- 0:00:52
793000 -- (-1703.224) (-1706.137) (-1695.809) [-1692.204] * [-1693.851] (-1691.595) (-1700.014) (-1698.847) -- 0:00:52
793500 -- (-1698.923) [-1695.120] (-1695.344) (-1690.122) * [-1694.499] (-1692.561) (-1705.001) (-1691.727) -- 0:00:52
794000 -- (-1703.243) [-1694.336] (-1699.436) (-1704.969) * (-1697.044) [-1700.151] (-1700.950) (-1694.503) -- 0:00:51
794500 -- (-1693.851) (-1703.425) [-1701.544] (-1697.876) * (-1696.633) (-1694.928) [-1698.109] (-1705.489) -- 0:00:51
795000 -- (-1693.299) (-1702.605) [-1696.257] (-1693.223) * (-1694.527) (-1696.785) [-1701.514] (-1699.955) -- 0:00:51
Average standard deviation of split frequencies: 0.004442
795500 -- (-1691.573) [-1693.756] (-1697.897) (-1701.466) * (-1700.847) (-1696.088) (-1699.086) [-1697.644] -- 0:00:51
796000 -- (-1693.875) (-1692.964) (-1695.354) [-1693.746] * (-1697.087) (-1701.414) [-1701.141] (-1694.964) -- 0:00:51
796500 -- (-1695.833) (-1693.632) [-1693.853] (-1696.637) * (-1700.070) (-1705.142) (-1701.766) [-1690.781] -- 0:00:51
797000 -- (-1701.248) [-1693.517] (-1694.653) (-1699.876) * (-1699.676) [-1699.846] (-1694.244) (-1695.618) -- 0:00:51
797500 -- (-1700.646) [-1697.992] (-1708.304) (-1690.330) * (-1693.417) (-1702.882) (-1698.553) [-1698.794] -- 0:00:51
798000 -- (-1699.270) (-1705.041) [-1694.190] (-1695.188) * (-1698.410) [-1696.896] (-1696.729) (-1697.776) -- 0:00:50
798500 -- (-1699.394) (-1701.003) (-1695.736) [-1693.926] * (-1705.337) [-1694.865] (-1700.259) (-1702.259) -- 0:00:50
799000 -- [-1700.704] (-1703.858) (-1692.669) (-1698.907) * [-1691.509] (-1692.419) (-1699.848) (-1699.645) -- 0:00:50
799500 -- (-1695.750) (-1700.405) [-1691.668] (-1702.683) * (-1699.158) (-1693.556) [-1696.023] (-1695.181) -- 0:00:50
800000 -- (-1697.091) (-1698.096) [-1692.501] (-1699.312) * (-1695.584) (-1696.906) (-1698.756) [-1694.715] -- 0:00:50
Average standard deviation of split frequencies: 0.005005
800500 -- (-1697.426) (-1700.685) (-1698.457) [-1692.141] * (-1695.717) [-1691.199] (-1692.338) (-1691.552) -- 0:00:50
801000 -- (-1701.641) [-1696.775] (-1698.773) (-1691.280) * (-1704.135) (-1695.751) (-1703.487) [-1688.574] -- 0:00:50
801500 -- [-1695.400] (-1702.590) (-1692.419) (-1694.688) * (-1698.695) [-1697.359] (-1696.525) (-1698.236) -- 0:00:50
802000 -- [-1696.776] (-1693.193) (-1695.434) (-1699.537) * (-1696.664) (-1698.618) (-1699.191) [-1698.250] -- 0:00:49
802500 -- (-1703.341) (-1694.629) (-1699.031) [-1692.459] * (-1693.012) (-1703.668) [-1692.129] (-1696.875) -- 0:00:49
803000 -- (-1696.816) (-1700.656) [-1694.129] (-1696.344) * (-1700.991) (-1704.895) [-1694.615] (-1699.463) -- 0:00:49
803500 -- (-1705.530) (-1705.269) [-1695.618] (-1694.845) * (-1697.169) (-1700.367) [-1695.562] (-1695.844) -- 0:00:49
804000 -- (-1697.924) (-1703.055) (-1691.226) [-1697.308] * (-1692.964) (-1699.850) [-1692.641] (-1689.679) -- 0:00:49
804500 -- [-1690.558] (-1701.199) (-1697.753) (-1693.542) * [-1693.079] (-1697.272) (-1692.906) (-1694.610) -- 0:00:49
805000 -- (-1699.752) (-1697.991) (-1699.433) [-1697.825] * (-1696.334) (-1698.420) (-1700.130) [-1693.985] -- 0:00:49
Average standard deviation of split frequencies: 0.005702
805500 -- (-1698.283) [-1696.753] (-1692.557) (-1696.242) * (-1706.226) [-1697.494] (-1697.364) (-1696.808) -- 0:00:49
806000 -- (-1696.082) [-1697.238] (-1695.871) (-1697.350) * (-1698.340) (-1699.792) (-1706.773) [-1700.510] -- 0:00:48
806500 -- (-1698.222) (-1700.608) [-1689.685] (-1701.315) * (-1698.014) (-1699.118) [-1699.266] (-1704.496) -- 0:00:48
807000 -- (-1697.465) (-1695.928) (-1698.998) [-1695.003] * (-1705.977) (-1694.995) (-1708.574) [-1697.963] -- 0:00:48
807500 -- (-1699.410) (-1696.088) [-1694.380] (-1703.331) * (-1699.652) (-1694.152) (-1704.537) [-1693.162] -- 0:00:48
808000 -- (-1695.319) [-1695.900] (-1692.603) (-1700.087) * [-1702.694] (-1695.554) (-1699.934) (-1696.959) -- 0:00:48
808500 -- (-1697.089) (-1692.015) [-1694.935] (-1699.776) * [-1699.605] (-1699.821) (-1696.612) (-1715.510) -- 0:00:48
809000 -- (-1696.689) (-1698.981) (-1697.086) [-1693.792] * (-1697.274) [-1703.484] (-1696.403) (-1698.275) -- 0:00:48
809500 -- (-1698.309) [-1695.821] (-1700.812) (-1697.451) * (-1692.644) [-1696.657] (-1696.417) (-1703.903) -- 0:00:48
810000 -- (-1695.376) [-1700.871] (-1711.048) (-1692.806) * (-1699.574) (-1696.117) (-1695.672) [-1699.285] -- 0:00:48
Average standard deviation of split frequencies: 0.005088
810500 -- (-1696.619) (-1696.063) (-1698.486) [-1698.940] * [-1696.115] (-1695.676) (-1697.058) (-1699.433) -- 0:00:47
811000 -- (-1697.080) [-1698.045] (-1697.220) (-1711.468) * (-1698.245) [-1700.787] (-1697.550) (-1692.068) -- 0:00:47
811500 -- (-1696.358) (-1697.192) (-1699.481) [-1703.314] * [-1703.178] (-1698.482) (-1693.412) (-1694.932) -- 0:00:47
812000 -- [-1695.398] (-1693.799) (-1695.048) (-1695.556) * (-1691.577) [-1694.777] (-1697.037) (-1698.593) -- 0:00:47
812500 -- (-1694.961) (-1698.167) [-1694.134] (-1696.937) * (-1697.758) (-1697.631) [-1702.532] (-1691.064) -- 0:00:47
813000 -- [-1697.170] (-1697.925) (-1700.063) (-1695.732) * (-1702.967) [-1695.108] (-1698.858) (-1697.694) -- 0:00:47
813500 -- (-1705.685) (-1705.135) (-1699.738) [-1697.362] * (-1693.717) (-1698.308) (-1692.770) [-1700.224] -- 0:00:46
814000 -- [-1694.596] (-1694.665) (-1695.877) (-1701.275) * [-1695.446] (-1693.318) (-1693.814) (-1693.835) -- 0:00:47
814500 -- (-1703.903) (-1694.727) [-1696.310] (-1701.036) * (-1695.525) [-1697.756] (-1695.725) (-1701.058) -- 0:00:46
815000 -- (-1695.121) [-1699.734] (-1702.264) (-1694.362) * (-1701.560) (-1693.218) (-1697.451) [-1695.821] -- 0:00:46
Average standard deviation of split frequencies: 0.004766
815500 -- [-1695.469] (-1698.584) (-1700.452) (-1700.546) * (-1704.038) (-1699.083) (-1696.318) [-1696.103] -- 0:00:46
816000 -- [-1692.495] (-1703.274) (-1696.089) (-1693.397) * [-1694.660] (-1698.901) (-1693.295) (-1693.716) -- 0:00:46
816500 -- (-1693.440) (-1702.887) [-1700.746] (-1693.591) * (-1688.963) (-1697.177) [-1697.045] (-1692.654) -- 0:00:46
817000 -- (-1700.729) (-1707.403) [-1689.169] (-1693.398) * (-1695.423) (-1695.671) [-1700.044] (-1696.251) -- 0:00:46
817500 -- (-1693.242) (-1696.645) [-1697.619] (-1694.090) * (-1694.999) [-1693.884] (-1698.380) (-1701.834) -- 0:00:45
818000 -- (-1694.782) [-1695.858] (-1699.254) (-1696.135) * (-1695.005) [-1691.535] (-1698.954) (-1697.535) -- 0:00:46
818500 -- (-1701.684) (-1696.001) [-1701.535] (-1702.617) * (-1697.920) (-1699.436) [-1699.390] (-1689.933) -- 0:00:45
819000 -- [-1698.895] (-1699.099) (-1703.511) (-1706.058) * (-1697.088) (-1696.760) (-1703.538) [-1691.448] -- 0:00:45
819500 -- (-1698.360) (-1694.924) (-1706.074) [-1694.684] * (-1691.053) [-1696.138] (-1708.438) (-1696.035) -- 0:00:45
820000 -- (-1693.433) (-1699.052) (-1700.588) [-1689.705] * (-1699.922) (-1699.885) (-1702.217) [-1696.937] -- 0:00:45
Average standard deviation of split frequencies: 0.005313
820500 -- (-1706.473) [-1698.495] (-1698.054) (-1694.031) * [-1695.299] (-1694.380) (-1693.340) (-1698.220) -- 0:00:45
821000 -- [-1695.393] (-1696.345) (-1694.311) (-1697.002) * (-1696.328) (-1696.397) [-1699.021] (-1693.878) -- 0:00:45
821500 -- (-1693.267) (-1702.656) (-1709.066) [-1694.611] * (-1696.442) [-1699.402] (-1697.601) (-1702.295) -- 0:00:44
822000 -- (-1692.566) [-1695.440] (-1698.393) (-1694.970) * (-1699.546) [-1695.918] (-1699.370) (-1701.744) -- 0:00:45
822500 -- [-1696.020] (-1696.501) (-1696.043) (-1695.796) * (-1695.519) [-1694.183] (-1701.828) (-1701.487) -- 0:00:44
823000 -- (-1697.650) (-1695.373) (-1697.292) [-1692.376] * (-1696.636) (-1692.885) [-1695.358] (-1692.026) -- 0:00:44
823500 -- [-1700.105] (-1695.961) (-1707.161) (-1694.987) * (-1703.399) [-1693.115] (-1698.580) (-1695.363) -- 0:00:44
824000 -- [-1696.219] (-1699.171) (-1699.091) (-1704.947) * [-1697.881] (-1694.297) (-1693.887) (-1695.721) -- 0:00:44
824500 -- (-1691.723) [-1693.471] (-1698.720) (-1699.979) * (-1693.214) [-1691.240] (-1696.506) (-1696.702) -- 0:00:44
825000 -- [-1697.691] (-1701.075) (-1696.564) (-1698.802) * [-1700.002] (-1697.102) (-1702.781) (-1703.684) -- 0:00:44
Average standard deviation of split frequencies: 0.004708
825500 -- [-1697.087] (-1697.214) (-1695.467) (-1698.142) * (-1705.007) [-1695.414] (-1697.888) (-1706.679) -- 0:00:43
826000 -- [-1692.132] (-1701.240) (-1698.542) (-1695.178) * (-1698.892) [-1700.315] (-1696.125) (-1697.107) -- 0:00:44
826500 -- (-1697.843) [-1695.358] (-1697.953) (-1696.901) * (-1695.506) [-1698.547] (-1699.030) (-1700.911) -- 0:00:43
827000 -- (-1698.457) (-1701.817) [-1696.101] (-1694.621) * (-1697.257) [-1690.805] (-1698.594) (-1698.422) -- 0:00:43
827500 -- [-1697.540] (-1703.464) (-1699.428) (-1697.302) * (-1698.617) (-1694.580) [-1697.962] (-1699.267) -- 0:00:43
828000 -- (-1695.839) (-1701.239) [-1698.307] (-1696.988) * (-1699.947) [-1696.679] (-1703.295) (-1697.556) -- 0:00:43
828500 -- [-1691.409] (-1699.175) (-1690.641) (-1699.733) * (-1695.036) [-1690.818] (-1701.328) (-1698.190) -- 0:00:43
829000 -- [-1690.488] (-1693.221) (-1692.577) (-1697.437) * (-1690.495) [-1694.206] (-1696.914) (-1694.679) -- 0:00:43
829500 -- (-1694.291) (-1693.708) (-1692.036) [-1694.758] * (-1705.932) [-1703.654] (-1696.596) (-1698.809) -- 0:00:42
830000 -- (-1701.227) (-1697.277) (-1695.289) [-1697.637] * (-1694.730) (-1695.699) (-1697.760) [-1696.332] -- 0:00:43
Average standard deviation of split frequencies: 0.005675
830500 -- (-1694.008) (-1696.859) (-1692.068) [-1694.335] * (-1693.816) [-1695.069] (-1699.084) (-1700.356) -- 0:00:42
831000 -- (-1699.299) (-1693.524) [-1695.361] (-1692.812) * [-1694.331] (-1702.560) (-1705.478) (-1691.726) -- 0:00:42
831500 -- (-1700.658) (-1697.059) (-1698.718) [-1694.156] * [-1701.141] (-1694.693) (-1693.896) (-1696.547) -- 0:00:42
832000 -- (-1693.024) (-1691.602) [-1693.104] (-1701.781) * (-1693.082) (-1697.610) [-1690.604] (-1697.978) -- 0:00:42
832500 -- (-1699.577) (-1697.126) [-1693.409] (-1699.472) * (-1694.480) (-1697.493) (-1701.741) [-1695.800] -- 0:00:42
833000 -- (-1696.710) [-1700.145] (-1701.220) (-1692.180) * (-1691.552) [-1694.885] (-1699.799) (-1696.694) -- 0:00:42
833500 -- (-1696.652) [-1696.615] (-1695.524) (-1698.437) * (-1698.034) [-1703.382] (-1691.072) (-1692.241) -- 0:00:41
834000 -- (-1696.313) (-1694.743) [-1693.814] (-1696.119) * [-1691.681] (-1699.402) (-1692.973) (-1698.229) -- 0:00:41
834500 -- (-1695.543) (-1696.852) (-1697.590) [-1700.039] * (-1693.970) [-1698.754] (-1706.547) (-1693.907) -- 0:00:41
835000 -- (-1695.075) [-1695.270] (-1698.678) (-1696.323) * (-1693.719) (-1696.572) (-1700.323) [-1696.297] -- 0:00:41
Average standard deviation of split frequencies: 0.005639
835500 -- [-1694.425] (-1696.215) (-1697.703) (-1700.717) * (-1694.143) (-1700.086) [-1693.404] (-1696.019) -- 0:00:41
836000 -- (-1694.211) (-1696.495) [-1696.541] (-1693.977) * [-1694.603] (-1696.522) (-1698.382) (-1695.879) -- 0:00:41
836500 -- [-1697.877] (-1695.287) (-1699.205) (-1699.957) * (-1696.480) [-1692.098] (-1695.452) (-1693.761) -- 0:00:41
837000 -- (-1698.043) [-1693.521] (-1698.375) (-1699.136) * (-1699.789) (-1695.958) [-1691.710] (-1704.169) -- 0:00:41
837500 -- [-1696.645] (-1696.304) (-1696.232) (-1701.356) * (-1699.936) [-1699.971] (-1697.879) (-1702.724) -- 0:00:40
838000 -- (-1699.636) (-1693.009) [-1695.895] (-1701.437) * (-1699.472) [-1697.386] (-1698.383) (-1702.319) -- 0:00:40
838500 -- (-1703.618) (-1700.677) [-1692.530] (-1696.386) * [-1692.133] (-1700.860) (-1700.921) (-1698.233) -- 0:00:40
839000 -- (-1703.204) (-1696.855) [-1697.698] (-1697.843) * (-1697.356) (-1699.070) [-1697.841] (-1695.572) -- 0:00:40
839500 -- (-1702.875) (-1700.081) (-1694.469) [-1696.952] * [-1696.474] (-1699.854) (-1698.611) (-1701.453) -- 0:00:40
840000 -- [-1690.814] (-1692.276) (-1698.991) (-1697.603) * (-1699.859) (-1703.700) (-1701.480) [-1694.112] -- 0:00:40
Average standard deviation of split frequencies: 0.005047
840500 -- (-1701.666) (-1696.040) [-1692.017] (-1699.454) * [-1693.954] (-1692.796) (-1706.237) (-1697.106) -- 0:00:40
841000 -- (-1698.546) (-1691.106) [-1699.992] (-1710.006) * (-1694.305) [-1694.773] (-1701.477) (-1700.752) -- 0:00:40
841500 -- (-1699.000) (-1691.319) (-1696.912) [-1699.347] * (-1697.628) (-1692.289) [-1697.061] (-1692.987) -- 0:00:40
842000 -- (-1694.241) (-1696.784) (-1706.331) [-1698.914] * (-1699.885) [-1693.475] (-1694.299) (-1698.546) -- 0:00:39
842500 -- (-1694.243) (-1695.580) (-1703.107) [-1696.319] * [-1693.385] (-1698.381) (-1699.724) (-1692.577) -- 0:00:39
843000 -- [-1692.437] (-1696.414) (-1704.007) (-1700.861) * (-1695.085) [-1695.289] (-1693.858) (-1707.074) -- 0:00:39
