--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Nov 25 21:57:53 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/340/para-PH/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/340/para-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/340/para-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/340/para-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1     -12327.65        -12340.65
2     -12327.06        -12339.91
--------------------------------------
TOTAL   -12327.31        -12340.35
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/340/para-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/340/para-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/340/para-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.216658    0.000232    0.188652    0.247476    0.215856   1363.54   1432.27    1.000
r(A<->C){all}   0.070780    0.000162    0.048317    0.098173    0.070015   1129.59   1220.91    1.001
r(A<->G){all}   0.247930    0.000602    0.203707    0.298680    0.247286    925.51    949.04    1.000
r(A<->T){all}   0.077228    0.000260    0.047508    0.110470    0.076254   1207.67   1241.33    1.000
r(C<->G){all}   0.082657    0.000141    0.061287    0.106363    0.082258   1129.29   1213.97    1.000
r(C<->T){all}   0.461850    0.000929    0.405186    0.522479    0.461771    936.32    959.12    1.000
r(G<->T){all}   0.059554    0.000146    0.037267    0.083534    0.058986   1271.65   1316.56    1.000
pi(A){all}      0.254293    0.000028    0.244254    0.264790    0.254200   1155.63   1208.62    1.000
pi(C){all}      0.242186    0.000028    0.231698    0.252432    0.242197    930.63    980.32    1.000
pi(G){all}      0.265404    0.000029    0.255430    0.276153    0.265359   1059.11   1149.20    1.000
pi(T){all}      0.238117    0.000027    0.228185    0.248016    0.238087    683.53    946.35    1.000
alpha{1,2}      0.072960    0.000894    0.004970    0.114928    0.080420    961.35    975.41    1.001
alpha{3}        4.560714    1.229999    2.591301    6.775710    4.440070   1209.31   1355.16    1.000
pinvar{all}     0.782703    0.000198    0.752838    0.807651    0.783214   1065.72   1135.14    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-11642.84059
Model 2: PositiveSelection	-11633.620255
Model 0: one-ratio	-11756.419985
Model 3: discrete	-11633.595173
Model 7: beta	-11662.06702
Model 8: beta&w>1	-11633.974851


Model 0 vs 1	227.15879000000132

Model 2 vs 1	18.440669999999955

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PH)

            Pr(w>1)     post mean +- SE for w

  1972 E      0.800         3.405
  1983 H      0.978*        3.937
  1992 G      0.804         3.416
  1998 E      0.912         3.740
  1999 A      0.912         3.741
  2000 T      0.635         2.907
  2004 P      0.687         3.064
  2008 S      0.893         3.684
  2042 A      0.637         2.913
  2044 A      0.917         3.756

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PH)

            Pr(w>1)     post mean +- SE for w

   315 S      0.566         1.670 +- 0.884
   859 M      0.708         1.930 +- 0.818
  1972 E      0.852         2.143 +- 0.773
  1981 T      0.649         1.822 +- 0.885
  1983 H      0.933         2.239 +- 0.718
  1986 G      0.563         1.665 +- 0.885
  1992 G      0.830         2.118 +- 0.788
  1993 D      0.530         1.603 +- 0.884
  1995 A      0.611         1.753 +- 0.888
  1997 D      0.571         1.679 +- 0.886
  1998 E      0.888         2.190 +- 0.751
  1999 A      0.888         2.191 +- 0.751
  2000 T      0.763         2.017 +- 0.834
  2001 D      0.657         1.838 +- 0.890
  2002 D      0.705         1.921 +- 0.847
  2004 P      0.787         2.053 +- 0.820
  2005 A      0.647         1.820 +- 0.888
  2006 G      0.661         1.843 +- 0.884
  2008 S      0.881         2.182 +- 0.756
  2014 E      0.596         1.726 +- 0.887
  2028 G      0.669         1.859 +- 0.881
  2040 A      0.635         1.798 +- 0.890
  2041 A      0.634         1.796 +- 0.890
  2042 A      0.786         2.053 +- 0.805
  2044 A      0.890         2.193 +- 0.750


