--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Nov 25 23:13:55 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/340/para-PM/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/340/para-PM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/340/para-PM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/340/para-PM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1     -12333.42        -12348.59
2     -12334.05        -12346.00
--------------------------------------
TOTAL   -12333.69        -12347.97
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/340/para-PM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/340/para-PM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/340/para-PM/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.215468    0.000235    0.185948    0.245716    0.214551   1460.11   1480.56    1.001
r(A<->C){all}   0.070211    0.000159    0.046535    0.095320    0.069504   1001.33   1095.19    1.000
r(A<->G){all}   0.246062    0.000592    0.196643    0.291259    0.245008    818.59    867.36    1.000
r(A<->T){all}   0.077654    0.000254    0.050081    0.112489    0.076740    824.79   1043.79    1.000
r(C<->G){all}   0.082669    0.000137    0.061173    0.105579    0.082350   1224.44   1228.59    1.001
r(C<->T){all}   0.463522    0.000916    0.401322    0.519577    0.463207    726.46    770.06    1.000
r(G<->T){all}   0.059882    0.000152    0.035955    0.083768    0.059101   1039.79   1090.89    1.000
pi(A){all}      0.256117    0.000029    0.246261    0.266957    0.255934    786.56    896.07    1.000
pi(C){all}      0.241390    0.000027    0.231210    0.251583    0.241300   1014.53   1076.46    1.000
pi(G){all}      0.265563    0.000029    0.255699    0.276966    0.265630   1019.03   1113.03    1.000
pi(T){all}      0.236929    0.000029    0.226351    0.247065    0.236888   1018.03   1183.45    1.000
alpha{1,2}      0.074691    0.000876    0.009273    0.120961    0.081437   1056.60   1057.67    1.000
alpha{3}        4.561501    1.278441    2.596236    6.864729    4.426768   1324.89   1352.53    1.000
pinvar{all}     0.783682    0.000197    0.755815    0.810917    0.783976   1329.02   1415.01    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-11642.811706
Model 2: PositiveSelection	-11634.15508
Model 0: one-ratio	-11751.145057
Model 3: discrete	-11634.111729
Model 7: beta	-11661.268524
Model 8: beta&w>1	-11634.341059


Model 0 vs 1	216.66670199999862

Model 2 vs 1	17.31325199999992

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PM)

            Pr(w>1)     post mean +- SE for w

  1975 E      0.816         3.297
  1986 H      0.979*        3.756
  1995 G      0.795         3.238
  2001 E      0.773         3.177
  2002 A      0.913         3.570
  2003 T      0.673         2.894
  2007 P      0.706         2.986
  2011 S      0.897         3.525
  2045 A      0.660         2.858
  2047 A      0.920         3.588

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PM)

            Pr(w>1)     post mean +- SE for w

   326 S      0.568         1.611 +- 0.840
   862 M      0.705         1.849 +- 0.781
  1975 E      0.841         2.033 +- 0.753
  1984 T      0.642         1.742 +- 0.844
  1986 H      0.924         2.123 +- 0.708
  1989 G      0.567         1.610 +- 0.840
  1995 G      0.811         2.003 +- 0.768
  1996 D      0.534         1.552 +- 0.839
  1998 A      0.609         1.684 +- 0.845
  2001 E      0.807         1.997 +- 0.769
  2002 A      0.875         2.075 +- 0.737
  2003 T      0.759         1.927 +- 0.802
  2004 D      0.656         1.765 +- 0.847
  2005 D      0.699         1.835 +- 0.810
  2007 P      0.775         1.951 +- 0.792
  2008 A      0.642         1.742 +- 0.847
  2009 G      0.654         1.762 +- 0.843
  2011 S      0.868         2.067 +- 0.741
  2017 E      0.595         1.658 +- 0.843
  2031 G      0.662         1.775 +- 0.841
  2043 A      0.630         1.722 +- 0.848
  2044 A      0.631         1.722 +- 0.848
  2045 A      0.776         1.953 +- 0.777
  2047 A      0.877         2.078 +- 0.736