843500 -- (-1696.650) (-1694.220) (-1701.376) [-1695.291] * (-1692.307) [-1700.439] (-1693.533) (-1697.784) -- 0:00:39
844000 -- (-1701.136) (-1697.567) [-1691.214] (-1700.288) * [-1699.898] (-1695.417) (-1695.660) (-1695.097) -- 0:00:39
844500 -- [-1698.700] (-1698.855) (-1691.930) (-1698.848) * [-1698.511] (-1692.839) (-1695.971) (-1694.403) -- 0:00:39
845000 -- [-1694.294] (-1703.593) (-1692.682) (-1693.774) * [-1693.887] (-1699.248) (-1697.346) (-1691.904) -- 0:00:39
Average standard deviation of split frequencies: 0.005572
845500 -- (-1700.925) (-1696.849) [-1695.224] (-1695.123) * (-1697.243) (-1696.699) (-1693.452) [-1691.892] -- 0:00:39
846000 -- (-1697.798) [-1693.792] (-1695.359) (-1693.289) * (-1707.653) (-1703.485) (-1694.784) [-1692.556] -- 0:00:38
846500 -- [-1693.145] (-1701.254) (-1696.899) (-1702.960) * (-1697.114) [-1693.694] (-1697.381) (-1693.556) -- 0:00:38
847000 -- (-1700.536) [-1698.559] (-1696.305) (-1703.360) * (-1700.781) (-1694.767) [-1693.983] (-1695.977) -- 0:00:38
847500 -- [-1700.540] (-1696.960) (-1696.284) (-1698.853) * [-1693.420] (-1696.947) (-1697.330) (-1692.097) -- 0:00:38
848000 -- [-1694.968] (-1699.993) (-1693.357) (-1699.412) * [-1695.160] (-1699.443) (-1691.809) (-1693.841) -- 0:00:38
848500 -- (-1695.164) (-1698.218) (-1700.933) [-1697.416] * (-1703.276) [-1695.845] (-1693.676) (-1697.473) -- 0:00:38
849000 -- [-1693.765] (-1695.544) (-1696.140) (-1694.072) * (-1692.667) (-1695.754) (-1701.781) [-1696.120] -- 0:00:38
849500 -- (-1698.018) [-1696.719] (-1696.898) (-1693.184) * (-1696.342) [-1700.577] (-1693.199) (-1702.685) -- 0:00:38
850000 -- (-1696.607) (-1697.709) [-1693.700] (-1700.890) * [-1691.158] (-1695.777) (-1700.857) (-1696.104) -- 0:00:37
Average standard deviation of split frequencies: 0.006511
850500 -- (-1701.261) (-1703.773) (-1695.394) [-1695.586] * (-1692.800) [-1695.402] (-1699.997) (-1695.296) -- 0:00:37
851000 -- (-1696.757) [-1693.742] (-1695.894) (-1706.361) * [-1697.674] (-1695.903) (-1694.377) (-1699.332) -- 0:00:37
851500 -- [-1691.468] (-1697.058) (-1697.517) (-1701.665) * [-1695.757] (-1700.797) (-1692.859) (-1702.346) -- 0:00:37
852000 -- [-1693.939] (-1698.220) (-1701.038) (-1698.645) * [-1693.234] (-1696.615) (-1694.479) (-1697.247) -- 0:00:37
852500 -- (-1696.140) [-1695.826] (-1701.755) (-1697.029) * (-1690.702) [-1693.924] (-1693.066) (-1702.168) -- 0:00:37
853000 -- (-1696.707) (-1695.947) (-1693.470) [-1697.422] * (-1694.468) (-1703.860) (-1697.880) [-1695.343] -- 0:00:37
853500 -- [-1695.760] (-1696.566) (-1695.353) (-1701.052) * [-1696.282] (-1693.368) (-1693.953) (-1693.680) -- 0:00:37
854000 -- (-1695.992) [-1699.039] (-1699.720) (-1697.055) * [-1702.446] (-1699.544) (-1699.797) (-1698.979) -- 0:00:36
854500 -- [-1699.697] (-1692.599) (-1697.880) (-1698.789) * [-1694.195] (-1692.975) (-1698.148) (-1696.218) -- 0:00:36
855000 -- [-1694.563] (-1696.861) (-1697.497) (-1692.567) * [-1689.496] (-1694.041) (-1698.221) (-1699.557) -- 0:00:36
Average standard deviation of split frequencies: 0.005645
855500 -- (-1699.688) (-1699.688) (-1698.363) [-1697.656] * (-1696.656) [-1697.728] (-1695.159) (-1695.738) -- 0:00:36
856000 -- (-1699.494) (-1692.405) (-1692.678) [-1694.973] * (-1698.992) (-1701.503) [-1695.886] (-1702.781) -- 0:00:36
856500 -- (-1702.700) (-1697.702) [-1694.501] (-1698.458) * (-1698.022) (-1694.145) [-1701.769] (-1700.606) -- 0:00:36
857000 -- (-1695.933) (-1699.964) (-1696.127) [-1695.454] * (-1702.660) (-1701.466) [-1696.508] (-1700.293) -- 0:00:36
857500 -- (-1700.493) (-1695.159) [-1693.157] (-1696.717) * (-1703.773) (-1698.094) [-1694.933] (-1694.605) -- 0:00:36
858000 -- (-1693.652) [-1696.828] (-1699.101) (-1697.435) * (-1698.593) [-1700.538] (-1701.450) (-1703.532) -- 0:00:35
858500 -- (-1698.224) (-1703.500) [-1697.001] (-1693.458) * (-1699.064) (-1695.107) (-1696.779) [-1699.589] -- 0:00:35
859000 -- (-1698.674) (-1709.755) [-1692.090] (-1697.451) * (-1696.278) (-1695.073) [-1693.144] (-1700.791) -- 0:00:35
859500 -- (-1706.054) (-1701.339) (-1700.674) [-1698.260] * (-1693.258) [-1691.810] (-1700.495) (-1697.007) -- 0:00:35
860000 -- (-1702.123) [-1695.245] (-1698.516) (-1702.463) * [-1694.131] (-1697.397) (-1699.305) (-1699.711) -- 0:00:35
Average standard deviation of split frequencies: 0.005614
860500 -- (-1693.923) (-1691.359) (-1694.235) [-1696.699] * (-1696.565) (-1697.565) [-1693.736] (-1702.582) -- 0:00:35
861000 -- (-1694.112) (-1696.329) (-1699.511) [-1697.752] * (-1697.234) [-1692.722] (-1694.556) (-1700.026) -- 0:00:35
861500 -- [-1695.002] (-1693.220) (-1698.291) (-1719.570) * [-1703.438] (-1696.930) (-1695.537) (-1698.049) -- 0:00:35
862000 -- (-1693.211) [-1693.526] (-1704.270) (-1702.648) * (-1701.177) (-1697.208) (-1694.158) [-1703.382] -- 0:00:34
862500 -- [-1691.688] (-1698.574) (-1698.168) (-1699.563) * (-1698.486) [-1692.789] (-1694.255) (-1709.833) -- 0:00:34
863000 -- (-1693.390) [-1696.763] (-1696.801) (-1700.724) * [-1696.982] (-1705.183) (-1700.057) (-1700.610) -- 0:00:34
863500 -- [-1698.423] (-1697.309) (-1699.309) (-1694.753) * [-1696.242] (-1702.387) (-1693.269) (-1693.024) -- 0:00:34
864000 -- (-1701.167) (-1698.663) (-1697.359) [-1697.429] * (-1695.035) (-1699.352) [-1695.372] (-1695.888) -- 0:00:34
864500 -- [-1691.089] (-1693.299) (-1695.496) (-1697.674) * [-1692.738] (-1696.365) (-1697.986) (-1692.972) -- 0:00:34
865000 -- [-1693.166] (-1697.938) (-1700.013) (-1701.619) * (-1699.562) (-1691.549) [-1702.091] (-1693.854) -- 0:00:34
Average standard deviation of split frequencies: 0.005988
865500 -- (-1698.903) (-1705.853) [-1691.501] (-1697.596) * (-1691.482) (-1692.117) (-1698.802) [-1694.103] -- 0:00:34
866000 -- (-1701.046) [-1700.989] (-1697.083) (-1698.564) * (-1691.710) [-1690.725] (-1703.374) (-1711.253) -- 0:00:33
866500 -- (-1701.255) (-1701.344) [-1698.859] (-1698.989) * (-1700.077) [-1699.695] (-1702.242) (-1696.528) -- 0:00:33
867000 -- (-1695.906) (-1706.042) [-1698.851] (-1694.900) * (-1697.640) (-1698.221) [-1703.432] (-1696.265) -- 0:00:33
867500 -- [-1695.603] (-1702.714) (-1710.159) (-1695.071) * (-1694.051) (-1695.860) [-1697.848] (-1697.795) -- 0:00:33
868000 -- [-1696.388] (-1705.775) (-1694.794) (-1695.874) * (-1693.851) (-1697.082) (-1701.538) [-1700.220] -- 0:00:33
868500 -- [-1694.704] (-1702.563) (-1693.804) (-1699.075) * (-1701.488) [-1698.815] (-1699.977) (-1704.178) -- 0:00:33
869000 -- [-1696.268] (-1695.186) (-1695.536) (-1695.378) * [-1702.265] (-1706.642) (-1695.745) (-1702.564) -- 0:00:33
869500 -- (-1702.267) (-1696.635) [-1700.430] (-1700.140) * (-1704.929) (-1695.121) [-1697.622] (-1701.144) -- 0:00:33
870000 -- [-1697.021] (-1698.361) (-1701.763) (-1705.541) * (-1701.494) [-1692.017] (-1702.277) (-1704.196) -- 0:00:32
Average standard deviation of split frequencies: 0.006091
870500 -- [-1703.316] (-1706.299) (-1697.907) (-1706.229) * [-1698.496] (-1699.827) (-1701.442) (-1702.666) -- 0:00:32
871000 -- (-1698.153) (-1697.303) [-1695.659] (-1698.966) * (-1699.866) [-1697.990] (-1700.515) (-1699.439) -- 0:00:32
871500 -- (-1695.980) (-1693.169) (-1702.383) [-1697.064] * (-1702.309) [-1702.103] (-1699.228) (-1701.138) -- 0:00:32
872000 -- (-1698.324) (-1692.013) [-1701.767] (-1708.596) * (-1694.515) [-1697.228] (-1697.601) (-1701.490) -- 0:00:32
872500 -- [-1700.119] (-1706.269) (-1704.699) (-1694.849) * (-1692.339) [-1692.912] (-1698.688) (-1698.993) -- 0:00:32
873000 -- (-1702.111) [-1695.644] (-1700.482) (-1692.685) * [-1699.445] (-1691.588) (-1696.362) (-1700.776) -- 0:00:32
873500 -- (-1692.249) (-1696.551) (-1695.289) [-1698.061] * [-1690.300] (-1695.826) (-1698.616) (-1697.507) -- 0:00:32
874000 -- (-1706.844) [-1699.536] (-1696.404) (-1701.980) * [-1694.890] (-1695.160) (-1696.770) (-1699.996) -- 0:00:31
874500 -- (-1700.856) (-1691.682) [-1691.223] (-1703.724) * (-1699.558) (-1692.035) [-1698.848] (-1695.545) -- 0:00:31
875000 -- (-1696.592) (-1701.782) [-1691.572] (-1705.410) * (-1698.420) (-1694.959) [-1695.964] (-1697.897) -- 0:00:31
Average standard deviation of split frequencies: 0.006458
875500 -- (-1699.179) (-1696.243) [-1697.311] (-1697.400) * [-1692.388] (-1701.782) (-1700.488) (-1700.543) -- 0:00:31
876000 -- (-1705.067) (-1696.855) [-1694.060] (-1699.363) * (-1695.234) [-1693.461] (-1697.275) (-1700.660) -- 0:00:31
876500 -- (-1701.414) (-1710.462) [-1697.440] (-1696.644) * (-1703.643) (-1694.773) [-1698.949] (-1709.148) -- 0:00:31
877000 -- (-1702.795) (-1699.700) [-1692.921] (-1693.379) * (-1701.850) [-1694.196] (-1700.224) (-1692.366) -- 0:00:31
877500 -- (-1698.879) (-1705.875) (-1707.387) [-1698.291] * (-1699.229) (-1695.896) [-1695.366] (-1701.266) -- 0:00:30
878000 -- (-1693.002) (-1707.354) [-1698.473] (-1700.591) * (-1695.738) (-1701.228) [-1698.403] (-1699.568) -- 0:00:30
878500 -- (-1696.406) (-1701.569) (-1696.789) [-1697.287] * (-1698.320) (-1709.714) [-1692.014] (-1694.093) -- 0:00:30
879000 -- (-1698.098) (-1698.344) (-1695.274) [-1694.077] * [-1691.213] (-1703.393) (-1705.561) (-1700.814) -- 0:00:30
879500 -- (-1694.691) (-1702.181) (-1696.690) [-1694.749] * [-1693.566] (-1697.714) (-1701.447) (-1704.537) -- 0:00:30
880000 -- (-1697.618) (-1692.575) (-1696.553) [-1697.739] * (-1693.151) [-1697.296] (-1697.935) (-1702.428) -- 0:00:30
Average standard deviation of split frequencies: 0.006825
880500 -- (-1694.739) (-1692.895) (-1698.258) [-1694.049] * (-1695.313) (-1701.468) [-1695.926] (-1699.680) -- 0:00:30
881000 -- [-1691.580] (-1700.483) (-1693.962) (-1697.894) * (-1693.263) (-1703.150) (-1698.577) [-1700.740] -- 0:00:30
881500 -- (-1694.103) (-1696.806) (-1697.581) [-1697.365] * [-1691.558] (-1705.087) (-1695.595) (-1697.057) -- 0:00:29
882000 -- [-1698.485] (-1710.848) (-1696.337) (-1701.537) * [-1691.459] (-1695.911) (-1696.580) (-1700.622) -- 0:00:29
882500 -- [-1699.477] (-1694.169) (-1693.846) (-1694.240) * (-1696.322) [-1694.650] (-1696.845) (-1700.981) -- 0:00:29
883000 -- (-1697.212) (-1703.169) [-1697.224] (-1694.759) * (-1699.017) (-1696.992) [-1695.249] (-1695.321) -- 0:00:29
883500 -- (-1699.132) [-1693.434] (-1699.027) (-1700.425) * (-1700.599) [-1693.533] (-1697.657) (-1701.398) -- 0:00:29
884000 -- (-1697.695) (-1701.668) (-1701.362) [-1696.318] * [-1699.646] (-1701.028) (-1693.985) (-1707.874) -- 0:00:29
884500 -- (-1696.028) [-1701.121] (-1695.186) (-1700.922) * (-1699.448) [-1694.547] (-1694.464) (-1700.356) -- 0:00:29
885000 -- [-1698.706] (-1698.742) (-1695.437) (-1700.034) * (-1693.809) (-1692.767) [-1693.377] (-1694.428) -- 0:00:29
Average standard deviation of split frequencies: 0.006385
885500 -- (-1701.036) [-1695.453] (-1696.006) (-1701.318) * (-1700.681) (-1694.754) [-1697.905] (-1696.798) -- 0:00:28
886000 -- (-1697.805) [-1692.787] (-1699.142) (-1700.692) * (-1700.697) (-1698.142) (-1695.574) [-1697.303] -- 0:00:28
886500 -- (-1698.481) [-1696.588] (-1699.717) (-1708.197) * (-1692.431) [-1694.221] (-1692.938) (-1695.236) -- 0:00:28
887000 -- (-1693.330) [-1691.282] (-1695.739) (-1702.651) * [-1698.486] (-1696.134) (-1699.113) (-1695.336) -- 0:00:28
887500 -- (-1699.361) [-1695.192] (-1695.241) (-1704.051) * (-1691.803) (-1697.534) [-1691.397] (-1696.753) -- 0:00:28
888000 -- (-1696.271) (-1695.914) (-1697.033) [-1700.935] * (-1696.259) (-1694.193) [-1695.920] (-1697.118) -- 0:00:28
888500 -- (-1696.852) (-1700.735) [-1692.172] (-1699.226) * (-1701.357) (-1699.342) [-1698.989] (-1697.150) -- 0:00:28
889000 -- (-1697.149) [-1695.483] (-1696.747) (-1695.536) * (-1692.537) (-1698.886) (-1696.944) [-1699.626] -- 0:00:28
889500 -- (-1700.540) [-1690.619] (-1694.061) (-1695.857) * (-1695.220) (-1699.930) (-1693.341) [-1697.950] -- 0:00:27
890000 -- [-1699.345] (-1698.811) (-1692.550) (-1693.155) * [-1691.813] (-1692.801) (-1696.808) (-1696.278) -- 0:00:27
Average standard deviation of split frequencies: 0.006616
890500 -- (-1698.162) (-1695.094) (-1697.143) [-1698.466] * [-1692.552] (-1703.151) (-1694.592) (-1692.810) -- 0:00:27
891000 -- (-1697.700) [-1698.596] (-1693.272) (-1697.426) * (-1693.540) (-1701.734) [-1702.367] (-1696.226) -- 0:00:27
891500 -- [-1690.696] (-1697.950) (-1694.808) (-1698.669) * (-1693.785) (-1708.365) (-1698.430) [-1699.881] -- 0:00:27
892000 -- (-1697.628) (-1701.958) (-1695.721) [-1699.320] * (-1704.423) [-1695.836] (-1693.383) (-1704.943) -- 0:00:27
892500 -- (-1704.103) (-1700.785) [-1689.857] (-1694.511) * [-1692.006] (-1698.991) (-1693.670) (-1694.865) -- 0:00:27
893000 -- (-1698.291) (-1693.438) [-1696.203] (-1701.400) * [-1697.362] (-1695.809) (-1693.726) (-1697.254) -- 0:00:27
893500 -- (-1696.773) (-1701.925) [-1697.309] (-1697.999) * [-1695.701] (-1699.575) (-1697.718) (-1705.152) -- 0:00:26
894000 -- (-1696.993) [-1693.629] (-1702.657) (-1699.573) * (-1697.103) (-1697.978) [-1696.605] (-1697.636) -- 0:00:26
