--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Nov 25 22:43:16 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/340/para-PK/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/340/para-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/340/para-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/340/para-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1     -12243.02        -12255.39
2     -12242.99        -12253.91
--------------------------------------
TOTAL   -12243.01        -12254.90
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/340/para-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/340/para-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/340/para-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.221014    0.000236    0.192176    0.251445    0.220288   1335.62   1344.62    1.000
r(A<->C){all}   0.067601    0.000151    0.045188    0.092595    0.066910    968.07   1008.13    1.000
r(A<->G){all}   0.259067    0.000623    0.208841    0.305800    0.258239    979.18   1004.01    1.001
r(A<->T){all}   0.081007    0.000272    0.050839    0.114314    0.080027    985.83   1062.30    1.001
r(C<->G){all}   0.084641    0.000143    0.062543    0.109144    0.084218   1073.39   1149.20    1.000
r(C<->T){all}   0.450013    0.000894    0.392469    0.507537    0.450701    876.13    942.40    1.000
r(G<->T){all}   0.057670    0.000144    0.034969    0.081590    0.057434   1196.78   1223.07    1.000
pi(A){all}      0.252988    0.000028    0.242132    0.262889    0.252983   1064.80   1118.82    1.000
pi(C){all}      0.242880    0.000028    0.232254    0.253248    0.242833    974.36   1060.54    1.000
pi(G){all}      0.267587    0.000029    0.257266    0.278234    0.267630    911.49   1077.67    1.000
pi(T){all}      0.236545    0.000027    0.226778    0.246855    0.236608    951.60   1043.18    1.000
alpha{1,2}      0.068781    0.000930    0.000583    0.110083    0.076088    845.25   1089.27    1.000
alpha{3}        4.605550    1.235655    2.605870    6.847092    4.484444   1467.53   1484.26    1.000
pinvar{all}     0.779800    0.000192    0.752955    0.806654    0.780114   1247.91   1318.27    1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-11541.813032
Model 2: PositiveSelection	-11533.64896
Model 0: one-ratio	-11650.440366
Model 3: discrete	-11533.611436
Model 7: beta	-11560.465002
Model 8: beta&w>1	-11533.830785


Model 0 vs 1	217.2546680000014

Model 2 vs 1	16.328143999999156

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PK)

            Pr(w>1)     post mean +- SE for w

  1951 E      0.805         3.176
  1962 H      0.977*        3.640
  1971 G      0.785         3.120
  1977 E      0.766         3.068
  1978 A      0.907         3.450
  1979 T      0.667         2.802
  1983 P      0.699         2.889
  1987 S      0.893         3.414
  2021 A      0.649         2.753
  2023 A      0.912         3.465

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PK)

            Pr(w>1)     post mean +- SE for w

   326 S      0.558         1.573 +- 0.822
   838 M      0.696         1.811 +- 0.765
  1951 E      0.833         1.994 +- 0.742
  1960 T      0.635         1.707 +- 0.828
  1962 H      0.920         2.085 +- 0.700
  1965 G      0.556         1.570 +- 0.822
  1971 G      0.804         1.964 +- 0.757
  1972 D      0.526         1.518 +- 0.821
  1974 A      0.600         1.647 +- 0.828
  1977 E      0.801         1.960 +- 0.757
  1978 A      0.869         2.036 +- 0.728
  1979 T      0.753         1.892 +- 0.788
  1980 D      0.646         1.725 +- 0.832
  1981 D      0.690         1.798 +- 0.795
  1983 P      0.769         1.915 +- 0.778
  1984 A      0.635         1.708 +- 0.831
  1985 G      0.651         1.734 +- 0.827
  1987 S      0.863         2.030 +- 0.731
  1993 E      0.592         1.634 +- 0.826
  2007 G      0.659         1.746 +- 0.825
  2019 A      0.622         1.685 +- 0.831
  2020 A      0.622         1.685 +- 0.831
  2021 A      0.768         1.914 +- 0.764
  2023 A      0.871         2.039 +- 0.727


Model 8 vs 7	53.268434000001434

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PK)