Model 8 vs 7	53.854929999997694

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PM)

            Pr(w>1)     post mean +- SE for w

   112 V      0.591         1.562
   135 M      0.613         1.617
   324 R      0.578         1.530
   326 S      0.950*        2.457
   799 F      0.538         1.430
   862 M      0.997**       2.572
  1975 E      1.000**       2.580
  1978 G      0.759         1.981
  1984 T      0.973*        2.512
  1986 H      1.000**       2.581
  1989 G      0.950*        2.457
  1990 G      0.502         1.340
  1995 G      0.999**       2.579
  1996 D      0.936         2.420
  1998 A      0.964*        2.490
  1999 P      0.557         1.478
  2000 D      0.771         2.011
  2001 E      0.999**       2.578
  2002 A      1.000**       2.580
  2003 T      0.994**       2.566
  2004 D      0.975*        2.517
  2005 D      0.989*        2.553
  2007 P      0.996**       2.570
  2008 A      0.972*        2.511
  2009 G      0.975*        2.519
  2011 S      1.000**       2.580
  2012 V      0.558         1.480
  2015 T      0.600         1.585
  2016 A      0.634         1.670
  2017 E      0.960*        2.480
  2031 G      0.977*        2.524
  2038 A      0.626         1.649
  2039 A      0.606         1.600
  2043 A      0.969*        2.504
  2044 A      0.969*        2.504
  2045 A      0.999**       2.577
  2047 A      1.000**       2.580

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PM)

            Pr(w>1)     post mean +- SE for w

   326 S      0.695         1.182 +- 0.532
   862 M      0.865         1.387 +- 0.354
  1975 E      0.948         1.470 +- 0.234
  1984 T      0.748         1.245 +- 0.497
  1986 H      0.984*        1.502 +- 0.160
  1989 G      0.694         1.181 +- 0.533
  1995 G      0.916         1.438 +- 0.290
  1996 D      0.665         1.146 +- 0.549
  1998 A      0.724         1.217 +- 0.514
  2001 E      0.915         1.437 +- 0.292
  2002 A      0.962*        1.483 +- 0.206
  2003 T      0.858         1.372 +- 0.385
  2004 D      0.752         1.250 +- 0.495
  2005 D      0.824         1.336 +- 0.419
  2007 P      0.876         1.392 +- 0.360
  2008 A      0.745         1.241 +- 0.499
  2009 G      0.756         1.255 +- 0.490
  2011 S      0.958*        1.479 +- 0.216
  2017 E      0.714         1.205 +- 0.520
  2031 G      0.763         1.263 +- 0.485
  2043 A      0.736         1.231 +- 0.506
  2044 A      0.736         1.231 +- 0.506
  2045 A      0.900         1.422 +- 0.312
  2047 A      0.963*        1.484 +- 0.205