894500 -- (-1694.257) (-1696.692) [-1699.205] (-1692.222) * (-1699.761) [-1695.716] (-1704.875) (-1700.833) -- 0:00:26
895000 -- (-1692.613) (-1695.913) (-1696.992) [-1692.527] * (-1695.616) (-1693.255) [-1701.696] (-1696.587) -- 0:00:26
Average standard deviation of split frequencies: 0.006050
895500 -- (-1691.654) (-1704.774) (-1693.529) [-1694.192] * [-1696.768] (-1693.308) (-1696.958) (-1695.703) -- 0:00:26
896000 -- (-1697.274) (-1706.380) (-1691.857) [-1695.250] * (-1694.774) [-1698.361] (-1694.909) (-1698.826) -- 0:00:26
896500 -- (-1693.431) (-1702.107) [-1696.955] (-1695.912) * (-1691.530) [-1698.977] (-1697.865) (-1696.718) -- 0:00:26
897000 -- (-1697.147) (-1702.389) [-1688.541] (-1692.342) * [-1696.387] (-1697.169) (-1699.933) (-1696.413) -- 0:00:26
897500 -- (-1699.657) (-1696.565) [-1691.427] (-1698.171) * (-1698.950) (-1698.276) [-1697.020] (-1700.445) -- 0:00:25
898000 -- [-1695.416] (-1698.326) (-1696.385) (-1697.317) * (-1692.765) (-1697.123) (-1697.046) [-1699.327] -- 0:00:25
898500 -- (-1696.623) (-1698.148) [-1695.645] (-1694.560) * (-1700.412) (-1700.772) (-1698.141) [-1693.137] -- 0:00:25
899000 -- (-1691.407) [-1705.105] (-1702.716) (-1700.506) * (-1698.471) (-1694.450) (-1702.132) [-1699.528] -- 0:00:25
899500 -- [-1695.210] (-1694.336) (-1704.508) (-1698.140) * (-1692.758) (-1705.897) [-1699.717] (-1692.398) -- 0:00:25
900000 -- (-1697.420) [-1698.974] (-1693.367) (-1698.599) * [-1695.143] (-1692.829) (-1701.567) (-1699.544) -- 0:00:25
Average standard deviation of split frequencies: 0.006673
900500 -- (-1699.068) (-1699.708) (-1695.143) [-1699.859] * (-1697.306) (-1692.440) [-1704.455] (-1690.425) -- 0:00:25
901000 -- (-1701.608) (-1696.843) [-1696.220] (-1695.984) * (-1698.046) [-1694.697] (-1698.447) (-1696.114) -- 0:00:25
901500 -- (-1698.293) [-1697.462] (-1697.051) (-1701.973) * [-1695.782] (-1697.771) (-1697.002) (-1699.184) -- 0:00:24
902000 -- (-1693.899) (-1699.971) [-1697.827] (-1690.860) * (-1698.715) (-1693.552) (-1693.492) [-1704.261] -- 0:00:24
902500 -- (-1698.642) [-1698.617] (-1695.099) (-1700.630) * (-1700.555) [-1696.247] (-1696.360) (-1697.150) -- 0:00:24
903000 -- (-1694.492) (-1700.963) [-1696.744] (-1699.173) * (-1695.005) [-1694.294] (-1694.825) (-1698.882) -- 0:00:24
903500 -- (-1695.356) (-1702.098) (-1691.700) [-1702.997] * (-1695.460) (-1700.083) [-1694.933] (-1698.073) -- 0:00:24
904000 -- (-1694.328) (-1699.391) [-1699.575] (-1698.292) * (-1698.127) (-1700.296) (-1696.714) [-1693.387] -- 0:00:24
904500 -- (-1695.557) [-1699.761] (-1698.734) (-1697.057) * (-1701.340) [-1693.403] (-1699.858) (-1695.191) -- 0:00:24
905000 -- (-1702.669) [-1698.413] (-1701.974) (-1695.471) * [-1695.172] (-1705.756) (-1697.547) (-1695.789) -- 0:00:24
Average standard deviation of split frequencies: 0.006764
905500 -- (-1698.352) (-1695.921) [-1694.170] (-1696.551) * (-1707.692) (-1698.003) [-1691.841] (-1692.134) -- 0:00:23
906000 -- (-1706.670) (-1695.027) [-1695.584] (-1691.849) * (-1701.059) (-1697.929) (-1695.174) [-1694.114] -- 0:00:23
906500 -- [-1697.350] (-1700.760) (-1696.908) (-1695.716) * [-1690.021] (-1696.183) (-1703.209) (-1696.695) -- 0:00:23
907000 -- [-1696.396] (-1696.699) (-1695.241) (-1697.081) * (-1699.095) [-1696.037] (-1699.684) (-1704.747) -- 0:00:23
907500 -- [-1697.678] (-1693.619) (-1696.815) (-1698.140) * (-1697.183) (-1697.289) [-1694.346] (-1699.724) -- 0:00:23
908000 -- (-1696.577) (-1697.352) (-1691.517) [-1696.072] * [-1694.830] (-1691.180) (-1699.114) (-1693.846) -- 0:00:23
908500 -- (-1701.772) [-1699.523] (-1698.293) (-1699.500) * (-1692.777) [-1693.998] (-1690.993) (-1700.415) -- 0:00:23
909000 -- (-1703.784) [-1706.626] (-1698.522) (-1695.461) * (-1695.203) [-1695.456] (-1698.871) (-1702.451) -- 0:00:23
909500 -- (-1698.239) (-1696.392) (-1697.223) [-1695.852] * (-1698.007) [-1693.301] (-1698.311) (-1694.914) -- 0:00:22
910000 -- [-1693.761] (-1695.479) (-1696.036) (-1701.009) * (-1705.939) (-1696.338) [-1693.404] (-1703.442) -- 0:00:22
Average standard deviation of split frequencies: 0.007118
910500 -- (-1702.910) (-1702.231) (-1702.669) [-1692.758] * (-1701.020) [-1697.545] (-1694.005) (-1695.009) -- 0:00:22
911000 -- (-1697.631) (-1702.645) (-1702.282) [-1692.395] * (-1694.895) (-1696.252) (-1706.127) [-1691.905] -- 0:00:22
911500 -- (-1696.393) [-1693.839] (-1704.212) (-1698.844) * (-1696.233) (-1692.334) [-1694.566] (-1701.777) -- 0:00:22
912000 -- (-1694.019) (-1705.090) (-1700.061) [-1699.400] * (-1702.814) [-1693.392] (-1699.923) (-1705.120) -- 0:00:22
912500 -- (-1694.748) [-1693.384] (-1695.534) (-1705.075) * [-1700.634] (-1697.704) (-1698.995) (-1692.979) -- 0:00:22
913000 -- (-1693.427) (-1701.893) [-1694.961] (-1698.551) * (-1695.697) (-1695.564) (-1695.242) [-1695.923] -- 0:00:22
913500 -- (-1697.367) [-1698.180] (-1691.686) (-1695.121) * (-1696.216) (-1702.323) (-1694.706) [-1694.367] -- 0:00:21
914000 -- (-1692.727) [-1695.958] (-1697.779) (-1698.431) * (-1704.051) (-1698.833) [-1696.798] (-1700.733) -- 0:00:21
914500 -- (-1704.748) (-1693.722) (-1699.993) [-1699.958] * (-1697.850) (-1695.748) [-1695.251] (-1700.529) -- 0:00:21
915000 -- [-1697.777] (-1695.859) (-1700.334) (-1693.777) * [-1698.038] (-1695.750) (-1700.683) (-1698.266) -- 0:00:21
Average standard deviation of split frequencies: 0.007977
915500 -- [-1695.552] (-1704.617) (-1696.888) (-1703.132) * [-1692.021] (-1699.991) (-1701.967) (-1694.241) -- 0:00:21
916000 -- [-1695.576] (-1695.086) (-1698.921) (-1698.554) * (-1700.490) (-1698.771) (-1698.965) [-1696.268] -- 0:00:21
916500 -- (-1695.514) (-1699.965) [-1694.963] (-1701.082) * [-1694.564] (-1700.340) (-1696.654) (-1696.344) -- 0:00:21
917000 -- (-1699.367) [-1696.564] (-1704.414) (-1691.880) * (-1695.627) (-1700.427) [-1697.351] (-1694.594) -- 0:00:20
917500 -- (-1698.653) (-1693.964) (-1698.251) [-1693.101] * (-1696.483) (-1703.264) [-1693.599] (-1692.907) -- 0:00:20
918000 -- (-1694.059) [-1696.313] (-1702.569) (-1699.296) * [-1695.593] (-1698.092) (-1695.310) (-1696.351) -- 0:00:20
918500 -- (-1703.412) (-1697.874) (-1705.093) [-1695.006] * (-1699.259) (-1693.150) (-1700.194) [-1692.879] -- 0:00:20
919000 -- [-1704.103] (-1696.836) (-1697.226) (-1695.654) * (-1697.079) [-1693.976] (-1693.676) (-1694.227) -- 0:00:20
919500 -- (-1707.121) (-1700.676) (-1700.918) [-1696.198] * (-1693.988) (-1694.096) [-1693.892] (-1700.773) -- 0:00:20
920000 -- (-1700.129) (-1699.316) [-1693.586] (-1700.783) * (-1698.291) [-1699.351] (-1700.394) (-1695.509) -- 0:00:20
Average standard deviation of split frequencies: 0.008320
920500 -- (-1696.385) [-1693.026] (-1701.591) (-1696.228) * (-1694.116) (-1699.363) (-1707.154) [-1692.384] -- 0:00:20
921000 -- [-1691.716] (-1701.877) (-1696.423) (-1694.362) * [-1694.658] (-1701.913) (-1704.636) (-1702.341) -- 0:00:19
921500 -- (-1699.405) (-1713.824) [-1699.688] (-1697.152) * [-1690.613] (-1698.961) (-1710.603) (-1702.992) -- 0:00:19
922000 -- (-1706.275) (-1703.038) (-1697.886) [-1691.040] * (-1696.702) [-1697.084] (-1705.205) (-1696.460) -- 0:00:19
922500 -- (-1700.020) [-1696.218] (-1702.696) (-1692.004) * [-1693.789] (-1696.003) (-1706.327) (-1694.226) -- 0:00:19
923000 -- (-1694.712) [-1695.254] (-1701.063) (-1698.096) * (-1699.309) [-1697.337] (-1699.426) (-1691.413) -- 0:00:19
923500 -- [-1693.427] (-1693.704) (-1698.698) (-1695.147) * [-1695.947] (-1695.232) (-1697.081) (-1693.891) -- 0:00:19
924000 -- (-1700.180) (-1692.516) (-1703.300) [-1695.406] * (-1696.786) (-1708.142) (-1697.911) [-1691.712] -- 0:00:19
924500 -- [-1702.784] (-1693.434) (-1703.281) (-1693.857) * (-1692.437) (-1706.018) [-1695.516] (-1694.309) -- 0:00:19
925000 -- (-1696.183) (-1695.925) (-1695.529) [-1692.471] * (-1695.872) [-1699.174] (-1689.586) (-1701.996) -- 0:00:18
Average standard deviation of split frequencies: 0.008527
925500 -- (-1697.648) (-1695.364) [-1697.036] (-1697.217) * [-1698.476] (-1696.726) (-1694.345) (-1697.765) -- 0:00:18
926000 -- [-1694.401] (-1694.391) (-1698.247) (-1700.122) * [-1695.248] (-1698.387) (-1695.356) (-1703.771) -- 0:00:18
926500 -- (-1692.155) [-1695.855] (-1696.489) (-1695.249) * [-1693.522] (-1699.288) (-1694.868) (-1700.082) -- 0:00:18
927000 -- [-1695.793] (-1699.647) (-1696.042) (-1705.006) * (-1693.531) (-1703.995) [-1694.826] (-1694.847) -- 0:00:18
927500 -- (-1693.241) [-1700.827] (-1700.140) (-1703.239) * (-1695.651) (-1696.236) [-1700.491] (-1697.638) -- 0:00:18
928000 -- (-1698.617) (-1695.526) [-1693.978] (-1700.664) * (-1698.262) [-1695.867] (-1698.206) (-1698.110) -- 0:00:18
928500 -- (-1705.774) (-1699.771) (-1693.605) [-1698.157] * (-1702.761) [-1696.055] (-1692.717) (-1696.075) -- 0:00:18
929000 -- (-1715.971) [-1695.467] (-1695.224) (-1695.162) * (-1694.628) (-1695.575) [-1695.197] (-1697.570) -- 0:00:17
929500 -- (-1698.518) (-1698.716) [-1698.435] (-1693.995) * (-1694.025) (-1698.849) [-1691.588] (-1693.781) -- 0:00:17
930000 -- (-1698.253) (-1707.658) (-1695.614) [-1697.629] * (-1695.293) [-1702.240] (-1700.457) (-1700.068) -- 0:00:17
Average standard deviation of split frequencies: 0.008358
930500 -- [-1694.983] (-1701.000) (-1697.077) (-1691.357) * (-1696.133) (-1699.782) (-1698.141) [-1696.398] -- 0:00:17
931000 -- (-1696.802) [-1698.780] (-1697.833) (-1699.521) * [-1694.133] (-1696.315) (-1705.100) (-1696.270) -- 0:00:17
931500 -- (-1703.709) (-1700.567) (-1693.227) [-1700.352] * [-1697.862] (-1704.403) (-1699.819) (-1698.233) -- 0:00:17
932000 -- (-1698.087) (-1698.675) (-1700.812) [-1698.183] * [-1693.496] (-1700.324) (-1701.982) (-1696.792) -- 0:00:17
932500 -- [-1695.581] (-1697.659) (-1707.034) (-1694.034) * (-1694.125) (-1700.846) (-1697.659) [-1694.258] -- 0:00:17
933000 -- [-1692.431] (-1700.565) (-1699.491) (-1699.796) * (-1694.378) [-1697.106] (-1699.670) (-1693.989) -- 0:00:16
933500 -- (-1692.995) (-1691.911) (-1694.008) [-1695.193] * [-1691.797] (-1694.142) (-1702.685) (-1696.438) -- 0:00:16
934000 -- (-1693.441) (-1694.210) (-1697.639) [-1697.764] * (-1704.827) [-1696.411] (-1698.022) (-1701.824) -- 0:00:16
934500 -- (-1697.154) (-1699.636) [-1700.283] (-1705.090) * (-1699.678) (-1694.406) [-1693.955] (-1695.173) -- 0:00:16
935000 -- (-1697.640) (-1700.963) [-1694.030] (-1705.699) * (-1696.241) (-1694.467) [-1692.839] (-1697.028) -- 0:00:16
Average standard deviation of split frequencies: 0.008436
935500 -- (-1693.520) (-1695.822) [-1699.520] (-1697.612) * (-1696.027) (-1694.963) (-1693.003) [-1697.768] -- 0:00:16
936000 -- (-1700.452) (-1698.448) [-1695.806] (-1697.644) * [-1695.286] (-1695.433) (-1697.792) (-1698.852) -- 0:00:16
936500 -- (-1700.627) [-1698.624] (-1695.218) (-1695.141) * (-1696.490) [-1693.089] (-1699.582) (-1695.634) -- 0:00:16
937000 -- (-1708.089) [-1688.834] (-1697.348) (-1700.039) * (-1693.308) [-1692.485] (-1702.909) (-1695.563) -- 0:00:15
937500 -- [-1697.557] (-1693.050) (-1701.134) (-1699.105) * (-1695.743) (-1696.228) (-1704.867) [-1695.182] -- 0:00:15
938000 -- [-1695.459] (-1689.377) (-1699.576) (-1699.082) * (-1698.618) (-1695.917) [-1693.962] (-1697.406) -- 0:00:15
938500 -- [-1699.104] (-1694.904) (-1703.185) (-1702.393) * (-1694.274) (-1701.357) (-1696.461) [-1695.972] -- 0:00:15
939000 -- [-1693.880] (-1699.275) (-1706.773) (-1693.687) * (-1699.338) (-1697.275) [-1694.222] (-1696.062) -- 0:00:15
939500 -- (-1694.534) (-1691.711) [-1700.794] (-1705.546) * [-1697.181] (-1699.706) (-1694.967) (-1700.536) -- 0:00:15
940000 -- (-1695.391) (-1697.082) [-1694.776] (-1693.936) * [-1692.562] (-1697.001) (-1695.902) (-1696.584) -- 0:00:15
Average standard deviation of split frequencies: 0.009522
940500 -- (-1695.655) [-1697.698] (-1694.886) (-1696.305) * (-1696.086) [-1697.665] (-1699.781) (-1698.650) -- 0:00:15
941000 -- (-1698.755) [-1694.632] (-1694.992) (-1694.609) * (-1690.703) (-1694.561) (-1696.721) [-1694.249] -- 0:00:14
941500 -- (-1692.168) [-1691.900] (-1690.605) (-1698.724) * (-1700.314) (-1692.103) [-1692.981] (-1696.506) -- 0:00:14
942000 -- (-1694.179) [-1694.526] (-1697.557) (-1697.921) * (-1695.178) [-1694.203] (-1690.534) (-1697.699) -- 0:00:14
942500 -- (-1695.159) (-1693.620) (-1699.928) [-1696.022] * (-1703.816) (-1704.586) (-1693.681) [-1697.958] -- 0:00:14
943000 -- (-1697.044) [-1693.546] (-1703.111) (-1694.745) * (-1701.859) (-1692.981) (-1708.674) [-1694.810] -- 0:00:14
943500 -- (-1699.445) (-1697.380) (-1693.837) [-1694.031] * (-1702.724) (-1693.873) (-1702.224) [-1692.785] -- 0:00:14
944000 -- (-1701.608) [-1695.213] (-1698.532) (-1695.283) * (-1702.753) (-1703.466) (-1701.471) [-1692.019] -- 0:00:14
944500 -- (-1696.962) [-1702.409] (-1696.363) (-1697.044) * (-1700.324) (-1704.702) (-1696.381) [-1691.213] -- 0:00:14