            Pr(w>1)     post mean +- SE for w

   112 V      0.613         1.567
   135 M      0.620         1.585
   324 R      0.582         1.493
   326 S      0.952*        2.386
   775 F      0.553         1.423
   838 M      0.997**       2.495
  1951 E      1.000**       2.502
  1954 G      0.759         1.921
  1960 T      0.974*        2.439
  1962 H      1.000**       2.502
  1965 G      0.951*        2.384
  1966 G      0.510         1.319
  1971 G      0.999**       2.500
  1972 D      0.938         2.352
  1974 A      0.965*        2.417
  1975 P      0.564         1.450
  1976 D      0.773         1.954
  1977 E      0.999**       2.500
  1978 A      1.000**       2.502
  1979 T      0.994**       2.489
  1980 D      0.975*        2.442
  1981 D      0.989*        2.476
  1983 P      0.996**       2.493
  1984 A      0.973*        2.438
  1985 G      0.977*        2.447
  1987 S      1.000**       2.502
  1988 V      0.575         1.476
  1991 T      0.617         1.578
  1992 A      0.651         1.659
  1993 E      0.963*        2.413
  2007 G      0.979*        2.451
  2014 A      0.646         1.647
  2015 A      0.626         1.599
  2019 A      0.970*        2.430
  2020 A      0.970*        2.430
  2021 A      0.999**       2.499
  2023 A      1.000**       2.502

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PK)

            Pr(w>1)     post mean +- SE for w

   326 S      0.687         1.173 +- 0.536
   838 M      0.862         1.384 +- 0.358
  1951 E      0.946         1.468 +- 0.236
  1960 T      0.744         1.241 +- 0.499
  1962 H      0.984*        1.502 +- 0.160
  1965 G      0.685         1.171 +- 0.538
  1971 G      0.914         1.437 +- 0.292
  1972 D      0.657         1.137 +- 0.553
  1974 A      0.718         1.210 +- 0.518
  1977 E      0.914         1.436 +- 0.293
  1978 A      0.962*        1.483 +- 0.207
  1979 T      0.857         1.372 +- 0.385
  1980 D      0.746         1.243 +- 0.499
  1981 D      0.821         1.332 +- 0.423
  1983 P      0.875         1.392 +- 0.360
  1984 A      0.741         1.237 +- 0.502
  1985 G      0.756         1.254 +- 0.491
  1987 S      0.957*        1.479 +- 0.217
  1993 E      0.713         1.204 +- 0.521
  2007 G      0.763         1.263 +- 0.485
  2019 A      0.731         1.225 +- 0.510
  2020 A      0.731         1.225 +- 0.509
  2021 A      0.898         1.420 +- 0.315
  2023 A      0.962*        1.483 +- 0.206