>C1
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWMLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
LDHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
AAGRHSRASDRGEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQ
EWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFT
ATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVL
RSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMG
MQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDC
MYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTN
KIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELG
HDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNA
TDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEEL
DEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDS
PFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPIL
QDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLIN
FVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIF
NVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESE
NYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRE
TNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTED
QKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGL
NMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEP
WNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGA
KGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGIND
VYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCG
SATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDM
YYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPIC
RGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSST
LWRQREEYCARLIQHAWRKHKARGEGGGSFEPDTDHGDGGDPDAGDPAPD
EATDGDAPAGGDGSVNGTAEGAADADESNVNSPGEDAAAAAAAAAAAAAA
GTTTAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTADV
ooooooooooooooo
>C2
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWAYHNHNKSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
LDHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
AAGRHSRASDRGEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQ
EWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFT
ATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVL
RSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMG
MQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDC
MYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTN
KIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELG
HDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNA
TDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEEL
DEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDS
PFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPIL
QDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLIN
FVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIF
NVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESE
NYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRE
TNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTED
QKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGL
NMFTMTLDRYDASETYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEP
WNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGA
KGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGIND
VYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCG
SATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDM
YYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPIC
RGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSST
LWRQREEYCARLIQHAWRKHKARGEGGGSFEPDTDQGDGGDPDAGDPAPD
EQTDGDAPAGGDGSVNGTAEGAADADESNVNSPGEDAAAASAAAAAAAAG
TTTAGSPGAGSTGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTADVo
ooooooooooooooo
>C3
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
LEHRDFEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
AAGRHSRASDRGEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQ
EWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFT
ATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVL
RSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMG
MQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDC
MYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTN
KIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELG
HDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNA
TDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEEL
DEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDS
PFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPIL
QDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLIN
FVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIF
NVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESE
NYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRE
TNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTED
QKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGL
NMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEP
WNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGA
KGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGIND
VYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCG
SATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDM
YYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPIC
RGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSST
LWRQREEYCARLIQHAWRKHKARGAGGGSFEPDTDGDGDGDCDPDAVDPA
PDEQADGGEAPAGGALDGSVNGTGNGTGTGEGAADADESNVNSPGEDAAA
AAVAAAAAATTAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSRSPSI
TSRTADVoooooooo
>C4
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
LEHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
AAGRHSRASDRGEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQ
EWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFT
ATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVL
RSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMG
MQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDC
MYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTN
KIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELG
HDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNA
TDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEEL
DEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDS
PFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPIL
QDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLIN
FVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIF
NVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESE
NYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRE
TNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTED
QKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGL
NMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEP
WNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGA
KGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGIND
VYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCG
SATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDM
YYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPIC
RGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSST
LWRQREEYCARLIQHAWRKHKARGEGGGGSFEPDTDQGDGGDPDAADPAP
GDETADGEAPAGGDGSVNGTGGNGEGAADADESNVNSPGEDAAAAAAAAA
AGTTAGTTAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSR
TADVooooooooooo
>C5
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
LEHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
AAGRHSRASDRGEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQ
EWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFT
ATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVL
RSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMG
MQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDC
MYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTN
KIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELG
HDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNA
TDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEEL
DEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDS
PFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPIL
QDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLIN
FVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIF
NVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESE
NYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRE
TNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTED
QKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGL
NMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEP
WNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGA
KGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGIND
VYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCG
SATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDM
YYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPIC
RGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSST
LWRQREEYCARLIQHAWRKHKARGSGGDGGGSFEPDPEQGDHQGGGGNGG
EPEAGAPAPGDAADGEAPTDGEANGNGTGDGAAGADESNVNSPIEDAVAA
AAAAAVATAAGAVTTTTTAAGSPGAGSAGRQTAVLVESDGFVTKNGHKVV
IHSRSPSITSRTADV
>C6
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPFYSNILTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
LEHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
AAGRHSRASDRGEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKIQ
EWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFT
ATFAIEATMKLCAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVL
RSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMG
MQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDC
MYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTN
KIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELG
HDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNA
TDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEEL
DEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDS
PFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPIL
QDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLIN
FVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIF
NVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESE
NYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRE
TNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTED
QKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGL
NMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEP
WNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGA
KGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGIND
VYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCG
SATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDM
YYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPIC
RGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSST
LWRQREEYCARLIQHAWRKHKARGEGGGSFEPDPDQGGGGDGGDPDAAEP
QLDEPTDAEGPEGDGSGVNGTGTGDGAADADENNVNSPGEDAAAAAAAAA
GTTTGTAAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRT
ADVoooooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=2140 

C1              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C2              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C3              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C4              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C5              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C6              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
                **************************************************

C1              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C2              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C3              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C4              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C5              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C6              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
                **************************************************

C1              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWMLDPFNPIRRVAIYIL
C2              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
C3              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
C4              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
C5              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
C6              PLEDIDPFYSNILTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
                *******:***:**********************:***************

C1              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C2              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C3              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C4              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C5              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C6              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
                **************************************************

C1              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C2              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C3              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C4              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C5              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C6              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
                **************************************************

C1              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C2              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C3              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C4              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C5              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C6              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
                **************************************************