945000 -- [-1695.091] (-1700.344) (-1694.954) (-1698.678) * (-1695.613) (-1699.301) (-1697.793) [-1689.179] -- 0:00:13
Average standard deviation of split frequencies: 0.009219
945500 -- (-1694.313) [-1692.951] (-1694.991) (-1695.623) * [-1700.709] (-1693.824) (-1697.211) (-1693.393) -- 0:00:13
946000 -- (-1697.362) (-1697.852) [-1696.162] (-1695.719) * (-1700.330) (-1697.748) [-1698.031] (-1705.667) -- 0:00:13
946500 -- [-1696.611] (-1703.351) (-1697.672) (-1692.016) * (-1700.542) [-1700.644] (-1699.847) (-1703.878) -- 0:00:13
947000 -- [-1699.520] (-1696.293) (-1694.144) (-1694.193) * (-1704.306) (-1693.788) [-1690.553] (-1696.708) -- 0:00:13
947500 -- (-1698.370) [-1695.759] (-1699.328) (-1695.583) * (-1696.085) [-1702.049] (-1692.560) (-1697.794) -- 0:00:13
948000 -- [-1692.185] (-1694.064) (-1698.388) (-1694.507) * (-1696.015) (-1696.892) [-1697.111] (-1698.236) -- 0:00:13
948500 -- [-1700.817] (-1703.914) (-1702.072) (-1699.113) * (-1693.444) [-1695.106] (-1702.706) (-1690.442) -- 0:00:13
949000 -- (-1694.695) (-1703.190) [-1698.701] (-1698.862) * (-1697.781) (-1695.650) [-1695.607] (-1699.430) -- 0:00:12
949500 -- [-1694.130] (-1694.353) (-1704.172) (-1701.083) * (-1699.051) (-1699.452) (-1696.234) [-1698.097] -- 0:00:12
950000 -- (-1698.720) (-1706.252) [-1691.708] (-1701.158) * [-1694.167] (-1703.912) (-1696.201) (-1696.933) -- 0:00:12
Average standard deviation of split frequencies: 0.009917
950500 -- [-1691.233] (-1698.742) (-1693.237) (-1696.940) * (-1693.772) (-1700.395) (-1698.526) [-1701.454] -- 0:00:12
951000 -- (-1694.528) [-1692.391] (-1701.102) (-1704.972) * (-1691.000) (-1695.521) [-1699.291] (-1696.855) -- 0:00:12
951500 -- (-1702.425) (-1693.792) (-1696.405) [-1703.557] * (-1692.836) [-1701.802] (-1697.722) (-1694.439) -- 0:00:12
952000 -- (-1697.001) (-1697.112) [-1695.148] (-1697.892) * (-1697.777) [-1692.878] (-1702.602) (-1694.984) -- 0:00:12
952500 -- (-1696.247) (-1693.365) [-1693.779] (-1695.898) * [-1695.828] (-1693.466) (-1693.649) (-1708.630) -- 0:00:12
953000 -- (-1692.942) (-1692.282) [-1693.282] (-1694.866) * (-1696.232) (-1692.908) [-1697.557] (-1706.831) -- 0:00:11
953500 -- (-1695.726) [-1695.817] (-1704.088) (-1692.540) * [-1692.347] (-1703.389) (-1693.062) (-1696.284) -- 0:00:11
954000 -- (-1693.990) (-1693.484) (-1714.521) [-1696.565] * (-1693.734) [-1702.118] (-1697.525) (-1699.856) -- 0:00:11
954500 -- (-1691.060) (-1694.326) [-1704.342] (-1694.959) * (-1698.886) [-1693.227] (-1697.464) (-1698.264) -- 0:00:11
955000 -- (-1696.028) (-1693.544) (-1712.029) [-1690.992] * (-1694.037) (-1694.502) [-1704.154] (-1702.352) -- 0:00:11
Average standard deviation of split frequencies: 0.010478
955500 -- (-1699.790) [-1697.923] (-1706.286) (-1701.470) * (-1699.521) (-1703.284) (-1708.993) [-1694.358] -- 0:00:11
956000 -- (-1699.259) [-1696.779] (-1702.232) (-1698.978) * (-1695.764) [-1700.486] (-1701.822) (-1702.038) -- 0:00:11
956500 -- (-1703.875) (-1699.737) [-1696.248] (-1698.148) * [-1695.791] (-1696.829) (-1708.226) (-1694.840) -- 0:00:11
957000 -- [-1695.492] (-1693.843) (-1697.606) (-1692.274) * (-1695.949) (-1702.234) (-1699.348) [-1696.855] -- 0:00:10
957500 -- (-1702.519) [-1692.972] (-1696.593) (-1695.571) * (-1692.606) (-1692.553) [-1700.025] (-1697.852) -- 0:00:10
958000 -- (-1694.684) (-1696.447) [-1698.458] (-1703.257) * (-1696.678) (-1698.235) (-1698.339) [-1692.695] -- 0:00:10
958500 -- (-1693.280) (-1695.875) (-1699.020) [-1692.381] * (-1703.855) [-1695.839] (-1693.678) (-1698.102) -- 0:00:10
959000 -- [-1691.998] (-1695.813) (-1694.861) (-1704.003) * (-1695.596) [-1694.570] (-1705.677) (-1696.397) -- 0:00:10
959500 -- (-1698.413) (-1695.896) (-1706.746) [-1699.792] * [-1699.834] (-1695.606) (-1698.858) (-1700.169) -- 0:00:10
960000 -- (-1709.745) [-1699.245] (-1701.707) (-1693.973) * (-1696.368) [-1691.476] (-1697.275) (-1697.665) -- 0:00:10
Average standard deviation of split frequencies: 0.010427
960500 -- (-1699.171) [-1691.900] (-1698.788) (-1692.435) * (-1703.752) (-1699.010) [-1697.868] (-1695.870) -- 0:00:09
961000 -- (-1697.677) [-1695.799] (-1695.378) (-1699.687) * (-1703.027) (-1691.693) (-1695.955) [-1694.662] -- 0:00:09
961500 -- (-1696.418) (-1696.767) [-1702.191] (-1699.043) * (-1695.762) (-1710.530) [-1694.582] (-1694.740) -- 0:00:09
962000 -- (-1695.203) (-1705.386) (-1692.105) [-1693.912] * [-1698.084] (-1705.627) (-1691.844) (-1696.638) -- 0:00:09
962500 -- (-1698.515) (-1699.497) [-1693.281] (-1698.019) * (-1698.852) (-1692.410) (-1692.919) [-1694.425] -- 0:00:09
963000 -- (-1700.428) [-1699.728] (-1694.361) (-1701.914) * [-1693.656] (-1700.823) (-1699.920) (-1700.367) -- 0:00:09
963500 -- (-1701.786) (-1697.467) (-1698.549) [-1697.836] * (-1696.127) [-1693.352] (-1697.758) (-1698.923) -- 0:00:09
964000 -- (-1695.724) [-1693.458] (-1695.094) (-1699.516) * [-1693.024] (-1696.444) (-1699.301) (-1697.893) -- 0:00:09
964500 -- (-1702.990) (-1700.307) (-1698.803) [-1692.396] * (-1700.973) (-1693.397) [-1693.265] (-1704.762) -- 0:00:08
965000 -- (-1692.662) [-1697.178] (-1699.518) (-1699.439) * (-1699.962) (-1698.834) [-1695.260] (-1693.792) -- 0:00:08
Average standard deviation of split frequencies: 0.010614
965500 -- [-1694.265] (-1695.605) (-1698.195) (-1704.737) * (-1697.079) (-1694.229) [-1692.600] (-1696.267) -- 0:00:08
966000 -- (-1697.798) [-1694.219] (-1701.933) (-1696.899) * (-1695.080) (-1697.946) (-1699.873) [-1691.639] -- 0:00:08
966500 -- (-1692.509) (-1696.294) [-1695.988] (-1703.754) * (-1701.877) [-1694.946] (-1703.986) (-1699.133) -- 0:00:08
967000 -- (-1699.000) (-1695.993) [-1699.824] (-1698.329) * (-1694.743) [-1695.025] (-1693.014) (-1695.631) -- 0:00:08
967500 -- (-1692.458) (-1694.236) [-1701.287] (-1700.737) * (-1703.558) (-1699.834) [-1697.086] (-1695.870) -- 0:00:08
968000 -- (-1697.213) (-1697.242) (-1695.286) [-1695.249] * (-1697.065) (-1690.072) [-1697.213] (-1697.124) -- 0:00:08
968500 -- (-1699.199) (-1696.799) (-1694.823) [-1697.535] * (-1692.809) (-1693.640) [-1695.363] (-1702.542) -- 0:00:07
969000 -- (-1707.868) [-1699.989] (-1696.190) (-1695.292) * [-1694.621] (-1702.948) (-1700.324) (-1692.183) -- 0:00:07
969500 -- (-1699.273) (-1692.208) [-1697.317] (-1694.721) * (-1692.150) (-1696.692) (-1699.556) [-1701.145] -- 0:00:07
970000 -- [-1694.907] (-1695.526) (-1691.503) (-1698.830) * (-1700.832) [-1698.840] (-1696.093) (-1692.652) -- 0:00:07
Average standard deviation of split frequencies: 0.010320
970500 -- (-1703.132) [-1693.946] (-1705.083) (-1693.963) * [-1688.830] (-1699.027) (-1700.380) (-1696.634) -- 0:00:07
971000 -- (-1696.837) (-1694.060) (-1701.468) [-1691.944] * (-1695.524) (-1701.026) (-1694.957) [-1698.928] -- 0:00:07
971500 -- (-1691.422) [-1694.405] (-1696.988) (-1699.164) * (-1692.530) [-1697.484] (-1694.532) (-1696.195) -- 0:00:07
972000 -- (-1702.264) (-1696.453) [-1699.709] (-1694.791) * (-1695.086) [-1693.134] (-1693.071) (-1702.825) -- 0:00:07
972500 -- (-1698.825) (-1698.838) [-1699.222] (-1697.229) * (-1697.976) (-1695.582) [-1690.162] (-1701.418) -- 0:00:06
973000 -- (-1692.845) (-1691.912) [-1692.090] (-1689.262) * (-1694.640) [-1698.078] (-1696.400) (-1696.666) -- 0:00:06
973500 -- (-1698.956) [-1702.682] (-1694.180) (-1699.704) * [-1698.727] (-1697.373) (-1695.788) (-1697.327) -- 0:00:06
974000 -- (-1699.971) (-1696.156) (-1694.998) [-1700.380] * (-1699.839) [-1693.215] (-1698.382) (-1694.573) -- 0:00:06
974500 -- (-1692.139) (-1691.305) [-1700.896] (-1699.514) * (-1697.554) (-1697.096) [-1691.063] (-1694.107) -- 0:00:06
975000 -- (-1695.348) [-1696.992] (-1698.785) (-1700.344) * [-1692.365] (-1697.843) (-1691.019) (-1698.885) -- 0:00:06
Average standard deviation of split frequencies: 0.009781
975500 -- [-1697.702] (-1696.208) (-1694.003) (-1697.504) * (-1700.155) [-1699.504] (-1701.978) (-1697.882) -- 0:00:06
976000 -- (-1694.281) (-1700.312) [-1694.160] (-1702.432) * (-1695.504) (-1699.930) (-1692.830) [-1694.212] -- 0:00:06
976500 -- (-1695.910) (-1695.636) [-1694.150] (-1693.552) * (-1691.725) (-1698.936) [-1698.719] (-1691.390) -- 0:00:05
977000 -- (-1698.650) [-1695.588] (-1703.459) (-1692.782) * [-1694.114] (-1699.398) (-1699.771) (-1692.272) -- 0:00:05
977500 -- (-1691.868) (-1693.610) [-1692.987] (-1701.010) * (-1697.146) (-1701.440) (-1691.626) [-1694.578] -- 0:00:05
978000 -- (-1690.370) [-1694.666] (-1700.082) (-1697.809) * (-1698.526) [-1695.579] (-1701.653) (-1697.625) -- 0:00:05
978500 -- (-1702.485) (-1703.081) [-1692.292] (-1693.369) * (-1699.042) [-1690.407] (-1695.016) (-1703.731) -- 0:00:05
979000 -- (-1701.514) [-1694.240] (-1705.349) (-1691.326) * (-1692.596) (-1694.280) (-1697.828) [-1696.603] -- 0:00:05
979500 -- (-1698.633) (-1699.232) (-1701.130) [-1693.223] * (-1694.992) (-1698.950) (-1692.639) [-1701.545] -- 0:00:05
980000 -- [-1691.761] (-1695.275) (-1699.309) (-1693.033) * (-1694.785) [-1693.430] (-1695.031) (-1700.997) -- 0:00:05
Average standard deviation of split frequencies: 0.009133
980500 -- (-1696.828) (-1695.393) (-1696.487) [-1701.011] * [-1695.702] (-1695.815) (-1694.941) (-1693.779) -- 0:00:04
981000 -- (-1702.303) (-1700.769) (-1702.591) [-1699.874] * (-1703.681) [-1693.254] (-1694.020) (-1694.647) -- 0:00:04
981500 -- [-1694.364] (-1698.911) (-1701.763) (-1699.084) * [-1698.728] (-1699.558) (-1697.084) (-1696.567) -- 0:00:04
982000 -- (-1695.066) [-1702.917] (-1702.930) (-1702.627) * (-1694.825) (-1697.932) (-1703.661) [-1697.821] -- 0:00:04
982500 -- (-1697.977) (-1693.994) [-1690.591] (-1692.045) * (-1695.631) (-1699.227) [-1700.922] (-1706.808) -- 0:00:04
983000 -- (-1696.269) [-1693.913] (-1695.977) (-1698.859) * (-1701.949) (-1701.964) (-1699.326) [-1700.804] -- 0:00:04
983500 -- [-1697.167] (-1695.715) (-1702.740) (-1694.693) * (-1697.850) (-1700.911) (-1697.077) [-1691.869] -- 0:00:04
984000 -- (-1689.805) [-1694.229] (-1695.407) (-1698.914) * (-1697.733) (-1702.664) [-1695.779] (-1694.656) -- 0:00:04
984500 -- (-1693.174) (-1697.963) [-1697.707] (-1699.764) * [-1701.896] (-1699.588) (-1699.067) (-1696.864) -- 0:00:03
985000 -- (-1695.287) (-1695.771) [-1693.566] (-1699.541) * [-1702.906] (-1697.227) (-1695.675) (-1710.360) -- 0:00:03
Average standard deviation of split frequencies: 0.008486
985500 -- [-1695.322] (-1692.322) (-1695.121) (-1705.522) * (-1698.558) (-1698.394) [-1696.885] (-1698.381) -- 0:00:03
986000 -- (-1691.375) (-1695.996) (-1697.711) [-1699.396] * (-1694.112) [-1692.792] (-1696.708) (-1697.967) -- 0:00:03
986500 -- (-1706.802) [-1689.680] (-1701.300) (-1695.651) * (-1697.662) (-1698.125) (-1693.391) [-1698.999] -- 0:00:03
987000 -- (-1695.086) (-1689.962) [-1694.378] (-1694.923) * (-1703.869) [-1700.553] (-1704.106) (-1698.998) -- 0:00:03
987500 -- (-1708.777) (-1698.003) [-1689.525] (-1693.563) * [-1692.753] (-1697.686) (-1696.979) (-1697.113) -- 0:00:03
988000 -- (-1699.953) (-1708.114) (-1696.700) [-1694.348] * (-1701.661) (-1703.578) [-1700.522] (-1693.062) -- 0:00:03
988500 -- (-1699.401) (-1697.261) [-1690.127] (-1691.925) * [-1693.106] (-1698.297) (-1704.748) (-1698.323) -- 0:00:02
989000 -- (-1696.697) [-1696.992] (-1698.030) (-1701.555) * (-1701.850) (-1693.745) (-1700.244) [-1697.697] -- 0:00:02
989500 -- (-1701.846) [-1694.404] (-1700.450) (-1701.639) * (-1698.493) (-1699.095) [-1700.562] (-1693.493) -- 0:00:02
990000 -- (-1701.521) [-1694.905] (-1695.829) (-1691.755) * (-1691.526) (-1698.962) [-1697.938] (-1698.297) -- 0:00:02
Average standard deviation of split frequencies: 0.009398
990500 -- (-1698.655) [-1699.012] (-1690.629) (-1698.492) * (-1697.292) (-1698.241) [-1699.259] (-1698.214) -- 0:00:02
991000 -- (-1701.721) (-1702.829) [-1694.513] (-1694.756) * (-1697.346) (-1706.637) [-1700.310] (-1697.922) -- 0:00:02
991500 -- (-1694.352) (-1699.482) [-1697.671] (-1703.930) * (-1696.213) [-1697.183] (-1697.753) (-1703.790) -- 0:00:02
992000 -- (-1693.040) (-1705.935) (-1701.467) [-1690.462] * [-1694.543] (-1693.269) (-1698.010) (-1701.213) -- 0:00:02
992500 -- (-1697.953) (-1700.820) (-1695.805) [-1698.259] * (-1695.576) (-1692.191) [-1697.885] (-1702.135) -- 0:00:01
993000 -- (-1696.473) (-1706.469) [-1695.111] (-1695.931) * (-1699.161) (-1699.468) (-1694.490) [-1699.808] -- 0:00:01
993500 -- (-1695.170) (-1702.740) [-1693.633] (-1697.991) * (-1697.157) [-1694.580] (-1694.166) (-1707.306) -- 0:00:01
994000 -- (-1704.499) (-1701.412) (-1693.653) [-1694.247] * [-1697.097] (-1701.095) (-1700.264) (-1707.858) -- 0:00:01
994500 -- (-1696.121) (-1702.238) [-1697.008] (-1698.276) * (-1708.278) [-1692.145] (-1704.242) (-1698.288) -- 0:00:01
995000 -- (-1691.284) [-1693.481] (-1698.272) (-1690.908) * (-1697.274) [-1689.727] (-1695.792) (-1699.184) -- 0:00:01
Average standard deviation of split frequencies: 0.008756