>C1
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWMLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESTSLSLPGSPFNIRRGSRSSH
KYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSEENG
AIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTKESK
LRNRNTRNQSVGATNGGTTCLDTNHKLDHRDYEIGLECTDEAGKIKHHDN
PFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGEDDDEDGPTFKD
KALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVELFITLCIVVNT
MFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGW
NIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISI
MGRTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTDHKDRFPDGDLPRWN
FTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVL
NLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADCF
KLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKGIKEQTQLEVAI
GDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGSHKNRPFKDESH
KGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDGDIIIHAHDEDI
LDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKTFQLIENKYFET
AVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWL
ALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALR
PLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGK
YFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQV
ATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLF
IGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPR
WRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLN
AIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEK
YFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLL
FLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWD
GVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMY
IAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEF
LDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGN
PIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLIQHAWRKHKARG
EGGGSFEPDTDHGDGGDPDAGDPAPDEATDGDAPAGGDGSVNGTAEGAAD
ADESNVNSPGEDAAAAAAAAAAAAAAGTTTAGSPGAGSAGRQTAVLVESD
GFVTKNGHKVVIHSRSPSITSRTADVooooooooooooooo
>C2
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWAYHNHNKSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESTSLSLPGSPFNIRRGSRSSH
KYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSEENG
AIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTKESK
LRNRNTRNQSVGATNGGTTCLDTNHKLDHRDYEIGLECTDEAGKIKHHDN
PFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGEDDDEDGPTFKD
KALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVELFITLCIVVNT
MFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGW
NIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISI
MGRTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTDHKDRFPDGDLPRWN
FTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVL
NLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADCF
KLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKGIKEQTQLEVAI
GDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGSHKNRPFKDESH
KGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDGDIIIHAHDEDI
LDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKTFQLIENKYFET
AVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWL
ALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALR
PLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGK
YFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQV
ATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLF
IGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPR
WRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASETYNAVLDYLN
AIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEK
YFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLL
FLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWD
GVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMY
IAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEF
LDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGN
PIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLIQHAWRKHKARG
EGGGSFEPDTDQGDGGDPDAGDPAPDEQTDGDAPAGGDGSVNGTAEGAAD
ADESNVNSPGEDAAAASAAAAAAAAGTTTAGSPGAGSTGRQTAVLVESDG
FVTKNGHKVVIHSRSPSITSRTADVoooooooooooooooo
>C3
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESTSLSLPGSPFNIRRGSRSSH
KYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSEENG
AIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTKESK
LRNRNTRNQSVGATNGGTTCLDTNHKLEHRDFEIGLECTDEAGKIKHHDN
PFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGEDDDEDGPTFKD
KALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVELFITLCIVVNT
MFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGW
NIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISI
MGRTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTDHKDRFPDGDLPRWN
FTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVL
NLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADCF
KLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKGIKEQTQLEVAI
GDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGSHKNRPFKDESH
KGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDGDIIIHAHDEDI
LDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKTFQLIENKYFET
AVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWL
ALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALR
PLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGK
YFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQV
ATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLF
IGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPR
WRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLN
AIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEK
YFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLL
FLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWD
GVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMY
IAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEF
LDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGN
PIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLIQHAWRKHKARG
AGGGSFEPDTDGDGDGDCDPDAVDPAPDEQADGGEAPAGGALDGSVNGTG
NGTGTGEGAADADESNVNSPGEDAAAAAVAAAAAATTAGSPGAGSAGRQT
AVLVESDGFVTKNGHKVVIHSRSPSITSRTADVoooooooo
>C4
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESTSLSLPGSPFNIRRGSRSSH
KYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSEENG
AIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTKESK
LRNRNTRNQSVGATNGGTTCLDTNHKLEHRDYEIGLECTDEAGKIKHHDN
PFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGEDDDEDGPTFKD
KALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVELFITLCIVVNT
MFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGW
NIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISI
MGRTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTDHKDRFPDGDLPRWN
FTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVL
NLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADCF
KLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKGIKEQTQLEVAI
GDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGSHKNRPFKDESH
KGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDGDIIIHAHDEDI
LDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKTFQLIENKYFET
AVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWL
ALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALR
PLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGK
YFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQV
ATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLF
IGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPR
WRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLN
AIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEK
YFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLL
FLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWD
GVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMY
IAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEF
LDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGN
PIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLIQHAWRKHKARG
EGGGGSFEPDTDQGDGGDPDAADPAPGDETADGEAPAGGDGSVNGTGGNG
EGAADADESNVNSPGEDAAAAAAAAAAGTTAGTTAGSPGAGSAGRQTAVL
VESDGFVTKNGHKVVIHSRSPSITSRTADVooooooooooo
>C5
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESTSLSLPGSPFNIRRGSRSSH
KYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSEENG
AIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTKESK
LRNRNTRNQSVGATNGGTTCLDTNHKLEHRDYEIGLECTDEAGKIKHHDN
PFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGEDDDEDGPTFKD
KALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVELFITLCIVVNT
MFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGW
NIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISI
MGRTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTDHKDRFPDGDLPRWN
FTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVL
NLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADCF
KLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKGIKEQTQLEVAI
GDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGSHKNRPFKDESH
KGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDGDIIIHAHDEDI
LDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKTFQLIENKYFET
AVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWL
ALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALR
PLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGK
YFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQV
ATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLF
IGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPR
WRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLN
AIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEK
YFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLL
FLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWD
GVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMY
IAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEF
LDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGN
PIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLIQHAWRKHKARG
SGGDGGGSFEPDPEQGDHQGGGGNGGEPEAGAPAPGDAADGEAPTDGEAN
GNGTGDGAAGADESNVNSPIEDAVAAAAAAAVATAAGAVTTTTTAAGSPG
AGSAGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTADV
>C6
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPFYSNILTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESTSLSLPGSPFNIRRGSRSSH
KYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSEENG
AIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTKESK
LRNRNTRNQSVGATNGGTTCLDTNHKLEHRDYEIGLECTDEAGKIKHHDN
PFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGEDDDEDGPTFKD
KALEVILKGIDVFCVWDCCWVWLKIQEWVSLIVFDPFVELFITLCIVVNT
MFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLCAMSPKYYFQEGW
NIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISI
MGRTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTDHKDRFPDGDLPRWN
FTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVL
NLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADCF
KLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKGIKEQTQLEVAI
GDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGSHKNRPFKDESH
KGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDGDIIIHAHDEDI
LDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKTFQLIENKYFET
AVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWL
ALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALR
PLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGK
YFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQV
ATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLF
IGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPR
WRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLN
AIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEK
YFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLL
FLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWD
GVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMY
IAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEF
LDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGN
PIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLIQHAWRKHKARG
EGGGSFEPDPDQGGGGDGGDPDAAEPQLDEPTDAEGPEGDGSGVNGTGTG
DGAADADENNVNSPGEDAAAAAAAAAGTTTGTAAGSPGAGSAGRQTAVLV
ESDGFVTKNGHKVVIHSRSPSITSRTADVoooooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=2116 