C1              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
C2              CIKKFPLDGSWGNLTDENWAYHNHNKSNWYSEDEGISFPLCGNISGAGQC
C3              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
C4              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
C5              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
C6              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
                ******************* ***:*.************************

C1              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C2              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C3              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C4              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C5              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C6              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
                **************************************************

C1              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C2              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C3              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C4              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C5              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C6              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
                **************************************************

C1              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C2              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C3              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C4              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C5              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C6              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
                **************************************************

C1              YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
C2              YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
C3              YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
C4              YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
C5              YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
C6              YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
                **************************************************

C1              KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
C2              KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
C3              KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
C4              KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
C5              KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
C6              KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
                **************************************************

C1              QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
C2              QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
C3              QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
C4              QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
C5              QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
C6              QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
                **************************************************

C1              YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
C2              YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
C3              YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
C4              YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
C5              YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
C6              YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
                **************************************************

C1              LDHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
C2              LDHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
C3              LEHRDFEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
C4              LEHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
C5              LEHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
C6              LEHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
                *:***:********************************************

C1              AAGRHSRASDRGEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQ
C2              AAGRHSRASDRGEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQ
C3              AAGRHSRASDRGEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQ
C4              AAGRHSRASDRGEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQ
C5              AAGRHSRASDRGEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQ
C6              AAGRHSRASDRGEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKIQ
                ************************************************:*

C1              EWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFT
C2              EWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFT
C3              EWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFT
C4              EWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFT
C5              EWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFT
C6              EWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFT
                **************************************************

C1              ATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVL
C2              ATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVL
C3              ATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVL
C4              ATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVL
C5              ATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVL
C6              ATFAIEATMKLCAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVL
                *********** **************************************

C1              RSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMG
C2              RSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMG
C3              RSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMG
C4              RSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMG
C5              RSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMG
C6              RSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMG
                **************************************************

C1              MQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDC
C2              MQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDC
C3              MQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDC
C4              MQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDC
C5              MQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDC
C6              MQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDC
                **************************************************

C1              MYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTN
C2              MYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTN
C3              MYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTN
C4              MYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTN
C5              MYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTN
C6              MYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTN
                **************************************************

C1              KIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELG
C2              KIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELG
C3              KIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELG
C4              KIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELG
C5              KIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELG
C6              KIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELG
                **************************************************

C1              HDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNA
C2              HDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNA
C3              HDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNA
C4              HDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNA
C5              HDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNA
C6              HDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNA
                **************************************************

C1              TDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEEL
C2              TDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEEL
C3              TDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEEL
C4              TDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEEL
C5              TDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEEL
C6              TDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEEL
                **************************************************

C1              DEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDS
C2              DEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDS
C3              DEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDS
C4              DEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDS
C5              DEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDS
C6              DEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDS
                **************************************************

C1              PFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPIL
C2              PFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPIL
C3              PFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPIL
C4              PFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPIL
C5              PFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPIL
C6              PFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPIL
                **************************************************

C1              QDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLIN
C2              QDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLIN
C3              QDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLIN
C4              QDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLIN
C5              QDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLIN
C6              QDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLIN
                **************************************************

C1              FVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIF
C2              FVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIF
C3              FVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIF
C4              FVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIF
C5              FVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIF
C6              FVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIF
                **************************************************

C1              NVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESE
C2              NVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESE
C3              NVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESE
C4              NVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESE
C5              NVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESE
C6              NVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESE
                **************************************************

C1              NYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRE
C2              NYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRE
C3              NYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRE
C4              NYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRE
C5              NYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRE
C6              NYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRE
                **************************************************

C1              TNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTED
C2              TNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTED
C3              TNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTED
C4              TNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTED
C5              TNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTED
C6              TNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTED
                **************************************************

C1              QKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGL
C2              QKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGL
C3              QKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGL
C4              QKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGL
C5              QKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGL
C6              QKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGL
                **************************************************