995500 -- (-1699.846) (-1701.228) (-1694.801) [-1692.448] * [-1699.293] (-1700.422) (-1698.636) (-1695.508) -- 0:00:01
996000 -- (-1697.992) (-1692.427) (-1697.786) [-1692.406] * [-1701.285] (-1703.364) (-1696.686) (-1712.716) -- 0:00:01
996500 -- [-1700.700] (-1692.735) (-1700.334) (-1692.670) * (-1699.023) (-1696.670) (-1695.905) [-1693.984] -- 0:00:00
997000 -- (-1701.766) (-1702.326) (-1703.858) [-1696.681] * [-1693.758] (-1692.787) (-1695.869) (-1700.770) -- 0:00:00
997500 -- (-1700.018) [-1692.378] (-1699.211) (-1703.247) * (-1698.883) (-1691.995) [-1693.482] (-1691.496) -- 0:00:00
998000 -- (-1700.329) [-1704.399] (-1700.123) (-1699.374) * (-1692.868) (-1696.606) (-1696.734) [-1696.367] -- 0:00:00
998500 -- (-1693.057) [-1705.040] (-1697.152) (-1699.304) * (-1694.533) (-1696.038) [-1695.583] (-1697.717) -- 0:00:00
999000 -- (-1696.564) (-1693.567) (-1698.222) [-1693.757] * (-1699.766) (-1692.470) [-1695.799] (-1697.519) -- 0:00:00
999500 -- (-1698.991) (-1694.907) (-1692.425) [-1691.907] * [-1693.472] (-1694.137) (-1699.852) (-1691.978) -- 0:00:00
1000000 -- [-1696.229] (-1696.884) (-1694.215) (-1692.540) * (-1695.272) (-1693.259) (-1698.266) [-1699.955] -- 0:00:00
Average standard deviation of split frequencies: 0.009775
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1696.228881 -- 14.629188
Chain 1 -- -1696.228878 -- 14.629188
Chain 2 -- -1696.883951 -- 11.767296
Chain 2 -- -1696.883946 -- 11.767296
Chain 3 -- -1694.214575 -- 16.379661
Chain 3 -- -1694.214583 -- 16.379661
Chain 4 -- -1692.540426 -- 14.280557
Chain 4 -- -1692.540425 -- 14.280557
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1695.271638 -- 14.968715
Chain 1 -- -1695.271635 -- 14.968715
Chain 2 -- -1693.258868 -- 13.907278
Chain 2 -- -1693.258867 -- 13.907278
Chain 3 -- -1698.266040 -- 10.608496
Chain 3 -- -1698.266040 -- 10.608496
Chain 4 -- -1699.955199 -- 16.404594
Chain 4 -- -1699.955196 -- 16.404594
Analysis completed in 4 mins 13 seconds
Analysis used 253.24 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1686.74
Likelihood of best state for "cold" chain of run 2 was -1686.74
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
56.2 % ( 39 %) Dirichlet(Revmat{all})
71.4 % ( 53 %) Slider(Revmat{all})
26.9 % ( 36 %) Dirichlet(Pi{all})
28.7 % ( 26 %) Slider(Pi{all})
50.9 % ( 34 %) Multiplier(Alpha{1,2})
47.4 % ( 21 %) Multiplier(Alpha{3})
61.9 % ( 35 %) Slider(Pinvar{all})
5.8 % ( 9 %) ExtSPR(Tau{all},V{all})
2.7 % ( 5 %) ExtTBR(Tau{all},V{all})
11.0 % ( 14 %) NNI(Tau{all},V{all})
15.1 % ( 17 %) ParsSPR(Tau{all},V{all})
26.1 % ( 26 %) Multiplier(V{all})
37.5 % ( 36 %) Nodeslider(V{all})
25.6 % ( 35 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
56.9 % ( 40 %) Dirichlet(Revmat{all})
71.7 % ( 48 %) Slider(Revmat{all})
26.8 % ( 39 %) Dirichlet(Pi{all})
29.0 % ( 28 %) Slider(Pi{all})
51.6 % ( 25 %) Multiplier(Alpha{1,2})
47.7 % ( 32 %) Multiplier(Alpha{3})
61.8 % ( 37 %) Slider(Pinvar{all})
5.7 % ( 10 %) ExtSPR(Tau{all},V{all})
2.7 % ( 2 %) ExtTBR(Tau{all},V{all})
10.7 % ( 14 %) NNI(Tau{all},V{all})
14.8 % ( 19 %) ParsSPR(Tau{all},V{all})
26.3 % ( 24 %) Multiplier(V{all})
37.6 % ( 36 %) Nodeslider(V{all})
25.6 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.82 0.66 0.53
2 | 166147 0.83 0.68
3 | 166551 166905 0.84
4 | 166566 166688 167143
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.82 0.66 0.53
2 | 166305 0.84 0.69
3 | 166443 167332 0.85
4 | 166284 166238 167398
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1694.12
| 1 |
| 2 1 |
| 1 1 |
| 2 2 |
| 2 2 2 1 1 22 |
| * 11 1 1 2 2 11|
|2 1 1 2 1 2 12 1 121 1 2 |
| 12 1 2 2 1 12 1 1 1 1 |
|1 2 1 2 21 2 2 1 2 1 1 |
| 22 2 1 2 2 * 1 2 2 2 |
| 1 2 1 22 1 2 2 212 2 1 2|
| 11 * 1 11 2 2 2 12 |
| 1 2 1 1 1 121 2 * 2 2 |
| 2 212 2 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1697.51
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1692.65 -1705.14
2 -1692.85 -1702.24
--------------------------------------
TOTAL -1692.75 -1704.50
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.506578 0.007073 0.361108 0.670111 0.495668 920.60 997.90 1.000
r(A<->C){all} 0.170509 0.001529 0.097060 0.245350 0.167931 893.31 924.09 1.000
r(A<->G){all} 0.197010 0.002213 0.112188 0.296008 0.193956 850.66 909.93 1.001
r(A<->T){all} 0.123414 0.002214 0.030770 0.211138 0.119182 677.89 775.02 1.000
r(C<->G){all} 0.090219 0.000590 0.044900 0.137673 0.088253 1138.17 1233.83 1.000
r(C<->T){all} 0.292183 0.003052 0.187053 0.402400 0.289274 888.08 989.77 1.001
r(G<->T){all} 0.126666 0.001651 0.049174 0.202676 0.123289 790.76 841.88 1.000
pi(A){all} 0.212022 0.000221 0.181706 0.239809 0.211460 1081.91 1190.51 1.000
pi(C){all} 0.343399 0.000278 0.310632 0.375300 0.343247 1046.62 1136.12 1.000
pi(G){all} 0.279716 0.000270 0.247147 0.311505 0.279325 1011.72 1033.04 1.000
pi(T){all} 0.164863 0.000182 0.138784 0.190885 0.164897 958.73 973.89 1.000
alpha{1,2} 0.098085 0.003158 0.000124 0.190499 0.098957 938.30 963.26 1.000
alpha{3} 1.965737 0.582422 0.657116 3.419758 1.840381 959.30 1188.08 1.000
pinvar{all} 0.306525 0.011893 0.087535 0.503839 0.309316 806.78 959.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- ...***
9 -- ...**.
10 -- ....**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 3000 0.999334 0.000942 0.998668 1.000000 2
8 2959 0.985676 0.004240 0.982678 0.988674 2
9 1874 0.624250 0.018844 0.610926 0.637575 2
10 964 0.321119 0.015075 0.310460 0.331779 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.021658 0.000075 0.007065 0.039524 0.020570 1.000 2
length{all}[2] 0.021833 0.000062 0.008271 0.038211 0.020769 1.000 2
length{all}[3] 0.017961 0.000048 0.005665 0.031002 0.017104 1.000 2
length{all}[4] 0.060820 0.000256 0.030651 0.091874 0.059227 1.000 2
length{all}[5] 0.045185 0.000235 0.017123 0.076316 0.043712 1.000 2
length{all}[6] 0.259547 0.004275 0.149301 0.392231 0.249672 1.000 2
length{all}[7] 0.020710 0.000072 0.005677 0.037672 0.019444 1.000 2
length{all}[8] 0.039402 0.000285 0.007520 0.071097 0.037720 1.000 2
length{all}[9] 0.022085 0.000175 0.000044 0.046659 0.019806 1.000 2
length{all}[10] 0.017080 0.000143 0.000006 0.039765 0.014684 1.001 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009775
Maximum standard deviation of split frequencies = 0.018844
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------ C2 (2)
|----------------------100----------------------+
| \------------------------ C3 (3)
+
| /------------------------ C4 (4)
| /-----------62----------+
| | \------------------------ C5 (5)
\-----------99----------+
\------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----- C1 (1)
|
| /----- C2 (2)
|----+
| \---- C3 (3)
+
| /--------------- C4 (4)
| /----+
| | \----------- C5 (5)
\--------+
\--------------------------------------------------------------- C6 (6)
|-----------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (7 trees sampled):
90 % credible set contains 2 trees
95 % credible set contains 3 trees
99 % credible set contains 4 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 6 ls = 696
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
51 ambiguity characters in seq. 1
51 ambiguity characters in seq. 2
51 ambiguity characters in seq. 3
48 ambiguity characters in seq. 4
63 ambiguity characters in seq. 5
36 ambiguity characters in seq. 6
23 sites are removed. 8 9 10 11 185 186 187 204 205 206 215 216 217 218 224 225 226 227 228 229 230 231 232
Sequences read..
Counting site patterns.. 0:00
133 patterns at 209 / 209 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
129808 bytes for conP
18088 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (2, 3), ((4, 5), 6)); MP score: 136
259616 bytes for conP, adjusted
0.045058 0.036093 0.031665 0.048232 0.062031 0.015183 0.107982 0.089003 0.364256 0.300000 1.300000
ntime & nrate & np: 9 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 11
lnL0 = -1701.244166
Iterating by ming2
Initial: fx= 1701.244166
x= 0.04506 0.03609 0.03166 0.04823 0.06203 0.01518 0.10798 0.08900 0.36426 0.30000 1.30000
1 h-m-p 0.0000 0.0013 250.9609 ++YCYCCC 1695.545094 5 0.0003 26 | 0/11
2 h-m-p 0.0004 0.0025 186.0440 +CYYCCC 1667.919119 5 0.0020 50 | 0/11
3 h-m-p 0.0001 0.0006 1871.1879 +CCCC 1629.347905 3 0.0005 71 | 0/11
4 h-m-p 0.0000 0.0002 447.0167 ++ 1624.462174 m 0.0002 85 | 0/11
5 h-m-p 0.0000 0.0000 736.6107
h-m-p: 1.29698676e-20 6.48493382e-20 7.36610698e+02 1624.462174
.. | 0/11
6 h-m-p 0.0000 0.0008 885.8978 +YYCCCC 1616.470130 5 0.0001 119 | 0/11
7 h-m-p 0.0002 0.0008 188.3827 +YYCYCC 1604.561630 5 0.0006 141 | 0/11
8 h-m-p 0.0001 0.0004 429.6016 +YYCCCC 1595.820122 5 0.0002 164 | 0/11
9 h-m-p 0.0003 0.0014 385.7335 +YYYYYCYCYC 1552.715530 10 0.0012 191 | 0/11
10 h-m-p 0.0003 0.0014 81.3529 YYCC 1552.172365 3 0.0002 209 | 0/11
11 h-m-p 0.0018 0.0479 9.2290 CYC 1552.148856 2 0.0005 226 | 0/11
12 h-m-p 0.0009 0.0416 5.1217 CC 1552.127878 1 0.0013 242 | 0/11
13 h-m-p 0.0009 0.1938 7.6649 ++CYC 1551.798218 2 0.0141 261 | 0/11
14 h-m-p 0.0005 0.0063 215.9426 YCCC 1550.944279 3 0.0012 280 | 0/11
15 h-m-p 0.0033 0.0167 48.4040 YCC 1550.857182 2 0.0006 297 | 0/11
16 h-m-p 0.0058 0.0291 2.2935 CCC 1550.834089 2 0.0018 315 | 0/11
17 h-m-p 0.0012 0.1465 3.3338 ++YCCCC 1548.235345 4 0.0439 338 | 0/11
18 h-m-p 1.6000 8.0000 0.0442 CCC 1547.669066 2 1.5698 356 | 0/11
19 h-m-p 1.6000 8.0000 0.0224 YCC 1547.604635 2 1.1675 384 | 0/11
20 h-m-p 1.6000 8.0000 0.0073 CCC 1547.577889 2 1.8643 413 | 0/11
21 h-m-p 1.6000 8.0000 0.0082 CC 1547.556794 1 2.4082 440 | 0/11
22 h-m-p 1.6000 8.0000 0.0047 CC 1547.550372 1 1.3286 467 | 0/11
23 h-m-p 1.6000 8.0000 0.0030 YC 1547.550036 1 0.9754 493 | 0/11
24 h-m-p 1.6000 8.0000 0.0004 Y 1547.550019 0 0.9472 518 | 0/11
25 h-m-p 1.6000 8.0000 0.0001 Y 1547.550018 0 1.0114 543 | 0/11
26 h-m-p 1.6000 8.0000 0.0000 Y 1547.550018 0 1.0263 568 | 0/11
27 h-m-p 1.6000 8.0000 0.0000 C 1547.550018 0 1.6000 593 | 0/11
28 h-m-p 1.6000 8.0000 0.0000 -------------C 1547.550018 0 0.0000 631
Out..
lnL = -1547.550018
632 lfun, 632 eigenQcodon, 5688 P(t)
Time used: 0:02
Model 1: NearlyNeutral
TREE # 1
(1, (2, 3), ((4, 5), 6)); MP score: 136
0.045058 0.036093 0.031665 0.048232 0.062031 0.015183 0.107982 0.089003 0.364256 1.213294 0.747245 0.296991
ntime & nrate & np: 9 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.295841
np = 12
lnL0 = -1585.726019
Iterating by ming2
Initial: fx= 1585.726019
x= 0.04506 0.03609 0.03166 0.04823 0.06203 0.01518 0.10798 0.08900 0.36426 1.21329 0.74724 0.29699
1 h-m-p 0.0000 0.0021 225.1811 +++YCYCYCC 1570.666900 6 0.0015 30 | 0/12
2 h-m-p 0.0000 0.0002 663.5666 +YCYCCC 1561.131216 5 0.0001 54 | 0/12
3 h-m-p 0.0001 0.0005 124.0132 CCCCC 1560.318322 4 0.0001 77 | 0/12
4 h-m-p 0.0003 0.0036 53.9673 +YYYC 1558.980247 3 0.0011 96 | 0/12
5 h-m-p 0.0007 0.0033 50.2226 CCCCC 1558.343843 4 0.0008 119 | 0/12
6 h-m-p 0.0013 0.0066 20.6280 YCC 1558.228222 2 0.0007 137 | 0/12
7 h-m-p 0.0021 0.0463 6.8964 CCC 1558.140405 2 0.0033 156 | 0/12
8 h-m-p 0.0026 0.0318 8.7835 CCC 1558.073801 2 0.0021 175 | 0/12
9 h-m-p 0.0041 0.1925 4.5212 +CCC 1557.806880 2 0.0135 195 | 0/12
10 h-m-p 0.0027 0.0544 22.3297 +CCCCC 1555.700007 4 0.0178 219 | 0/12
11 h-m-p 0.0017 0.0083 166.1426 CYC 1554.383390 2 0.0015 237 | 0/12
12 h-m-p 0.0068 0.0341 5.2082 YCC 1554.268509 2 0.0027 255 | 0/12
13 h-m-p 0.0030 0.0927 4.7000 ++CYCCC 1544.344492 4 0.0690 280 | 0/12
14 h-m-p 0.0168 0.0839 1.3097 +YYCCC 1539.940992 4 0.0632 302 | 0/12
15 h-m-p 0.1048 1.3625 0.7902 +YCCCCC 1535.886152 5 0.4774 327 | 0/12
16 h-m-p 0.7484 3.7418 0.0596 CCC 1534.274947 2 0.9648 358 | 0/12
17 h-m-p 0.3661 2.0784 0.1571 YCCC 1533.566303 3 0.6371 390 | 0/12
18 h-m-p 1.4882 8.0000 0.0672 YCCC 1533.232911 3 0.8716 422 | 0/12
19 h-m-p 1.6000 8.0000 0.0307 YCC 1533.006079 2 1.1547 452 | 0/12
20 h-m-p 0.7533 8.0000 0.0470 CC 1532.896288 1 1.1017 481 | 0/12
21 h-m-p 1.4951 8.0000 0.0346 YC 1532.875607 1 0.7290 509 | 0/12
22 h-m-p 1.6000 8.0000 0.0044 YC 1532.873077 1 0.7081 537 | 0/12
23 h-m-p 1.2666 8.0000 0.0024 YC 1532.872745 1 0.6946 565 | 0/12
24 h-m-p 1.6000 8.0000 0.0007 Y 1532.872712 0 0.6770 592 | 0/12
25 h-m-p 1.6000 8.0000 0.0003 Y 1532.872708 0 0.7482 619 | 0/12
26 h-m-p 1.6000 8.0000 0.0000 Y 1532.872708 0 0.7988 646 | 0/12
27 h-m-p 1.6000 8.0000 0.0000 C 1532.872708 0 0.5992 673 | 0/12
28 h-m-p 1.6000 8.0000 0.0000 Y 1532.872708 0 0.9384 700 | 0/12
29 h-m-p 1.6000 8.0000 0.0000 Y 1532.872708 0 0.4000 727 | 0/12
30 h-m-p 0.5285 8.0000 0.0000 -Y 1532.872708 0 0.0330 755
Out..
lnL = -1532.872708
756 lfun, 2268 eigenQcodon, 13608 P(t)
Time used: 0:07
Model 2: PositiveSelection
TREE # 1
(1, (2, 3), ((4, 5), 6)); MP score: 136
initial w for M2:NSpselection reset.