Model 8 vs 7	56.184337999999116

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PH)

            Pr(w>1)     post mean +- SE for w

   101 V      0.599         1.576
   124 M      0.622         1.632
   313 R      0.586         1.544
   315 S      0.954*        2.457
   796 F      0.543         1.436
   859 M      0.997**       2.565
  1972 E      1.000**       2.572
  1975 G      0.798         2.071
  1981 T      0.974*        2.509
  1983 H      1.000**       2.573
  1986 G      0.952*        2.455
  1987 G      0.505         1.342
  1992 G      0.999**       2.571
  1993 D      0.939         2.422
  1995 A      0.966*        2.488
  1996 P      0.561         1.481
  1997 D      0.955*        2.460
  1998 E      1.000**       2.573
  1999 A      1.000**       2.573
  2000 T      0.994**       2.557
  2001 D      0.975*        2.510
  2002 D      0.990*        2.547
  2004 P      0.996**       2.563
  2005 A      0.974*        2.507
  2006 G      0.977*        2.515
  2008 S      1.000**       2.572
  2009 V      0.563         1.488
  2012 T      0.607         1.596
  2013 A      0.644         1.687
  2014 E      0.962*        2.479
  2028 G      0.979*        2.519
  2035 A      0.636         1.667
  2036 A      0.610         1.603
  2040 A      0.971*        2.501
  2041 A      0.971*        2.500
  2042 A      0.999**       2.570
  2044 A      1.000**       2.573

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PH)

            Pr(w>1)     post mean +- SE for w

   315 S      0.693         1.185 +- 0.541
   859 M      0.863         1.392 +- 0.367
  1972 E      0.947         1.476 +- 0.250
  1981 T      0.747         1.250 +- 0.506
  1983 H      0.983*        1.509 +- 0.182
  1986 G      0.690         1.182 +- 0.543
  1992 G      0.918         1.447 +- 0.300
  1993 D      0.662         1.148 +- 0.558
  1995 A      0.722         1.220 +- 0.524
  1997 D      0.694         1.187 +- 0.540
  1998 E      0.962*        1.490 +- 0.223
  1999 A      0.962*        1.490 +- 0.223
  2000 T      0.852         1.372 +- 0.402
  2001 D      0.746         1.248 +- 0.508
  2002 D      0.823         1.341 +- 0.430
  2004 P      0.874         1.397 +- 0.373
  2005 A      0.743         1.245 +- 0.510
  2006 G      0.755         1.259 +- 0.500
  2008 S      0.957*        1.486 +- 0.233
  2014 E      0.713         1.209 +- 0.529
  2028 G      0.762         1.268 +- 0.494
  2040 A      0.734         1.235 +- 0.516
  2041 A      0.733         1.234 +- 0.516
  2042 A      0.899         1.428 +- 0.325
  2044 A      0.963*        1.491 +- 0.222