C1              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C2              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C3              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C4              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C5              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C6              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
                **************************************************

C1              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C2              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C3              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C4              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C5              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C6              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
                **************************************************

C1              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWMLDPFNPIRRVAIYIL
C2              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
C3              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
C4              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
C5              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
C6              PLEDIDPFYSNILTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
                *******:***:**********************:***************

C1              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C2              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C3              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C4              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C5              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C6              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
                **************************************************

C1              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C2              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C3              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C4              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C5              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C6              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
                **************************************************

C1              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C2              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C3              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C4              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C5              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C6              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
                **************************************************

C1              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
C2              CIKKFPLDGSWGNLTDENWAYHNHNKSNWYSEDEGISFPLCGNISGAGQC
C3              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
C4              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
C5              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
C6              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
                ******************* ***:*.************************

C1              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C2              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C3              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C4              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C5              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C6              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
                **************************************************

C1              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C2              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C3              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C4              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C5              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C6              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
                **************************************************

C1              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C2              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C3              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C4              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C5              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C6              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
                **************************************************

C1              YELFVGGEKGNDDNNKEKMSIRSVEVESESTSLSLPGSPFNIRRGSRSSH
C2              YELFVGGEKGNDDNNKEKMSIRSVEVESESTSLSLPGSPFNIRRGSRSSH
C3              YELFVGGEKGNDDNNKEKMSIRSVEVESESTSLSLPGSPFNIRRGSRSSH
C4              YELFVGGEKGNDDNNKEKMSIRSVEVESESTSLSLPGSPFNIRRGSRSSH
C5              YELFVGGEKGNDDNNKEKMSIRSVEVESESTSLSLPGSPFNIRRGSRSSH
C6              YELFVGGEKGNDDNNKEKMSIRSVEVESESTSLSLPGSPFNIRRGSRSSH
                **************************************************

C1              KYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSEENG
C2              KYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSEENG
C3              KYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSEENG
C4              KYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSEENG
C5              KYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSEENG
C6              KYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSEENG
                **************************************************

C1              AIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTKESK
C2              AIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTKESK
C3              AIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTKESK
C4              AIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTKESK
C5              AIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTKESK
C6              AIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTKESK
                **************************************************