0.045058 0.036093 0.031665 0.048232 0.062031 0.015183 0.107982 0.089003 0.364256 1.244185 0.896732 0.199894 0.157918 2.073080
ntime & nrate & np: 9 3 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 6.411603
np = 14
lnL0 = -1604.579304
Iterating by ming2
Initial: fx= 1604.579304
x= 0.04506 0.03609 0.03166 0.04823 0.06203 0.01518 0.10798 0.08900 0.36426 1.24418 0.89673 0.19989 0.15792 2.07308
1 h-m-p 0.0000 0.0020 262.3365 +++CYCCC 1596.810885 4 0.0004 30 | 0/14
2 h-m-p 0.0002 0.0010 145.5940 ++ 1580.592249 m 0.0010 47 | 1/14
3 h-m-p 0.0006 0.0093 152.8807 +CCCC 1571.220142 3 0.0026 71 | 0/14
4 h-m-p 0.0006 0.0073 660.2489 CCC 1568.645276 2 0.0002 92 | 0/14
5 h-m-p 0.0008 0.0040 151.4025 YCC 1564.598350 2 0.0015 112 | 0/14
6 h-m-p 0.0008 0.0038 94.4425 YCYCCC 1561.133017 5 0.0019 137 | 0/14
7 h-m-p 0.0006 0.0031 81.5634 +YCYCC 1558.917782 4 0.0018 161 | 0/14
8 h-m-p 0.0021 0.0142 72.1726 YCCC 1555.645287 3 0.0041 183 | 0/14
9 h-m-p 0.0034 0.0169 54.8948 CYC 1555.128467 2 0.0010 203 | 0/14
10 h-m-p 0.0027 0.0137 17.3677 CCCC 1554.460019 3 0.0038 226 | 0/14
11 h-m-p 0.0025 0.0128 26.5916 CCCCC 1553.167187 4 0.0039 251 | 0/14
12 h-m-p 0.0040 0.0198 23.2260 +CYCCC 1543.307333 4 0.0174 277 | 0/14
13 h-m-p 0.1766 0.8828 2.1938 CCCCC 1540.564029 4 0.2358 302 | 0/14
14 h-m-p 0.1181 0.5904 3.9249 CCCCC 1537.174816 4 0.1622 327 | 0/14
15 h-m-p 0.0947 0.4737 3.6088 YCCC 1536.499574 3 0.0679 349 | 0/14
16 h-m-p 0.3985 3.2144 0.6149 YCY 1534.653012 2 0.6656 369 | 0/14
17 h-m-p 0.4124 2.0622 0.3494 CCCCC 1533.804053 4 0.4843 408 | 0/14
18 h-m-p 0.7495 3.7475 0.1960 CCC 1533.194900 2 1.1055 443 | 0/14
19 h-m-p 0.7592 8.0000 0.2854 YCCC 1533.002728 3 0.4822 479 | 0/14
20 h-m-p 0.5836 4.7384 0.2358 YCC 1532.922538 2 0.4256 513 | 0/14
21 h-m-p 0.8868 8.0000 0.1132 CC 1532.883934 1 0.9922 546 | 0/14
22 h-m-p 1.2516 8.0000 0.0897 YC 1532.869142 1 0.6191 578 | 0/14
23 h-m-p 0.4620 8.0000 0.1202 +CC 1532.816737 1 2.7456 612 | 0/14
24 h-m-p 1.2118 7.2864 0.2724 YC 1532.789101 1 0.6717 644 | 0/14
25 h-m-p 0.8526 8.0000 0.2146 CCC 1532.766819 2 0.9809 679 | 0/14
26 h-m-p 1.6000 8.0000 0.0411 YC 1532.764267 1 0.8724 711 | 0/14
27 h-m-p 0.8942 8.0000 0.0401 CC 1532.762762 1 1.4325 744 | 0/14
28 h-m-p 1.6000 8.0000 0.0299 YC 1532.761568 1 2.7931 776 | 0/14
29 h-m-p 0.9339 8.0000 0.0893 +CC 1532.757867 1 3.7882 810 | 0/14
30 h-m-p 1.0880 8.0000 0.3109 YY 1532.754552 1 0.9484 842 | 0/14
31 h-m-p 1.6000 8.0000 0.0818 YC 1532.752720 1 1.1375 874 | 0/14
32 h-m-p 0.7686 8.0000 0.1210 YC 1532.751882 1 1.7547 906 | 0/14
33 h-m-p 1.6000 8.0000 0.0459 YC 1532.751386 1 1.0236 938 | 0/14
34 h-m-p 0.4625 8.0000 0.1015 +YC 1532.751204 1 1.2214 971 | 0/14
35 h-m-p 1.6000 8.0000 0.0276 C 1532.751166 0 1.5934 1002 | 0/14
36 h-m-p 1.6000 8.0000 0.0208 C 1532.751161 0 0.5716 1033 | 0/14
37 h-m-p 1.6000 8.0000 0.0068 Y 1532.751160 0 0.8149 1064 | 0/14
38 h-m-p 1.6000 8.0000 0.0007 Y 1532.751160 0 1.0307 1095 | 0/14
39 h-m-p 1.0858 8.0000 0.0007 Y 1532.751160 0 0.7976 1126 | 0/14
40 h-m-p 1.6000 8.0000 0.0001 Y 1532.751160 0 1.6000 1157 | 0/14
41 h-m-p 1.6000 8.0000 0.0000 C 1532.751160 0 1.6000 1188 | 0/14
42 h-m-p 1.6000 8.0000 0.0000 -Y 1532.751160 0 0.1000 1220 | 0/14
43 h-m-p 0.0160 8.0000 0.0500 -----Y 1532.751160 0 0.0000 1256 | 0/14
44 h-m-p 0.0160 8.0000 0.0000 -------------.. | 0/14
45 h-m-p 0.0160 8.0000 0.0002 ------------- | 0/14
46 h-m-p 0.0160 8.0000 0.0002 -------------
Out..
lnL = -1532.751160
1383 lfun, 5532 eigenQcodon, 37341 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1541.340018 S = -1465.761437 -67.151413
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 133 patterns 0:21
did 20 / 133 patterns 0:21
did 30 / 133 patterns 0:21
did 40 / 133 patterns 0:21
did 50 / 133 patterns 0:21
did 60 / 133 patterns 0:21
did 70 / 133 patterns 0:21
did 80 / 133 patterns 0:22
did 90 / 133 patterns 0:22
did 100 / 133 patterns 0:22
did 110 / 133 patterns 0:22
did 120 / 133 patterns 0:22
did 130 / 133 patterns 0:22
did 133 / 133 patterns 0:22
Time used: 0:22
Model 3: discrete
TREE # 1
(1, (2, 3), ((4, 5), 6)); MP score: 136
0.045058 0.036093 0.031665 0.048232 0.062031 0.015183 0.107982 0.089003 0.364256 1.252662 0.215184 0.509770 0.046108 0.115497 0.167375
ntime & nrate & np: 9 4 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 18.831934
np = 15
lnL0 = -1546.539286
Iterating by ming2
Initial: fx= 1546.539286
x= 0.04506 0.03609 0.03166 0.04823 0.06203 0.01518 0.10798 0.08900 0.36426 1.25266 0.21518 0.50977 0.04611 0.11550 0.16737
1 h-m-p 0.0000 0.0008 133.6324 ++YCCC 1544.029889 3 0.0003 42 | 0/15
2 h-m-p 0.0001 0.0003 107.1170 ++ 1541.908769 m 0.0003 75 | 1/15
3 h-m-p 0.0000 0.0002 888.8191 ++ 1539.215777 m 0.0002 108 | 2/15
4 h-m-p 0.0010 0.0050 39.7031 YCC 1538.931639 2 0.0006 143 | 1/15
5 h-m-p 0.0001 0.0004 504.6372 YC 1538.865158 1 0.0000 175 | 1/15
6 h-m-p 0.0003 0.0090 43.4051 +CCC 1538.431638 2 0.0009 212 | 0/15
7 h-m-p 0.0007 0.0035 48.1583 YCCC 1537.922868 3 0.0005 249 | 0/15
8 h-m-p 0.0008 0.0039 24.1319 YCC 1537.811851 2 0.0004 285 | 0/15
9 h-m-p 0.0006 0.0057 16.4178 YC 1537.692172 1 0.0012 319 | 0/15
10 h-m-p 0.0024 0.0316 8.6503 CC 1537.588766 1 0.0029 354 | 0/15
11 h-m-p 0.0011 0.0117 23.9591 CCC 1537.492423 2 0.0011 391 | 0/15
12 h-m-p 0.0020 0.0373 12.8336 YCCC 1537.300630 3 0.0044 429 | 0/15
13 h-m-p 0.0014 0.0338 40.9965 +CCCCC 1535.959998 4 0.0092 471 | 0/15
14 h-m-p 0.0007 0.0035 63.0633 YCCC 1535.864806 3 0.0005 509 | 0/15
15 h-m-p 0.0341 0.1707 0.6685 YCCCC 1535.067644 4 0.0793 549 | 0/15
16 h-m-p 0.1110 6.2973 0.4775 +YCC 1534.939684 2 0.3563 586 | 0/15
17 h-m-p 0.0895 1.4582 1.9001 YCCC 1534.640081 3 0.1822 624 | 0/15
18 h-m-p 1.6000 8.0000 0.1818 CCC 1534.174137 2 2.1176 661 | 0/15
19 h-m-p 0.6466 8.0000 0.5952 CCCC 1533.898948 3 0.9741 700 | 0/15
20 h-m-p 0.9526 8.0000 0.6086 CC 1533.528754 1 0.8020 735 | 0/15
21 h-m-p 1.6000 8.0000 0.0785 CCC 1533.228666 2 2.0843 772 | 0/15
22 h-m-p 1.6000 8.0000 0.0331 CC 1533.115923 1 1.6118 807 | 0/15
23 h-m-p 0.4076 8.0000 0.1310 +CC 1533.046737 1 1.6732 843 | 0/15
24 h-m-p 1.6000 8.0000 0.0881 CCCC 1532.891730 3 2.5394 882 | 0/15
25 h-m-p 1.6000 8.0000 0.1287 CCC 1532.766409 2 1.8890 919 | 0/15
26 h-m-p 1.6000 8.0000 0.0365 YC 1532.753156 1 1.0611 953 | 0/15
27 h-m-p 0.8223 8.0000 0.0471 CC 1532.751137 1 0.9132 988 | 0/15
28 h-m-p 1.6000 8.0000 0.0093 CC 1532.750199 1 1.8392 1023 | 0/15
29 h-m-p 1.6000 8.0000 0.0030 ++ 1532.747354 m 8.0000 1056 | 0/15
30 h-m-p 1.6000 8.0000 0.0122 +YCC 1532.733212 2 5.4279 1093 | 0/15
31 h-m-p 1.3825 7.3793 0.0477 CCCCC 1532.704785 4 1.7887 1134 | 0/15
32 h-m-p 0.3097 2.7832 0.2756 CYCCC 1532.670249 4 0.4912 1174 | 0/15
33 h-m-p 0.5503 8.0000 0.2460 YC 1532.615303 1 0.9545 1208 | 0/15
34 h-m-p 1.3051 8.0000 0.1799 YYC 1532.590142 2 1.1008 1243 | 0/15
35 h-m-p 1.6000 8.0000 0.0286 YC 1532.587654 1 0.6683 1277 | 0/15
36 h-m-p 1.6000 8.0000 0.0115 C 1532.586721 0 1.6594 1310 | 0/15
37 h-m-p 1.6000 8.0000 0.0063 C 1532.586462 0 1.5759 1343 | 0/15
38 h-m-p 1.6000 8.0000 0.0008 Y 1532.586433 0 2.6849 1376 | 0/15
39 h-m-p 1.2077 8.0000 0.0018 ++ 1532.586146 m 8.0000 1409 | 0/15
40 h-m-p 0.1002 8.0000 0.1454 ++YYY 1532.583430 2 1.4517 1446 | 0/15
41 h-m-p 1.6000 8.0000 0.0979 YYC 1532.580454 2 1.6000 1481 | 0/15
42 h-m-p 0.5884 2.9420 0.2224 CYC 1532.575848 2 0.8794 1517 | 0/15
43 h-m-p 1.6000 8.0000 0.0564 CC 1532.574465 1 0.3612 1552 | 0/15
44 h-m-p 0.1847 3.9043 0.1103 +YCYC 1532.571637 3 1.9090 1590 | 0/15
45 h-m-p 0.4312 2.1562 0.0963 YC 1532.570343 1 0.7395 1624 | 0/15
46 h-m-p 0.1179 0.5894 0.1945 ++ 1532.567631 m 0.5894 1657 | 1/15
47 h-m-p 1.6000 8.0000 0.0612 -C 1532.567542 0 0.1415 1691 | 1/15
48 h-m-p 0.5770 8.0000 0.0150 C 1532.567402 0 0.7510 1723 | 1/15
49 h-m-p 1.6000 8.0000 0.0070 Y 1532.567388 0 0.2930 1755 | 1/15
50 h-m-p 1.4007 8.0000 0.0015 C 1532.567386 0 1.3960 1787 | 1/15
51 h-m-p 1.6000 8.0000 0.0004 Y 1532.567386 0 1.1821 1819 | 1/15
52 h-m-p 1.6000 8.0000 0.0000 Y 1532.567386 0 0.9803 1851 | 1/15
53 h-m-p 1.6000 8.0000 0.0000 C 1532.567386 0 1.6000 1883 | 1/15
54 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 1/15
55 h-m-p 0.0160 8.0000 0.0001 ------C 1532.567386 0 0.0000 1967
Out..
lnL = -1532.567386
1968 lfun, 7872 eigenQcodon, 53136 P(t)
Time used: 0:41
Model 7: beta
TREE # 1
(1, (2, 3), ((4, 5), 6)); MP score: 136
0.045058 0.036093 0.031665 0.048232 0.062031 0.015183 0.107982 0.089003 0.364256 1.245177 0.603915 1.022819
ntime & nrate & np: 9 1 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 10.767160
np = 12
lnL0 = -1569.779052
Iterating by ming2
Initial: fx= 1569.779052
x= 0.04506 0.03609 0.03166 0.04823 0.06203 0.01518 0.10798 0.08900 0.36426 1.24518 0.60392 1.02282
1 h-m-p 0.0000 0.0027 185.9657 ++YYCCC 1566.419298 4 0.0003 37 | 0/12
2 h-m-p 0.0006 0.0077 87.4737 +CYYCCC 1547.520625 5 0.0048 74 | 0/12
3 h-m-p 0.0001 0.0003 1009.2147 CCCCC 1544.958902 4 0.0001 109 | 0/12
4 h-m-p 0.0003 0.0015 100.4927 CCCCC 1543.936880 4 0.0004 144 | 0/12
5 h-m-p 0.0008 0.0042 30.3290 CCCC 1543.569139 3 0.0010 177 | 0/12
6 h-m-p 0.0006 0.0067 45.0587 +YYCCC 1542.522825 4 0.0022 211 | 0/12
7 h-m-p 0.0004 0.0035 227.6126 +YCCCC 1539.801877 4 0.0012 246 | 0/12
8 h-m-p 0.0006 0.0030 364.4521 YCCC 1538.378198 3 0.0005 278 | 0/12
9 h-m-p 0.0004 0.0018 205.7149 CYCCC 1537.359426 4 0.0005 312 | 0/12
10 h-m-p 0.0057 0.0286 8.3297 CYC 1537.317892 2 0.0013 342 | 0/12
11 h-m-p 0.0013 0.0540 8.5859 YCC 1537.262169 2 0.0023 372 | 0/12
12 h-m-p 0.0103 0.6879 1.9484 ++YCCC 1536.774769 3 0.1058 406 | 0/12
13 h-m-p 0.2656 1.3279 0.4219 YCCC 1534.974166 3 0.4262 438 | 0/12
14 h-m-p 1.4891 7.4457 0.0507 YCC 1534.729435 2 1.1305 468 | 0/12
15 h-m-p 0.7368 8.0000 0.0778 YC 1534.652442 1 1.5112 496 | 0/12
16 h-m-p 1.1271 8.0000 0.1043 +YYC 1534.444198 2 4.0917 526 | 0/12
17 h-m-p 1.5597 7.7985 0.1690 YYC 1534.347974 2 1.1403 555 | 0/12
18 h-m-p 1.6000 8.0000 0.0829 YC 1534.326131 1 0.7834 583 | 0/12
19 h-m-p 1.6000 8.0000 0.0328 YC 1534.322808 1 1.0042 611 | 0/12
20 h-m-p 1.6000 8.0000 0.0026 YC 1534.322661 1 1.0472 639 | 0/12
21 h-m-p 1.6000 8.0000 0.0002 C 1534.322650 0 1.2850 666 | 0/12
22 h-m-p 1.6000 8.0000 0.0001 Y 1534.322648 0 1.2480 693 | 0/12
23 h-m-p 1.6000 8.0000 0.0001 Y 1534.322648 0 0.9629 720 | 0/12
24 h-m-p 1.6000 8.0000 0.0000 Y 1534.322648 0 0.9784 747 | 0/12
25 h-m-p 1.6000 8.0000 0.0000 C 1534.322648 0 2.4602 774 | 0/12
26 h-m-p 1.6000 8.0000 0.0000 ---C 1534.322648 0 0.0099 804
Out..
lnL = -1534.322648
805 lfun, 8855 eigenQcodon, 72450 P(t)
Time used: 1:07
Model 8: beta&w>1
TREE # 1
(1, (2, 3), ((4, 5), 6)); MP score: 136
initial w for M8:NSbetaw>1 reset.