>C1
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
IRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELASTPLEDIDPYYSN
VLTFVVVSKGKDIFRFSASKAMWMLDPFNPIRRVAIYILVHPLFSLFIIT
TILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLR
DAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVAIVPGLKTIV
GAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSW
GNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQCDDDYVCLQGFG
PNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIV
IIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAIREAEEAAAAKA
AKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCISYELFVGGEKGN
DDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVRKVSTTSLSLPG
SPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYAD
DSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGM
AVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHKLDHRDYEIGLE
CTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDR
GVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWV
SLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATF
AIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSF
RLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQL
FGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYV
GDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIA
EAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDE
ILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDD
DTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEE
GECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFW
QGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDI
LYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVA
SLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVL
LVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYT
WVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNI
YMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKK
YYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMF
TMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNL
FDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGI
RTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYN
FKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSAT
VGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYE
IWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGD
LMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWR
QREEYCARLIQHAWRKHKARGEGGGSFEPDTDHGDGGDPDAGDPAPDEAT
DGDAPAGGDGSVNGTAEGAADADESNVNSPGEDAAAAAAAAAAAAAAGTT
TAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTADVooo
oooooooooooo
>C2
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
IRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELASTPLEDIDPYYSN
VLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYILVHPLFSLFIIT
TILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLR
DAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVAIVPGLKTIV
GAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSW
GNLTDENWAYHNHNKSNWYSEDEGISFPLCGNISGAGQCDDDYVCLQGFG
PNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIV
IIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAIREAEEAAAAKA
AKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCISYELFVGGEKGN
DDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVRKVSTTSLSLPG
SPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYAD
DSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGM
AVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHKLDHRDYEIGLE
CTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDR
GVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWV
SLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATF
AIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSF
RLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQL
FGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYV
GDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIA
EAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDE
ILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDD
DTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEE
GECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFW
QGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDI
LYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVA
SLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVL
LVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYT
WVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNI
YMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKK
YYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMF
TMTLDRYDASETYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNL
FDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGI
RTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYN
FKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSAT
VGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYE
IWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGD
LMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWR
QREEYCARLIQHAWRKHKARGEGGGSFEPDTDQGDGGDPDAGDPAPDEQT
DGDAPAGGDGSVNGTAEGAADADESNVNSPGEDAAAASAAAAAAAAGTTT
AGSPGAGSTGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTADVoooo
oooooooooooo
>C3
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
IRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELASTPLEDIDPYYSN
VLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYILVHPLFSLFIIT
TILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLR
DAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVAIVPGLKTIV
GAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSW
GNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQCDDDYVCLQGFG
PNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIV
IIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAIREAEEAAAAKA
AKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCISYELFVGGEKGN
DDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVRKVSTTSLSLPG
SPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYAD
DSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGM
AVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHKLEHRDFEIGLE
CTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDR
GVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWV
SLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATF
AIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSF
RLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQL
FGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYV
GDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIA
EAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDE
ILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDD
DTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEE
GECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFW
QGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDI
LYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVA
SLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVL
LVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYT
WVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNI
YMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKK
YYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMF
TMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNL
FDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGI
RTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYN
FKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSAT
VGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYE
IWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGD
LMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWR
QREEYCARLIQHAWRKHKARGAGGGSFEPDTDGDGDGDCDPDAVDPAPDE
QADGGEAPAGGALDGSVNGTGNGTGTGEGAADADESNVNSPGEDAAAAAV
AAAAAATTAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSR
TADVoooooooo
>C4
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
IRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELASTPLEDIDPYYSN
VLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYILVHPLFSLFIIT
TILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLR
DAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVAIVPGLKTIV
GAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSW
GNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQCDDDYVCLQGFG
PNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIV
IIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAIREAEEAAAAKA
AKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCISYELFVGGEKGN
DDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVRKVSTTSLSLPG
SPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYAD
DSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGM
AVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHKLEHRDYEIGLE
CTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDR
GVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWV
SLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATF
AIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSF
RLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQL
FGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYV
GDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIA
EAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDE
ILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDD
DTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEE
GECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFW
QGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDI
LYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVA
SLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVL
LVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYT
WVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNI
YMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKK
YYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMF
TMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNL
FDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGI
RTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYN
FKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSAT
VGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYE
IWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGD
LMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWR
QREEYCARLIQHAWRKHKARGEGGGGSFEPDTDQGDGGDPDAADPAPGDE
TADGEAPAGGDGSVNGTGGNGEGAADADESNVNSPGEDAAAAAAAAAAGT
TAGTTAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTAD
Vooooooooooo
>C5
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
IRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELASTPLEDIDPYYSN
VLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYILVHPLFSLFIIT
TILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLR
DAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVAIVPGLKTIV
GAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSW
GNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQCDDDYVCLQGFG
PNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIV
IIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAIREAEEAAAAKA
AKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCISYELFVGGEKGN
DDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVRKVSTTSLSLPG
SPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYAD
DSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGM
AVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHKLEHRDYEIGLE
CTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDR
GVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWV
SLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATF
AIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSF
RLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQL
FGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYV
GDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIA
EAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDE
ILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDD
DTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEE
GECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFW
QGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDI
LYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVA
SLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVL
LVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYT
WVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNI
YMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKK
YYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMF
TMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNL
FDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGI
RTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYN
FKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSAT
VGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYE
IWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGD
LMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWR
QREEYCARLIQHAWRKHKARGSGGDGGGSFEPDPEQGDHQGGGGNGGEPE
AGAPAPGDAADGEAPTDGEANGNGTGDGAAGADESNVNSPIEDAVAAAAA
AAVATAAGAVTTTTTAAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHS
RSPSITSRTADV
>C6
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
IRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELASTPLEDIDPFYSN
ILTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYILVHPLFSLFIIT
TILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLR
DAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVAIVPGLKTIV
GAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSW
GNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQCDDDYVCLQGFG
PNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIV
IIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAIREAEEAAAAKA
AKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCISYELFVGGEKGN
DDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVRKVSTTSLSLPG
SPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYAD
DSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGM
AVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHKLEHRDYEIGLE
CTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDR
GVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKIQEWV
SLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATF
AIEATMKLCAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSF
RLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQL
FGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYV
GDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIA
EAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDE
ILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDD
DTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEE
GECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFW
QGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDI
LYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVA
SLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVL
LVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYT
WVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNI
YMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKK
YYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMF
TMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNL
FDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGI
RTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYN
FKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSAT
VGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYE
IWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGD
LMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWR
QREEYCARLIQHAWRKHKARGEGGGSFEPDPDQGGGGDGGDPDAAEPQLD
EPTDAEGPEGDGSGVNGTGTGDGAADADENNVNSPGEDAAAAAAAAAGTT
TGTAAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTADV
oooooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=2137 