C1              LRNRNTRNQSVGATNGGTTCLDTNHKLDHRDYEIGLECTDEAGKIKHHDN
C2              LRNRNTRNQSVGATNGGTTCLDTNHKLDHRDYEIGLECTDEAGKIKHHDN
C3              LRNRNTRNQSVGATNGGTTCLDTNHKLEHRDFEIGLECTDEAGKIKHHDN
C4              LRNRNTRNQSVGATNGGTTCLDTNHKLEHRDYEIGLECTDEAGKIKHHDN
C5              LRNRNTRNQSVGATNGGTTCLDTNHKLEHRDYEIGLECTDEAGKIKHHDN
C6              LRNRNTRNQSVGATNGGTTCLDTNHKLEHRDYEIGLECTDEAGKIKHHDN
                ***************************:***:******************

C1              PFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGEDDDEDGPTFKD
C2              PFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGEDDDEDGPTFKD
C3              PFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGEDDDEDGPTFKD
C4              PFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGEDDDEDGPTFKD
C5              PFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGEDDDEDGPTFKD
C6              PFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGEDDDEDGPTFKD
                **************************************************

C1              KALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVELFITLCIVVNT
C2              KALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVELFITLCIVVNT
C3              KALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVELFITLCIVVNT
C4              KALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVELFITLCIVVNT
C5              KALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVELFITLCIVVNT
C6              KALEVILKGIDVFCVWDCCWVWLKIQEWVSLIVFDPFVELFITLCIVVNT
                ************************:*************************

C1              MFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGW
C2              MFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGW
C3              MFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGW
C4              MFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGW
C5              MFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGW
C6              MFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLCAMSPKYYFQEGW
                ************************************* ************

C1              NIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISI
C2              NIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISI
C3              NIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISI
C4              NIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISI
C5              NIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISI
C6              NIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISI
                **************************************************

C1              MGRTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTDHKDRFPDGDLPRWN
C2              MGRTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTDHKDRFPDGDLPRWN
C3              MGRTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTDHKDRFPDGDLPRWN
C4              MGRTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTDHKDRFPDGDLPRWN
C5              MGRTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTDHKDRFPDGDLPRWN
C6              MGRTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTDHKDRFPDGDLPRWN
                **************************************************

C1              FTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVL
C2              FTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVL
C3              FTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVL
C4              FTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVL
C5              FTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVL
C6              FTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFLATVVIGNLVVL
                **************************************************

C1              NLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADCF
C2              NLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADCF
C3              NLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADCF
C4              NLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADCF
C5              NLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADCF
C6              NLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADCF
                **************************************************

C1              KLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKGIKEQTQLEVAI
C2              KLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKGIKEQTQLEVAI
C3              KLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKGIKEQTQLEVAI
C4              KLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKGIKEQTQLEVAI
C5              KLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKGIKEQTQLEVAI
C6              KLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKGIKEQTQLEVAI
                **************************************************

C1              GDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGSHKNRPFKDESH
C2              GDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGSHKNRPFKDESH
C3              GDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGSHKNRPFKDESH
C4              GDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGSHKNRPFKDESH
C5              GDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGSHKNRPFKDESH
C6              GDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGSHKNRPFKDESH
                **************************************************

C1              KGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDGDIIIHAHDEDI
C2              KGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDGDIIIHAHDEDI
C3              KGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDGDIIIHAHDEDI
C4              KGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDGDIIIHAHDEDI
C5              KGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDGDIIIHAHDEDI
C6              KGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDGDIIIHAHDEDI
                **************************************************

C1              LDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKTFQLIENKYFET
C2              LDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKTFQLIENKYFET
C3              LDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKTFQLIENKYFET
C4              LDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKTFQLIENKYFET
C5              LDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKTFQLIENKYFET
C6              LDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKTFQLIENKYFET
                **************************************************

C1              AVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWL
C2              AVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWL
C3              AVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWL
C4              AVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWL
C5              AVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWL
C6              AVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWL
                **************************************************

C1              ALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALR
C2              ALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALR
C3              ALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALR
C4              ALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALR
C5              ALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALR
C6              ALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALR
                **************************************************