0.045058 0.036093 0.031665 0.048232 0.062031 0.015183 0.107982 0.089003 0.364256 1.230057 0.900000 0.523761 1.873198 2.941449
ntime & nrate & np: 9 2 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 9.074973
np = 14
lnL0 = -1567.192223
Iterating by ming2
Initial: fx= 1567.192223
x= 0.04506 0.03609 0.03166 0.04823 0.06203 0.01518 0.10798 0.08900 0.36426 1.23006 0.90000 0.52376 1.87320 2.94145
1 h-m-p 0.0000 0.0004 353.0643 +++ 1551.347991 m 0.0004 34 | 0/14
2 h-m-p 0.0005 0.0024 62.9754 YCYCCC 1548.994857 5 0.0011 73 | 0/14
3 h-m-p 0.0004 0.0028 184.4516 +YYCCC 1543.364889 4 0.0012 111 | 0/14
4 h-m-p 0.0002 0.0011 275.0161 CYCCC 1541.229061 4 0.0003 149 | 0/14
5 h-m-p 0.0006 0.0029 55.8293 CYC 1540.756940 2 0.0005 183 | 0/14
6 h-m-p 0.0020 0.0101 14.6292 YCCC 1540.633032 3 0.0013 219 | 0/14
7 h-m-p 0.0007 0.0351 25.9140 YCCC 1540.421978 3 0.0016 255 | 0/14
8 h-m-p 0.0013 0.0080 31.3248 YCC 1540.306406 2 0.0008 289 | 0/14
9 h-m-p 0.0029 0.0574 8.6554 CYC 1540.210339 2 0.0035 323 | 0/14
10 h-m-p 0.0028 0.0197 10.9981 YCC 1540.154634 2 0.0018 357 | 0/14
11 h-m-p 0.0013 0.0595 15.3138 ++YYC 1539.380857 2 0.0170 392 | 0/14
12 h-m-p 0.0021 0.0106 126.4576 YCCCCC 1537.618056 5 0.0046 432 | 0/14
13 h-m-p 0.0990 0.4949 3.2336 CCCCC 1536.577563 4 0.1264 471 | 0/14
14 h-m-p 0.0900 0.4502 0.8862 +YYCCC 1534.110170 4 0.3056 509 | 0/14
15 h-m-p 0.6509 5.7942 0.4161 CCC 1533.228095 2 0.6306 544 | 0/14
16 h-m-p 0.4811 3.3681 0.5453 CCCC 1532.941225 3 0.5159 581 | 0/14
17 h-m-p 1.6000 8.0000 0.1198 YC 1532.889248 1 0.7830 613 | 0/14
18 h-m-p 0.8009 8.0000 0.1171 YC 1532.860529 1 1.3731 645 | 0/14
19 h-m-p 0.9893 8.0000 0.1626 YCC 1532.821330 2 1.8630 679 | 0/14
20 h-m-p 1.6000 8.0000 0.1666 CCC 1532.776747 2 2.3594 714 | 0/14
21 h-m-p 1.4208 8.0000 0.2767 CC 1532.732798 1 1.8374 747 | 0/14
22 h-m-p 1.5215 8.0000 0.3342 CCC 1532.694111 2 1.9533 782 | 0/14
23 h-m-p 1.4423 8.0000 0.4526 CCC 1532.650049 2 1.8761 817 | 0/14
24 h-m-p 1.6000 8.0000 0.4675 CY 1532.617078 1 1.6326 850 | 0/14
25 h-m-p 1.5496 8.0000 0.4925 CC 1532.604579 1 1.8755 883 | 0/14
26 h-m-p 1.5137 8.0000 0.6103 CC 1532.597349 1 1.1748 916 | 0/14
27 h-m-p 1.3153 8.0000 0.5451 CC 1532.591304 1 1.4573 949 | 0/14
28 h-m-p 1.6000 8.0000 0.4123 C 1532.586901 0 1.7887 980 | 0/14
29 h-m-p 1.6000 8.0000 0.2656 CC 1532.584076 1 2.0280 1013 | 0/14
30 h-m-p 1.6000 8.0000 0.0327 C 1532.583157 0 1.5163 1044 | 0/14
31 h-m-p 1.1787 8.0000 0.0420 C 1532.582954 0 1.2462 1075 | 0/14
32 h-m-p 0.6919 8.0000 0.0757 +Y 1532.582917 0 1.7697 1107 | 0/14
33 h-m-p 1.6000 8.0000 0.0349 Y 1532.582914 0 1.0219 1138 | 0/14
34 h-m-p 1.6000 8.0000 0.0041 Y 1532.582913 0 0.8056 1169 | 0/14
35 h-m-p 1.6000 8.0000 0.0002 Y 1532.582913 0 0.9517 1200 | 0/14
36 h-m-p 1.6000 8.0000 0.0001 -C 1532.582913 0 0.1000 1232 | 0/14
37 h-m-p 0.1999 8.0000 0.0000 ---C 1532.582913 0 0.0008 1266
Out..
lnL = -1532.582913
1267 lfun, 15204 eigenQcodon, 125433 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1542.186956 S = -1465.769142 -68.701930
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 133 patterns 1:53
did 20 / 133 patterns 1:53
did 30 / 133 patterns 1:53
did 40 / 133 patterns 1:53
did 50 / 133 patterns 1:54
did 60 / 133 patterns 1:54
did 70 / 133 patterns 1:54
did 80 / 133 patterns 1:54
did 90 / 133 patterns 1:54
did 100 / 133 patterns 1:55
did 110 / 133 patterns 1:55
did 120 / 133 patterns 1:55
did 130 / 133 patterns 1:55
did 133 / 133 patterns 1:55
Time used: 1:55
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=232
D_melanogaster_PGRP-LB-PB MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
D_sechellia_PGRP-LB-PB MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVC
D_simulans_PGRP-LB-PB MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
D_yakuba_PGRP-LB-PB MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVC
D_erecta_PGRP-LB-PB MQQANLG----TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
D_elegans_PGRP-LB-PB MQHANLGDGAATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVC
**:**** ******************:**:**************.**
D_melanogaster_PGRP-LB-PB YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
D_sechellia_PGRP-LB-PB YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
D_simulans_PGRP-LB-PB YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
D_yakuba_PGRP-LB-PB YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAH
D_erecta_PGRP-LB-PB YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAH
D_elegans_PGRP-LB-PB YTTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
*:**:**********************************:******:***
D_melanogaster_PGRP-LB-PB APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
D_sechellia_PGRP-LB-PB APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
D_simulans_PGRP-LB-PB APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
D_yakuba_PGRP-LB-PB APKYNDKSVGIVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLL
D_erecta_PGRP-LB-PB APKYNDRSVGIVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLL
D_elegans_PGRP-LB-PB APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
******:***********************::**:***************
D_melanogaster_PGRP-LB-PB GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTTAPVVPHVHPQA
D_sechellia_PGRP-LB-PB GHRQVRDTECPGGRLFAEISSWPHFTHLNASDGE-SSTAAPVVPHVHAQA
D_simulans_PGRP-LB-PB GHRQVRDTECPGGRLFAEISSWPHFTHLNATEGV-SSTAAPVVPHVHAQA
D_yakuba_PGRP-LB-PB GHRQVRDTECPGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKA
D_erecta_PGRP-LB-PB GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTKAPVEPHVHPQA
D_elegans_PGRP-LB-PB GHRQVRDTECPGGRLFAEISGWPHFTHLNATEGS---TPVPIEPHAHPQA
********************.******:. ::* * .*: **.*.:*
D_melanogaster_PGRP-LB-PB AAP---QKPHQSPP----AAPKVooooo----
D_sechellia_PGRP-LB-PB AAP---QTPHQSPP----AAPKVooooo----
D_simulans_PGRP-LB-PB AAP---QTPHQSPP----AAPKVooooo----
D_yakuba_PGRP-LB-PB ATQ---TPLAQSPP----AAPKVoooo-----
D_erecta_PGRP-LB-PB ATQ---QTPPKSPP----AAPKVooooooooo
D_elegans_PGRP-LB-PB ASQTPPQSPPQSPPHAPAAAPKV---------
*: :*** *****
>D_melanogaster_PGRP-LB-PB ATGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTGTC CCGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGAGCACTTCCAGG GTCCCGCGCCCTACGTCATCATCCATCACTCGTACATGCCGGCCGTGTGC TACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACTTCCA TCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCG GCGATGGCATGATTTACACCGGCAGGGGATTCAATGTCATCGGAGCTCAT GCACCCAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAGATTG GAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGA TCGCCTTTGGCGTTTTCAAGGGCTACATTGACCCTGCCTACAAGCTGCTG GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTGTTCGC CGAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAAGGCG TC---AGCAGCACCACGGCGCCCGTCGTGCCCCACGTCCATCCACAGGCG GCAGCACCA---------CAAAAGCCGCACCAATCCCCGCCA-------- ----GCTGCGCCCAAGGTC--------------------------- >D_sechellia_PGRP-LB-PB ATGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTTTC CCGATCCGACTGGGGTGCCCGGCTGCCCAAGTCTGTGGACCACTTCCAGG GACCCGCGCCCTACGTCATCATCCACCACTCGTACATGCCGGCCGTGTGC TACTCCACTCCGGAATGCATGAAGAGCATGCGGGACATGCAGGACTTCCA TCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCG GCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCATCGGAGCTCAT GCACCCAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAGATTG GAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGA TCGCCTTCGGAGTTTTCAAGGGCTACATTGACCCCGCCTACAAACTGCTG GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGAGGCCGCCTCTTCGC CGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAACGCCAGCGACGGCG AG---AGCAGCACTGCGGCGCCCGTCGTGCCCCATGTCCATGCACAGGCG GCAGCACCA---------CAAACGCCGCACCAATCCCCGCCA-------- ----GCTGCGCCCAAGGTC--------------------------- >D_simulans_PGRP-LB-PB ATGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTTTC CCGATCCGACTGGGGTGCACGGCTGCCCAAGTCCGTGGAGCACTTCCAGG GACCAGCGCCTTACGTCATCATCCACCACTCGTATATGCCGGCCGTGTGC TACTCAACTCCGGAATGCATGAAGAGCATGCGGGACATGCAGGACTTTCA TCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCG GCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCATCGGAGCTCAT GCACCGAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAGATTG GAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGA TCGCCTTCGGCGTTTTCAAGGGCTACATTGACCCCGCCTACAAGCTGCTG GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTCTTCGC CGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAACGCCACCGAAGGCG TG---AGCAGCACTGCGGCGCCCGTCGTGCCCCATGTCCATGCACAGGCG GCAGCACCA---------CAAACGCCGCACCAATCCCCGCCA-------- ----GCTGCGCCCAAGGTC--------------------------- >D_yakuba_PGRP-LB-PB ATGCAGCAGGCAAATCTGGGCGATGGTGTGGCCACCGCCCGACTGCTGTC CAGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGACCACTTTCAGG GACCCGCGCCCTACGTCATCATCCACCACTCGTACATGCCAGGCGTGTGC TACTCCACTCCGGAGTGCATGAAGAGCATGCGGGACATGCAGGACTTCCA CCAGCTGGAGCGCGGATGGAACGATATCGGATATAGCTTTGGCATCGGCG GCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCGTCGGAGCTCAT GCGCCGAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAGATTG GAGAACTGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAGGAACCTGA TCTCCTTCGGGGTGTTCAAGGGCTACATTGACCCCGCCTACAAGCTGCTG GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGAGGCCGCCTGTTTGC CGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAGCGAAACCGAAGGCG TAGTTAGCAGCACTGCTGCGCCCGTCGAGCCCCACGTCCATCCAAAGGCG GCAACACAA---------ACGCCACTCGCCCAATCCCCGCCA-------- ----GCTGCGCCCAAGGTC--------------------------- >D_erecta_PGRP-LB-PB ATGCAGCAGGCGAATCTGGGC------------ACCGCCCGGCTTCTGTC CCGATCCGACTGGGGTGCCCGCCTGCCCAAGTCCGTGGAGCACTTTCAAG GACCCGCGCCCTACGTGATCATCCACCACTCGTACATGCCAGCCGTGTGC TACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACTTCCA CCAGCTGGAGCGCGGTTGGAACGATATCGGATATAGCTTTGGCATCGGCG GCGATGGCATGATCTACGCAGGCAGGGGATTCAATGTCATCGGAGCTCAT GCGCCGAAGTACAATGACAGGAGCGTGGGCATCGTGCTGATCGGAGATTG GAGAACTGAACTTCCGCCCAAGCAGATGCTGGATGCGGCCAAGGACCTGA TCGCCTTCGGGGTGTTCAAGGGCTACATTGACCCCGCCTACAAGCTGCTG GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGGGGCCGCCTGTTTGC CGAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAAGGCG TT---AGCAGTACGAAGGCGCCGGTCGAGCCCCACGTCCATCCACAGGCG GCAACACAA---------CAAACGCCGCCCAAATCCCCGCCA-------- ----GCTGCGCCCAAGGTC--------------------------- >D_elegans_PGRP-LB-PB ATGCAGCATGCGAATTTGGGCGATGGAGCGGCCACCGCTCGACTTCTGTC CCGCTCCGACTGGGGCGCCCGTCTGCCCAAGTCCGTGGAGCACTTCGAGG GTCCCGCCCCCTACGTGATCATCCACCACTCTTACATGCCGGCGGTGTGC TATACCACTCCCGACTGCATGAAGAGCATGCGCGACATGCAGGACTTCCA CCAGCTGGAGCGCGGTTGGAACGACATCGGCTATAGCTTCGGCATCGGCG GCGATGGCATGATCTACACCGGAAGGGGATTCAACGTTATCGGAGCTCAT GCACCCAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAGATTG GAGAACTGAACTGCCGCCCAAACAGATGCTGGACGCGGCCAAAAACCTGA TCGCCTTCGGCGTGTTCAAGGGCTACATTGACCCCGCATACAAGCTGCTG GGCCACCGACAGGTTCGTGACACCGAGTGTCCCGGAGGCAGGCTGTTCGC GGAGATCTCCGGCTGGCCGCACTTTACCCACCTAAACGCCACCGAAGGCA GC---------ACCCCCGTCCCCATTGAACCGCACGCACATCCCCAGGCG GCGTCCCAAACGCCACCCCAATCACCACCCCAATCGCCACCCCATGCCCC GGCAGCTGCGCCCAAGGTC---------------------------
>D_melanogaster_PGRP-LB-PB MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTTAPVVPHVHPQA AAP---QKPHQSPP----AAPKV >D_sechellia_PGRP-LB-PB MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVC YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL GHRQVRDTECPGGRLFAEISSWPHFTHLNASDGE-SSTAAPVVPHVHAQA AAP---QTPHQSPP----AAPKV >D_simulans_PGRP-LB-PB MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL GHRQVRDTECPGGRLFAEISSWPHFTHLNATEGV-SSTAAPVVPHVHAQA AAP---QTPHQSPP----AAPKV >D_yakuba_PGRP-LB-PB MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVC YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAH APKYNDKSVGIVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLL GHRQVRDTECPGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKA ATQ---TPLAQSPP----AAPKV >D_erecta_PGRP-LB-PB MQQANLG----TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAH APKYNDRSVGIVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLL GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTKAPVEPHVHPQA ATQ---QTPPKSPP----AAPKV >D_elegans_PGRP-LB-PB MQHANLGDGAATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVC YTTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL GHRQVRDTECPGGRLFAEISGWPHFTHLNATEGS---TPVPIEPHAHPQA ASQTPPQSPPQSPPHAPAAAPKV
#NEXUS
[ID: 6551251364]
begin taxa;
dimensions ntax=6;
taxlabels
D_melanogaster_PGRP-LB-PB
D_sechellia_PGRP-LB-PB
D_simulans_PGRP-LB-PB
D_yakuba_PGRP-LB-PB
D_erecta_PGRP-LB-PB
D_elegans_PGRP-LB-PB
;
end;
begin trees;
translate
1 D_melanogaster_PGRP-LB-PB,
2 D_sechellia_PGRP-LB-PB,
3 D_simulans_PGRP-LB-PB,
4 D_yakuba_PGRP-LB-PB,
5 D_erecta_PGRP-LB-PB,
6 D_elegans_PGRP-LB-PB
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02057004,(2:0.02076878,3:0.01710413)0.999:0.01944359,((4:0.05922662,5:0.04371237)0.624:0.01980634,6:0.2496716)0.986:0.03772019);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02057004,(2:0.02076878,3:0.01710413):0.01944359,((4:0.05922662,5:0.04371237):0.01980634,6:0.2496716):0.03772019);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1692.65 -1705.14
2 -1692.85 -1702.24
--------------------------------------
TOTAL -1692.75 -1704.50
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.506578 0.007073 0.361108 0.670111 0.495668 920.60 997.90 1.000
r(A<->C){all} 0.170509 0.001529 0.097060 0.245350 0.167931 893.31 924.09 1.000
r(A<->G){all} 0.197010 0.002213 0.112188 0.296008 0.193956 850.66 909.93 1.001
r(A<->T){all} 0.123414 0.002214 0.030770 0.211138 0.119182 677.89 775.02 1.000
r(C<->G){all} 0.090219 0.000590 0.044900 0.137673 0.088253 1138.17 1233.83 1.000
r(C<->T){all} 0.292183 0.003052 0.187053 0.402400 0.289274 888.08 989.77 1.001
r(G<->T){all} 0.126666 0.001651 0.049174 0.202676 0.123289 790.76 841.88 1.000
pi(A){all} 0.212022 0.000221 0.181706 0.239809 0.211460 1081.91 1190.51 1.000
pi(C){all} 0.343399 0.000278 0.310632 0.375300 0.343247 1046.62 1136.12 1.000
pi(G){all} 0.279716 0.000270 0.247147 0.311505 0.279325 1011.72 1033.04 1.000
pi(T){all} 0.164863 0.000182 0.138784 0.190885 0.164897 958.73 973.89 1.000
alpha{1,2} 0.098085 0.003158 0.000124 0.190499 0.098957 938.30 963.26 1.000
alpha{3} 1.965737 0.582422 0.657116 3.419758 1.840381 959.30 1188.08 1.000
pinvar{all} 0.306525 0.011893 0.087535 0.503839 0.309316 806.78 959.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/346/PGRP-LB-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 209
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 2 3 4 4 1 | Ser TCT 0 1 0 0 0 1 | Tyr TAT 1 1 2 1 1 2 | Cys TGT 1 1 1 1 1 1