C1              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C2              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C3              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C4              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C5              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C6              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
                **************************************************

C1              IRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELASTPLEDIDPYYSN
C2              IRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELASTPLEDIDPYYSN
C3              IRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELASTPLEDIDPYYSN
C4              IRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELASTPLEDIDPYYSN
C5              IRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELASTPLEDIDPYYSN
C6              IRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELASTPLEDIDPFYSN
                **********************************************:***

C1              VLTFVVVSKGKDIFRFSASKAMWMLDPFNPIRRVAIYILVHPLFSLFIIT
C2              VLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYILVHPLFSLFIIT
C3              VLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYILVHPLFSLFIIT
C4              VLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYILVHPLFSLFIIT
C5              VLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYILVHPLFSLFIIT
C6              ILTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYILVHPLFSLFIIT
                :**********************:**************************

C1              TILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLR
C2              TILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLR
C3              TILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLR
C4              TILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLR
C5              TILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLR
C6              TILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMARGFILCPFTYLR
                **************************************************

C1              DAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVAIVPGLKTIV
C2              DAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVAIVPGLKTIV
C3              DAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVAIVPGLKTIV
C4              DAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVAIVPGLKTIV
C5              DAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVAIVPGLKTIV
C6              DAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVAIVPGLKTIV
                **************************************************

C1              GAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSW
C2              GAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSW
C3              GAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSW
C4              GAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSW
C5              GAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSW
C6              GAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSW
                **************************************************

C1              GNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQCDDDYVCLQGFG
C2              GNLTDENWAYHNHNKSNWYSEDEGISFPLCGNISGAGQCDDDYVCLQGFG
C3              GNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQCDDDYVCLQGFG
C4              GNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQCDDDYVCLQGFG
C5              GNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQCDDDYVCLQGFG
C6              GNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQCDDDYVCLQGFG
                ******** ***:*.***********************************

C1              PNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIV
C2              PNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIV
C3              PNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIV
C4              PNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIV
C5              PNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIV
C6              PNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIV
                **************************************************

C1              IIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAIREAEEAAAAKA
C2              IIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAIREAEEAAAAKA
C3              IIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAIREAEEAAAAKA
C4              IIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAIREAEEAAAAKA
C5              IIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAIREAEEAAAAKA
C6              IIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAIREAEEAAAAKA
                **************************************************