C1              PLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGK
C2              PLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGK
C3              PLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGK
C4              PLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGK
C5              PLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGK
C6              PLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGK
                **************************************************

C1              YFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQV
C2              YFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQV
C3              YFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQV
C4              YFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQV
C5              YFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQV
C6              YFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDHVGNAYLCLFQV
                **************************************************

C1              ATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLF
C2              ATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLF
C3              ATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLF
C4              ATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLF
C5              ATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLF
C6              ATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLF
                **************************************************

C1              IGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPR
C2              IGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPR
C3              IGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPR
C4              IGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPR
C5              IGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPR
C6              IGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPR
                **************************************************

C1              WRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLN
C2              WRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASETYNAVLDYLN
C3              WRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLN
C4              WRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLN
C5              WRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLN
C6              WRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLN
                ***************************************:**********

C1              AIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEK
C2              AIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEK
C3              AIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEK
C4              AIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEK
C5              AIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEK
C6              AIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEK
                **************************************************

C1              YFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLL
C2              YFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLL
C3              YFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLL
C4              YFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLL
C5              YFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLL
C6              YFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLL
                **************************************************

C1              FLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWD
C2              FLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWD
C3              FLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWD
C4              FLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWD
C5              FLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWD
C6              FLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWD
                **************************************************

C1              GVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMY
C2              GVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMY
C3              GVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMY
C4              GVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMY
C5              GVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMY
C6              GVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYLVISFLIVINMY
                **************************************************

C1              IAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEF
C2              IAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEF
C3              IAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEF
C4              IAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEF
C5              IAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEF
C6              IAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEF
                **************************************************

C1              LDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGN
C2              LDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGN
C3              LDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGN
C4              LDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGN
C5              LDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGN
C6              LDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKGN
                **************************************************

C1              PIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLIQHAWRKHKARG
C2              PIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLIQHAWRKHKARG
C3              PIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLIQHAWRKHKARG
C4              PIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLIQHAWRKHKARG
C5              PIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLIQHAWRKHKARG
C6              PIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLIQHAWRKHKARG
                **************************************************

C1              EGGG---SFEPDTD------HGDG-GDPDAGDPAP-DEATDGDAPAGG--
C2              EGGG---SFEPDTD------QGDG-GDPDAGDPAP-DEQTDGDAPAGG--
C3              AGGG---SFEPDTDG-----DGDGDCDPDAVDPAPDEQADGGEAPAGGAL
C4              EGGGG--SFEPDTD------QGDG-GDPDAADPAPGDETADGEAPAGG--
C5              SGGDGGGSFEPDPEQGDHQGGGGNGGEPEAGAPAPGDAADG-EAPTDG--
C6              EGGG---SFEPDPDQGG---GGDG-GDPDAAEPQLDEPTDAEGPEGDG--
                 **.   *****.:       *..  :*:*  *   :      .  .*  

C1              DGSVNGT------AEGAADADESNVNSPGEDAAAAAAAAAAA-----AAA
C2              DGSVNGT------AEGAADADESNVNSPGEDAAAASAAAAAA-----AAG
C3              DGSVNGTGNGTGTGEGAADADESNVNSPGEDAAAAAVAAAAA-----ATT
C4              DGSVNGTG---GNGEGAADADESNVNSPGEDAAAAAAAAAAG-----TTA
C5              --EANGNG----TGDGAAGADESNVNSPIEDAVAAAAAAAVATAAGAVTT
C6              -SGVNGTG----TGDGAADADENNVNSPGEDAAAAAAAAAGT-----TTG
                   .**.      .:***.***.***** ***.**:.***       .: 

C1              GTTTAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTADV
C2              -TTTAGSPGAGSTGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTADV
C3              ----AGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTADV
C4              -GTTAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTADV
C5              TTTAAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTADV
C6              --TAAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTADV
                    ********:*************************************

C1              ooooooooooooooo-
C2              oooooooooooooooo
C3              oooooooo--------
C4              ooooooooooo-----
C5              ----------------
C6              oooooooooooo----
                                




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [67340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [67340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [67340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [67340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [67340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2091 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [67340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2091 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 209