TTC 5 6 5 4 4 7 | TCC 6 5 5 7 6 5 | TAC 7 7 6 7 7 6 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 0 0 0 | TCA 0 0 1 0 0 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 1 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 1 1 0 2 1 | Pro CCT 2 1 2 1 1 0 | His CAT 4 4 4 2 2 3 | Arg CGT 0 0 0 0 0 2
CTC 0 1 1 1 0 0 | CCC 8 9 6 8 8 14 | CAC 7 7 7 8 8 8 | CGC 3 3 3 2 3 3
CTA 0 1 1 1 0 1 | CCA 3 2 3 4 3 2 | Gln CAA 2 2 2 2 3 3 | CGA 2 2 2 2 2 2
CTG 12 10 10 12 10 10 | CCG 6 6 7 5 7 4 | CAG 8 8 8 7 7 6 | CGG 3 3 3 3 3 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 2 3 1 1 2 | Thr ACT 1 2 2 3 2 2 | Asn AAT 3 3 3 3 3 2 | Ser AGT 0 0 0 0 0 0
ATC 7 9 8 9 10 10 | ACC 7 5 6 5 4 7 | AAC 3 3 3 2 2 4 | AGC 4 5 4 5 4 4
ATA 1 0 0 0 1 0 | ACA 0 0 0 1 1 0 | Lys AAA 0 1 0 0 1 2 | Arg AGA 1 1 1 2 1 1
Met ATG 7 7 7 7 7 7 | ACG 1 1 1 1 2 0 | AAG 10 8 9 9 9 7 | AGG 1 1 1 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 0 1 2 | Ala GCT 2 2 2 3 2 3 | Asp GAT 5 5 5 5 5 2 | Gly GGT 3 2 2 1 2 2
GTC 6 5 5 6 4 2 | GCC 7 8 7 6 7 5 | GAC 7 7 5 6 8 9 | GGC 13 11 13 12 11 14
GTA 0 0 0 1 0 0 | GCA 3 4 5 2 2 3 | Glu GAA 2 2 3 3 2 3 | GGA 4 7 5 7 5 5
GTG 6 6 7 6 7 6 | GCG 6 7 7 6 7 7 | GAG 4 4 4 5 5 5 | GGG 0 0 0 1 2 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_PGRP-LB-PB
position 1: T:0.14354 C:0.28708 A:0.23923 G:0.33014
position 2: T:0.24880 C:0.25359 A:0.30144 G:0.19617
position 3: T:0.14354 C:0.44019 A:0.08612 G:0.33014
Average T:0.17863 C:0.32695 A:0.20893 G:0.28549
#2: D_sechellia_PGRP-LB-PB
position 1: T:0.14354 C:0.28708 A:0.22967 G:0.33971
position 2: T:0.24402 C:0.25837 A:0.29665 G:0.20096
position 3: T:0.13397 C:0.44498 A:0.10526 G:0.31579
Average T:0.17384 C:0.33014 A:0.21053 G:0.28549
#3: D_simulans_PGRP-LB-PB
position 1: T:0.14354 C:0.28708 A:0.22967 G:0.33971
position 2: T:0.24880 C:0.26316 A:0.29187 G:0.19617
position 3: T:0.14833 C:0.41148 A:0.11005 G:0.33014
Average T:0.18022 C:0.32057 A:0.21053 G:0.28868
#4: D_yakuba_PGRP-LB-PB
position 1: T:0.14833 C:0.27751 A:0.23923 G:0.33493
position 2: T:0.24880 C:0.25359 A:0.28708 G:0.21053
position 3: T:0.11962 C:0.43062 A:0.11962 G:0.33014
Average T:0.17225 C:0.32057 A:0.21531 G:0.29187
#5: D_erecta_PGRP-LB-PB
position 1: T:0.14354 C:0.28230 A:0.23923 G:0.33493
position 2: T:0.24402 C:0.25359 A:0.30144 G:0.20096
position 3: T:0.12919 C:0.42105 A:0.10048 G:0.34928
Average T:0.17225 C:0.31898 A:0.21372 G:0.29506
#6: D_elegans_PGRP-LB-PB
position 1: T:0.15311 C:0.28230 A:0.23923 G:0.32536
position 2: T:0.23923 C:0.26316 A:0.29665 G:0.20096
position 3: T:0.12440 C:0.47847 A:0.11005 G:0.28708
Average T:0.17225 C:0.34131 A:0.21531 G:0.27113
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 17 | Ser S TCT 2 | Tyr Y TAT 8 | Cys C TGT 6
TTC 31 | TCC 34 | TAC 40 | TGC 12
Leu L TTA 0 | TCA 2 | *** * TAA 0 | *** * TGA 0
TTG 1 | TCG 6 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 5 | Pro P CCT 7 | His H CAT 19 | Arg R CGT 2
CTC 3 | CCC 53 | CAC 45 | CGC 17
CTA 4 | CCA 17 | Gln Q CAA 14 | CGA 12
CTG 64 | CCG 35 | CAG 44 | CGG 15
------------------------------------------------------------------------------
Ile I ATT 13 | Thr T ACT 12 | Asn N AAT 17 | Ser S AGT 0
ATC 53 | ACC 34 | AAC 17 | AGC 26
ATA 2 | ACA 2 | Lys K AAA 4 | Arg R AGA 7
Met M ATG 42 | ACG 6 | AAG 52 | AGG 9
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 14 | Asp D GAT 27 | Gly G GGT 12
GTC 28 | GCC 40 | GAC 42 | GGC 74
GTA 1 | GCA 19 | Glu E GAA 15 | GGA 33
GTG 38 | GCG 40 | GAG 27 | GGG 3
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14593 C:0.28389 A:0.23604 G:0.33413
position 2: T:0.24561 C:0.25758 A:0.29585 G:0.20096
position 3: T:0.13317 C:0.43780 A:0.10526 G:0.32376
Average T:0.17491 C:0.32642 A:0.21239 G:0.28628
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_PGRP-LB-PB
D_sechellia_PGRP-LB-PB 0.2199 (0.0224 0.1020)
D_simulans_PGRP-LB-PB 0.1059 (0.0128 0.1205) 0.1023 (0.0085 0.0829)
D_yakuba_PGRP-LB-PB 0.2269 (0.0457 0.2013) 0.2364 (0.0445 0.1884) 0.1743 (0.0401 0.2304)
D_erecta_PGRP-LB-PB 0.0965 (0.0213 0.2210) 0.1924 (0.0400 0.2077) 0.1221 (0.0301 0.2465) 0.3753 (0.0467 0.1245)
D_elegans_PGRP-LB-PB 0.0826 (0.0411 0.4968) 0.0903 (0.0474 0.5246) 0.0657 (0.0400 0.6093) 0.1268 (0.0611 0.4815) 0.0878 (0.0444 0.5052)
Model 0: one-ratio
TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 136
lnL(ntime: 9 np: 11): -1547.550018 +0.000000
7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6
0.050970 0.037015 0.042771 0.037376 0.065407 0.029097 0.119880 0.094743 0.370545 1.213294 0.092216
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.84780
(1: 0.050970, (2: 0.042771, 3: 0.037376): 0.037015, ((4: 0.119880, 5: 0.094743): 0.029097, 6: 0.370545): 0.065407);
(D_melanogaster_PGRP-LB-PB: 0.050970, (D_sechellia_PGRP-LB-PB: 0.042771, D_simulans_PGRP-LB-PB: 0.037376): 0.037015, ((D_yakuba_PGRP-LB-PB: 0.119880, D_erecta_PGRP-LB-PB: 0.094743): 0.029097, D_elegans_PGRP-LB-PB: 0.370545): 0.065407);
Detailed output identifying parameters
kappa (ts/tv) = 1.21329
omega (dN/dS) = 0.09222
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.051 504.6 122.4 0.0922 0.0058 0.0630 2.9 7.7
7..8 0.037 504.6 122.4 0.0922 0.0042 0.0458 2.1 5.6
8..2 0.043 504.6 122.4 0.0922 0.0049 0.0529 2.5 6.5
8..3 0.037 504.6 122.4 0.0922 0.0043 0.0462 2.2 5.7
7..9 0.065 504.6 122.4 0.0922 0.0075 0.0809 3.8 9.9
9..10 0.029 504.6 122.4 0.0922 0.0033 0.0360 1.7 4.4
10..4 0.120 504.6 122.4 0.0922 0.0137 0.1483 6.9 18.2
10..5 0.095 504.6 122.4 0.0922 0.0108 0.1172 5.5 14.3
9..6 0.371 504.6 122.4 0.0922 0.0423 0.4583 21.3 56.1
tree length for dN: 0.0967
tree length for dS: 1.0487
Time used: 0:02
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 136
lnL(ntime: 9 np: 12): -1532.872708 +0.000000
7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6
0.053439 0.036516 0.043805 0.038888 0.068310 0.031735 0.124857 0.099024 0.402381 1.244185 0.933497 0.044034
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.89895
(1: 0.053439, (2: 0.043805, 3: 0.038888): 0.036516, ((4: 0.124857, 5: 0.099024): 0.031735, 6: 0.402381): 0.068310);
(D_melanogaster_PGRP-LB-PB: 0.053439, (D_sechellia_PGRP-LB-PB: 0.043805, D_simulans_PGRP-LB-PB: 0.038888): 0.036516, ((D_yakuba_PGRP-LB-PB: 0.124857, D_erecta_PGRP-LB-PB: 0.099024): 0.031735, D_elegans_PGRP-LB-PB: 0.402381): 0.068310);
Detailed output identifying parameters
kappa (ts/tv) = 1.24418
dN/dS (w) for site classes (K=2)
p: 0.93350 0.06650
w: 0.04403 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.053 504.3 122.7 0.1076 0.0068 0.0631 3.4 7.7
7..8 0.037 504.3 122.7 0.1076 0.0046 0.0431 2.3 5.3
8..2 0.044 504.3 122.7 0.1076 0.0056 0.0517 2.8 6.3
8..3 0.039 504.3 122.7 0.1076 0.0049 0.0459 2.5 5.6
7..9 0.068 504.3 122.7 0.1076 0.0087 0.0807 4.4 9.9
9..10 0.032 504.3 122.7 0.1076 0.0040 0.0375 2.0 4.6
10..4 0.125 504.3 122.7 0.1076 0.0159 0.1474 8.0 18.1
10..5 0.099 504.3 122.7 0.1076 0.0126 0.1169 6.3 14.4
9..6 0.402 504.3 122.7 0.1076 0.0511 0.4752 25.8 58.3
Time used: 0:07
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 136
check convergence..
lnL(ntime: 9 np: 14): -1532.751160 +0.000000
7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6
0.053972 0.036631 0.044112 0.039282 0.069813 0.032234 0.126585 0.100145 0.409680 1.252662 0.943120 0.031510 0.047671 1.581351
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.91245
(1: 0.053972, (2: 0.044112, 3: 0.039282): 0.036631, ((4: 0.126585, 5: 0.100145): 0.032234, 6: 0.409680): 0.069813);
(D_melanogaster_PGRP-LB-PB: 0.053972, (D_sechellia_PGRP-LB-PB: 0.044112, D_simulans_PGRP-LB-PB: 0.039282): 0.036631, ((D_yakuba_PGRP-LB-PB: 0.126585, D_erecta_PGRP-LB-PB: 0.100145): 0.032234, D_elegans_PGRP-LB-PB: 0.409680): 0.069813);
Detailed output identifying parameters
kappa (ts/tv) = 1.25266
dN/dS (w) for site classes (K=3)
p: 0.94312 0.03151 0.02537
w: 0.04767 1.00000 1.58135
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.054 504.2 122.8 0.1166 0.0072 0.0621 3.7 7.6
7..8 0.037 504.2 122.8 0.1166 0.0049 0.0422 2.5 5.2
8..2 0.044 504.2 122.8 0.1166 0.0059 0.0508 3.0 6.2
8..3 0.039 504.2 122.8 0.1166 0.0053 0.0452 2.7 5.6
7..9 0.070 504.2 122.8 0.1166 0.0094 0.0804 4.7 9.9
9..10 0.032 504.2 122.8 0.1166 0.0043 0.0371 2.2 4.6
10..4 0.127 504.2 122.8 0.1166 0.0170 0.1457 8.6 17.9
10..5 0.100 504.2 122.8 0.1166 0.0134 0.1153 6.8 14.2
9..6 0.410 504.2 122.8 0.1166 0.0550 0.4716 27.7 57.9
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PB)
Pr(w>1) post mean +- SE for w
174 I 0.558 1.279
180 V 0.539 1.305
182 T 0.657 1.382
198 K 0.598 1.343
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PB)
Pr(w>1) post mean +- SE for w
174 I 0.642 1.999 +- 1.416
180 V 0.559 1.795 +- 1.214
182 T 0.766 2.313 +- 1.543
195 A 0.553 1.791 +- 1.358
198 K 0.652 1.985 +- 1.296
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.463 0.274 0.129 0.062 0.031 0.017 0.010 0.006 0.004 0.003
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.007 0.991
sum of density on p0-p1 = 1.000000
Time used: 0:22
Model 3: discrete (3 categories)
TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 136
lnL(ntime: 9 np: 15): -1532.567386 +0.000000
7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6
0.053897 0.037192 0.044344 0.039429 0.071336 0.032021 0.128222 0.100513 0.413380 1.245177 0.465067 0.495575 0.000001 0.110996 1.640550
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.92033
(1: 0.053897, (2: 0.044344, 3: 0.039429): 0.037192, ((4: 0.128222, 5: 0.100513): 0.032021, 6: 0.413380): 0.071336);
(D_melanogaster_PGRP-LB-PB: 0.053897, (D_sechellia_PGRP-LB-PB: 0.044344, D_simulans_PGRP-LB-PB: 0.039429): 0.037192, ((D_yakuba_PGRP-LB-PB: 0.128222, D_erecta_PGRP-LB-PB: 0.100513): 0.032021, D_elegans_PGRP-LB-PB: 0.413380): 0.071336);
Detailed output identifying parameters
kappa (ts/tv) = 1.24518
dN/dS (w) for site classes (K=3)
p: 0.46507 0.49557 0.03936
w: 0.00000 0.11100 1.64055
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.054 504.3 122.7 0.1196 0.0074 0.0615 3.7 7.6
7..8 0.037 504.3 122.7 0.1196 0.0051 0.0425 2.6 5.2
8..2 0.044 504.3 122.7 0.1196 0.0061 0.0506 3.1 6.2
8..3 0.039 504.3 122.7 0.1196 0.0054 0.0450 2.7 5.5
7..9 0.071 504.3 122.7 0.1196 0.0097 0.0815 4.9 10.0
9..10 0.032 504.3 122.7 0.1196 0.0044 0.0366 2.2 4.5
10..4 0.128 504.3 122.7 0.1196 0.0175 0.1464 8.8 18.0
10..5 0.101 504.3 122.7 0.1196 0.0137 0.1148 6.9 14.1
9..6 0.413 504.3 122.7 0.1196 0.0564 0.4721 28.5 57.9
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PB)
Pr(w>1) post mean +- SE for w
174 I 0.873 1.447
176 D 0.809 1.348
180 V 0.941 1.551
182 T 0.996** 1.634
195 A 0.791 1.321
197 Q 0.671 1.138
198 K 0.971* 1.596
Time used: 0:41
Model 7: beta (10 categories)
TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 136
lnL(ntime: 9 np: 12): -1534.322648 +0.000000
7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6
0.052362 0.037032 0.043431 0.038436 0.066633 0.031330 0.123424 0.097432 0.392629 1.230057 0.140161 1.159329
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.88271
(1: 0.052362, (2: 0.043431, 3: 0.038436): 0.037032, ((4: 0.123424, 5: 0.097432): 0.031330, 6: 0.392629): 0.066633);
(D_melanogaster_PGRP-LB-PB: 0.052362, (D_sechellia_PGRP-LB-PB: 0.043431, D_simulans_PGRP-LB-PB: 0.038436): 0.037032, ((D_yakuba_PGRP-LB-PB: 0.123424, D_erecta_PGRP-LB-PB: 0.097432): 0.031330, D_elegans_PGRP-LB-PB: 0.392629): 0.066633);
Detailed output identifying parameters
kappa (ts/tv) = 1.23006
Parameters in M7 (beta):
p = 0.14016 q = 1.15933
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00004 0.00045 0.00271 0.01134 0.03749 0.10508 0.26294 0.62055
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.052 504.4 122.6 0.1041 0.0065 0.0625 3.3 7.7
7..8 0.037 504.4 122.6 0.1041 0.0046 0.0442 2.3 5.4
8..2 0.043 504.4 122.6 0.1041 0.0054 0.0518 2.7 6.4
8..3 0.038 504.4 122.6 0.1041 0.0048 0.0459 2.4 5.6
7..9 0.067 504.4 122.6 0.1041 0.0083 0.0795 4.2 9.8
9..10 0.031 504.4 122.6 0.1041 0.0039 0.0374 2.0 4.6
10..4 0.123 504.4 122.6 0.1041 0.0153 0.1473 7.7 18.1
10..5 0.097 504.4 122.6 0.1041 0.0121 0.1163 6.1 14.3
9..6 0.393 504.4 122.6 0.1041 0.0488 0.4687 24.6 57.5
Time used: 1:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 136
lnL(ntime: 9 np: 14): -1532.582913 +0.000000
7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6
0.053890 0.037204 0.044335 0.039432 0.071265 0.032069 0.128163 0.100504 0.413138 1.245552 0.961742 0.640040 9.924726 1.656963
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.92000
(1: 0.053890, (2: 0.044335, 3: 0.039432): 0.037204, ((4: 0.128163, 5: 0.100504): 0.032069, 6: 0.413138): 0.071265);
(D_melanogaster_PGRP-LB-PB: 0.053890, (D_sechellia_PGRP-LB-PB: 0.044335, D_simulans_PGRP-LB-PB: 0.039432): 0.037204, ((D_yakuba_PGRP-LB-PB: 0.128163, D_erecta_PGRP-LB-PB: 0.100504): 0.032069, D_elegans_PGRP-LB-PB: 0.413138): 0.071265);
Detailed output identifying parameters
kappa (ts/tv) = 1.24555
Parameters in M8 (beta&w>1):
p0 = 0.96174 p = 0.64004 q = 9.92473
(p1 = 0.03826) w = 1.65696
dN/dS (w) for site classes (K=11)
p: 0.09617 0.09617 0.09617 0.09617 0.09617 0.09617 0.09617 0.09617 0.09617 0.09617 0.03826
w: 0.00081 0.00459 0.01054 0.01861 0.02912 0.04273 0.06072 0.08569 0.12429 0.20607 1.65696
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.054 504.3 122.7 0.1195 0.0074 0.0616 3.7 7.6
7..8 0.037 504.3 122.7 0.1195 0.0051 0.0425 2.6 5.2
8..2 0.044 504.3 122.7 0.1195 0.0061 0.0506 3.1 6.2
8..3 0.039 504.3 122.7 0.1195 0.0054 0.0450 2.7 5.5
7..9 0.071 504.3 122.7 0.1195 0.0097 0.0814 4.9 10.0
9..10 0.032 504.3 122.7 0.1195 0.0044 0.0366 2.2 4.5
10..4 0.128 504.3 122.7 0.1195 0.0175 0.1464 8.8 18.0
10..5 0.101 504.3 122.7 0.1195 0.0137 0.1148 6.9 14.1
9..6 0.413 504.3 122.7 0.1195 0.0564 0.4719 28.4 57.9
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PB)
Pr(w>1) post mean +- SE for w
174 I 0.860 1.447
176 D 0.754 1.292
180 V 0.916 1.532
182 T 0.990** 1.642
195 A 0.774 1.319
197 Q 0.652 1.135
198 K 0.956* 1.592
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PB)
Pr(w>1) post mean +- SE for w
174 I 0.761 1.923 +- 1.316
180 V 0.728 1.813 +- 1.222
182 T 0.913 2.235 +- 1.277
195 A 0.654 1.687 +- 1.306
198 K 0.826 2.028 +- 1.237
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.006 0.028 0.083 0.172 0.289 0.423
ws: 0.513 0.284 0.116 0.047 0.020 0.009 0.005 0.003 0.002 0.001
Time used: 1:55
Model 1: NearlyNeutral -1532.872708 Model 2: PositiveSelection -1532.75116 Model 0: one-ratio -1547.550018 Model 3: discrete -1532.567386 Model 7: beta -1534.322648 Model 8: beta&w>1 -1532.582913 Model 0 vs 1 29.354619999999613 Model 2 vs 1 0.24309600000015053 Model 8 vs 7 3.4794700000002194
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