C1              AKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCISYELFVGGEKGN
C2              AKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCISYELFVGGEKGN
C3              AKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCISYELFVGGEKGN
C4              AKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCISYELFVGGEKGN
C5              AKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCISYELFVGGEKGN
C6              AKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCISYELFVGGEKGN
                **************************************************

C1              DDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVRKVSTTSLSLPG
C2              DDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVRKVSTTSLSLPG
C3              DDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVRKVSTTSLSLPG
C4              DDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVRKVSTTSLSLPG
C5              DDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVRKVSTTSLSLPG
C6              DDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVRKVSTTSLSLPG
                **************************************************

C1              SPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYAD
C2              SPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYAD
C3              SPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYAD
C4              SPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYAD
C5              SPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYAD
C6              SPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYAD
                **************************************************

C1              DSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGM
C2              DSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGM
C3              DSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGM
C4              DSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGM
C5              DSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGM
C6              DSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGM
                **************************************************

C1              AVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHKLDHRDYEIGLE
C2              AVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHKLDHRDYEIGLE
C3              AVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHKLEHRDFEIGLE
C4              AVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHKLEHRDYEIGLE
C5              AVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHKLEHRDYEIGLE
C6              AVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHKLEHRDYEIGLE
                ****************************************:***:*****

C1              CTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDR
C2              CTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDR
C3              CTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDR
C4              CTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDR
C5              CTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDR
C6              CTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDR
                **************************************************

C1              GVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWV
C2              GVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWV
C3              GVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWV
C4              GVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWV
C5              GVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWV
C6              GVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKIQEWV
                *********************************************:****

C1              SLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATF
C2              SLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATF
C3              SLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATF
C4              SLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATF
C5              SLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATF
C6              SLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATF
                **************************************************

C1              AIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSF
C2              AIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSF
C3              AIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSF
C4              AIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSF
C5              AIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSF
C6              AIEATMKLCAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSF
                ******** *****************************************

C1              RLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQL
C2              RLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQL
C3              RLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQL
C4              RLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQL
C5              RLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQL
C6              RLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQL
                **************************************************

C1              FGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYV
C2              FGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYV
C3              FGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYV
C4              FGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYV
C5              FGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYV
C6              FGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYV
                **************************************************

C1              GDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIA
C2              GDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIA
C3              GDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIA
C4              GDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIA
C5              GDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIA
C6              GDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIA
                **************************************************

C1              EAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDE
C2              EAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDE
C3              EAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDE
C4              EAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDE
C5              EAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDE
C6              EAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDE
                **************************************************

C1              ILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDD
C2              ILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDD
C3              ILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDD
C4              ILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDD
C5              ILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDD
C6              ILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDD
                **************************************************

C1              DTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEE
C2              DTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEE
C3              DTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEE
C4              DTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEE
C5              DTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEE
C6              DTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEE
                **************************************************

C1              GECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFW
C2              GECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFW
C3              GECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFW
C4              GECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFW
C5              GECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFW
C6              GECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFW
                **************************************************

C1              QGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDI
C2              QGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDI
C3              QGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDI
C4              QGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDI
C5              QGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDI
C6              QGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDI
                **************************************************

C1              LYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVA
C2              LYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVA
C3              LYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVA
C4              LYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVA
C5              LYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVA
C6              LYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVA
                **************************************************

C1              SLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVL
C2              SLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVL
C3              SLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVL
C4              SLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVL
C5              SLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVL
C6              SLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVL
                **************************************************

C1              LVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYT
C2              LVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYT
C3              LVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYT
C4              LVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYT
C5              LVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYT
C6              LVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYT
                **************************************************

C1              WVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNI
C2              WVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNI
C3              WVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNI
C4              WVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNI
C5              WVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNI
C6              WVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNI
                **************************************************

C1              YMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKK
C2              YMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKK
C3              YMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKK
C4              YMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKK
C5              YMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKK
C6              YMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKK
                **************************************************

C1              YYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMF
C2              YYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMF
C3              YYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMF
C4              YYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMF
C5              YYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMF
C6              YYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMF
                **************************************************