C1              NMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEP
C2              NMFTMTLDRYDASETYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEP
C3              NMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEP
C4              NMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEP
C5              NMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEP
C6              NMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEP
                *************:************************************

C1              WNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGA
C2              WNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGA
C3              WNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGA
C4              WNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGA
C5              WNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGA
C6              WNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGA
                **************************************************

C1              KGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGIND
C2              KGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGIND
C3              KGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGIND
C4              KGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGIND
C5              KGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGIND
C6              KGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGIND
                **************************************************

C1              VYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCG
C2              VYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCG
C3              VYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCG
C4              VYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCG
C5              VYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCG
C6              VYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCG
                **************************************************

C1              SATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDM
C2              SATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDM
C3              SATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDM
C4              SATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDM
C5              SATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDM
C6              SATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDM
                **************************************************

C1              YYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPIC
C2              YYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPIC
C3              YYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPIC
C4              YYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPIC
C5              YYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPIC
C6              YYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPIC
                **************************************************

C1              RGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSST
C2              RGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSST
C3              RGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSST
C4              RGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSST
C5              RGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSST
C6              RGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSST
                **************************************************

C1              LWRQREEYCARLIQHAWRKHKARGEGGG---SFEPDTD------HGDG-G
C2              LWRQREEYCARLIQHAWRKHKARGEGGG---SFEPDTD------QGDG-G
C3              LWRQREEYCARLIQHAWRKHKARGAGGG---SFEPDTDG-----DGDGDC
C4              LWRQREEYCARLIQHAWRKHKARGEGGGG--SFEPDTD------QGDG-G
C5              LWRQREEYCARLIQHAWRKHKARGSGGDGGGSFEPDPEQGDHQGGGGNGG
C6              LWRQREEYCARLIQHAWRKHKARGEGGG---SFEPDPDQG---GGGDG-G
                ************************ **.   *****.:       *..  

C1              DPDAGDPAP-DEATDGDAPAGG--DGSVNGT------AEGAADADESNVN
C2              DPDAGDPAP-DEQTDGDAPAGG--DGSVNGT------AEGAADADESNVN
C3              DPDAVDPAPDEQADGGEAPAGGALDGSVNGTGNGTGTGEGAADADESNVN
C4              DPDAADPAPGDETADGEAPAGG--DGSVNGTG---GNGEGAADADESNVN
C5              EPEAGAPAPGDAADG-EAPTDG----EANGNG----TGDGAAGADESNVN
C6              DPDAAEPQLDEPTDAEGPEGDG---SGVNGTG----TGDGAADADENNVN
                :*:*  *   :      .  .*     .**.      .:***.***.***

C1              SPGEDAAAAAAAAAAA-----AAAGTTTAGSPGAGSAGRQTAVLVESDGF
C2              SPGEDAAAASAAAAAA-----AAG-TTTAGSPGAGSTGRQTAVLVESDGF
C3              SPGEDAAAAAVAAAAA-----ATT----AGSPGAGSAGRQTAVLVESDGF
C4              SPGEDAAAAAAAAAAG-----TTA-GTTAGSPGAGSAGRQTAVLVESDGF
C5              SPIEDAVAAAAAAAVATAAGAVTTTTTAAGSPGAGSAGRQTAVLVESDGF
C6              SPGEDAAAAAAAAAGT-----TTG--TAAGSPGAGSAGRQTAVLVESDGF
                ** ***.**:.***       .:     ********:*************

C1              VTKNGHKVVIHSRSPSITSRTADVooooooooooooooo-
C2              VTKNGHKVVIHSRSPSITSRTADVoooooooooooooooo
C3              VTKNGHKVVIHSRSPSITSRTADVoooooooo--------
C4              VTKNGHKVVIHSRSPSITSRTADVooooooooooo-----
C5              VTKNGHKVVIHSRSPSITSRTADV----------------
C6              VTKNGHKVVIHSRSPSITSRTADVoooooooooooo----
                ************************                




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [68068]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [68068]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [68068]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [68068]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [68068]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2115 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [68068]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2115 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PM/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6