C1              TMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNL
C2              TMTLDRYDASETYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNL
C3              TMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNL
C4              TMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNL
C5              TMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNL
C6              TMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNL
                **********:***************************************

C1              FDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGI
C2              FDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGI
C3              FDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGI
C4              FDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGI
C5              FDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGI
C6              FDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGI
                **************************************************

C1              RTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYN
C2              RTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYN
C3              RTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYN
C4              RTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYN
C5              RTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYN
C6              RTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYN
                **************************************************

C1              FKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSAT
C2              FKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSAT
C3              FKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSAT
C4              FKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSAT
C5              FKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSAT
C6              FKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSAT
                **************************************************

C1              VGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYE
C2              VGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYE
C3              VGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYE
C4              VGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYE
C5              VGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYE
C6              VGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYE
                **************************************************

C1              IWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGD
C2              IWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGD
C3              IWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGD
C4              IWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGD
C5              IWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGD
C6              IWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGD
                **************************************************

C1              LMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWR
C2              LMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWR
C3              LMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWR
C4              LMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWR
C5              LMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWR
C6              LMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWR
                **************************************************

C1              QREEYCARLIQHAWRKHKARGEGGG---SFEPDTD------HGDG-GDPD
C2              QREEYCARLIQHAWRKHKARGEGGG---SFEPDTD------QGDG-GDPD
C3              QREEYCARLIQHAWRKHKARGAGGG---SFEPDTDG-----DGDGDCDPD
C4              QREEYCARLIQHAWRKHKARGEGGGG--SFEPDTD------QGDG-GDPD
C5              QREEYCARLIQHAWRKHKARGSGGDGGGSFEPDPEQGDHQGGGGNGGEPE
C6              QREEYCARLIQHAWRKHKARGEGGG---SFEPDPDQG---GGGDG-GDPD
                ********************* **.   *****.:       *..  :*:

C1              AGDPAP-DEATDGDAPAGG--DGSVNGT------AEGAADADESNVNSPG
C2              AGDPAP-DEQTDGDAPAGG--DGSVNGT------AEGAADADESNVNSPG
C3              AVDPAPDEQADGGEAPAGGALDGSVNGTGNGTGTGEGAADADESNVNSPG
C4              AADPAPGDETADGEAPAGG--DGSVNGTG---GNGEGAADADESNVNSPG
C5              AGAPAPGDAADG-EAPTDG----EANGNG----TGDGAAGADESNVNSPI
C6              AAEPQLDEPTDAEGPEGDG---SGVNGTG----TGDGAADADENNVNSPG
                *  *   :      .  .*     .**.      .:***.***.***** 

C1              EDAAAAAAAAAAA-----AAAGTTTAGSPGAGSAGRQTAVLVESDGFVTK
C2              EDAAAASAAAAAA-----AAG-TTTAGSPGAGSTGRQTAVLVESDGFVTK
C3              EDAAAAAVAAAAA-----ATT----AGSPGAGSAGRQTAVLVESDGFVTK
C4              EDAAAAAAAAAAG-----TTA-GTTAGSPGAGSAGRQTAVLVESDGFVTK
C5              EDAVAAAAAAAVATAAGAVTTTTTAAGSPGAGSAGRQTAVLVESDGFVTK
C6              EDAAAAAAAAAGT-----TTG--TAAGSPGAGSAGRQTAVLVESDGFVTK
                ***.**:.***       .:     ********:****************

C1              NGHKVVIHSRSPSITSRTADVooooooooooooooo-
C2              NGHKVVIHSRSPSITSRTADVoooooooooooooooo
C3              NGHKVVIHSRSPSITSRTADVoooooooo--------
C4              NGHKVVIHSRSPSITSRTADVooooooooooo-----
C5              NGHKVVIHSRSPSITSRTADV----------------
C6              NGHKVVIHSRSPSITSRTADVoooooooooooo----
                *********************                




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [67976]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [67976]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [67976]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [67976]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2112 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2112 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process