--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Nov 25 14:15:13 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/336/Orct-PA/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/336/Orct-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/336/Orct-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/336/Orct-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3934.78 -3944.30 2 -3935.00 -3946.76 -------------------------------------- TOTAL -3934.88 -3946.15 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/336/Orct-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/336/Orct-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/336/Orct-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.583816 0.005648 0.455678 0.737542 0.574883 1248.93 1251.11 1.000 r(A<->C){all} 0.091026 0.000564 0.048507 0.137966 0.089912 902.73 962.96 1.000 r(A<->G){all} 0.255053 0.001772 0.169436 0.333643 0.252910 838.13 974.34 1.000 r(A<->T){all} 0.076528 0.001014 0.018947 0.140867 0.075000 721.62 844.64 1.000 r(C<->G){all} 0.074718 0.000278 0.043364 0.108035 0.073871 964.09 1037.39 1.000 r(C<->T){all} 0.426002 0.002359 0.332245 0.519718 0.424320 800.72 918.03 1.000 r(G<->T){all} 0.076672 0.000451 0.039299 0.120354 0.075223 1024.00 1120.17 1.000 pi(A){all} 0.190180 0.000089 0.172459 0.208845 0.189879 1118.91 1139.95 1.000 pi(C){all} 0.311252 0.000109 0.291921 0.332500 0.311134 1069.46 1108.51 1.000 pi(G){all} 0.285955 0.000111 0.265267 0.306400 0.285858 1274.97 1297.76 1.000 pi(T){all} 0.212613 0.000085 0.196566 0.232001 0.212542 975.74 1091.78 1.000 alpha{1,2} 0.057758 0.001131 0.000121 0.112412 0.058485 1184.05 1227.55 1.001 alpha{3} 3.410205 0.927018 1.743066 5.374621 3.289518 1247.08 1374.04 1.000 pinvar{all} 0.418133 0.002650 0.316747 0.517625 0.417329 997.93 1211.93 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -3611.430923 Model 2: PositiveSelection -3611.430958 Model 0: one-ratio -3626.067353 Model 3: discrete -3609.313276 Model 7: beta -3609.353783 Model 8: beta&w>1 -3609.349018 Model 0 vs 1 29.272860000000037 Model 2 vs 1 7.000000005064066E-5 Model 8 vs 7 0.009530000000268046
>C1 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA LPYENGSIYELSPHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNETK TCSSYVYDRSKYLNSAVTEWNLVCSRSLLSATSDSLFMLGVLLGSLIFGQ MSDKLGRKPTFFASLVLQLIFGVLAAVAPEYFSYTISRMIVGATTSGVFL VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQIAI TLPGLLFLCYYWIIPESARWLLMKGRKDEAFVIIEKAAKENKVEVPNEIY EQLVDEVAEKKKQDEMAASQPAATVFDLLRYPNLRRKTLLIFFDWFVNSG VYYGLSWNTNNLGGNQLVNFMISGAVEIPGYTLLLFTLNRWGRRSILCGT MMVAGISLLATIFVPSDMNWLIVACAMIGKLAITSSYGTIYIFSAEQFPT VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS LLLPETLNKPMPETIEDGENFGKKPAPQETAEEGGTQELSGMLNGKSG >C2 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA LPFENGSTYELSPHLWNLSYPQNERCSYYDVDYTAEYLNGSIPRSSNDTK SCTSYVYDRSKYLNSAVTEWDMVCSRSLLSATSDSLFMLGVLLGSFIFGQ MSDKLGRKPTFFASLVLQLIFGVFAAVAPEYFSYTISRMIVGATTSGVFL VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQVAL TLPGLLFLCYYWIIPESARWLLMKGRKDEAFVIIEKAAKENKVEVPNEVY EQLVDEVAEKKKQDEMAASQPAATVFDLLRYPNLRRKTLLIFFDWFVNSG VYYGLSWNTNNLGGNQLVNFVISGAVEIPGYTLLLFTLNRWGRRSILCGT MLVAGISLLATIFVPSDMNWLIIACAMIGKLAITSSYGTIYIFSAEQFPT VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS LLLPETLNKPMPETIEDGENFGKKPAPQEAAEDGGTQELNGMLNGRSG >C3 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA LPYENGSSYQLSPYLWNLSYPQGEVCAYYDVEFSEEYLNGSLPRSTNKTK SCTSYVYDQSKYLNSAVTEWDMVCSRSLLSATSDSLFMVGVLLGSFIFGQ MSDKLGRKPTFFASLVLQVIFGVLAAVAPEYVSYTISRIIVGATTSGVFL VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQISL TLPGLLFICYYWIIPESARWLLLKGRKDEAFVIIEKAAKENRVEIPNEIY EQLVDEVAEKKKQDELTASQPAATVFDLLRFPNLRRKTLLIFFDWFVNSG VYYGLSWNTNNLGGNQLVNFVISGGVEIPGYVLLLFTLNRWGRRSILCGT MVVAGVSLLATIFVPGDMNWLIIACAMIGKMAITASYGTIYIFSAEQFPT VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS LLLPETLNKPMPETIEDGENFGKKKAPQDSAELAGMLNGKSSoooooo >C4 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA LPYENGSSYDLPPHLWNLSYPQDEVCAYYDVEYSEEYLNGSLPRSSNATK SCSRYVYDQSKYLNSAVTEWDMVCSRSLLSATSDSLFMLGVLLGSFIFGQ MSDKLGRKPTFFASLVIQLIFGVLAAVAPEYFSYTISRMIVGATTSGVFL VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQIAL TLPGLLFVCYYWIIPESARWLLLKGRKDEAFVIIEKAAKENRVEIPSEIY EQLVDEVAEKKKQDELTASQPAATVFDLLRFPNLRRKTLLIFFDWFVNSG VYYGLSWNTNNLGGNQLVNFMISGAVEIPGYVLLLFTLNRWGRRSILCGT MMVAGVSLLATIFVPADLNWLIIACAMIGKLAITASYGTIYIFSAEQFPT VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS LLLPETLNKPMPETIEDGENFGKKTAPQESAEEGGSQELAGMLNEKSG CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=554 C1 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA C2 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA C3 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA C4 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA ************************************************** C1 LPYENGSIYELSPHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNETK C2 LPFENGSTYELSPHLWNLSYPQNERCSYYDVDYTAEYLNGSIPRSSNDTK C3 LPYENGSSYQLSPYLWNLSYPQGEVCAYYDVEFSEEYLNGSLPRSTNKTK C4 LPYENGSSYDLPPHLWNLSYPQDEVCAYYDVEYSEEYLNGSLPRSSNATK **:**** *:*.*:*******:.* *:****::: ******:***:* ** C1 TCSSYVYDRSKYLNSAVTEWNLVCSRSLLSATSDSLFMLGVLLGSLIFGQ C2 SCTSYVYDRSKYLNSAVTEWDMVCSRSLLSATSDSLFMLGVLLGSFIFGQ C3 SCTSYVYDQSKYLNSAVTEWDMVCSRSLLSATSDSLFMVGVLLGSFIFGQ C4 SCSRYVYDQSKYLNSAVTEWDMVCSRSLLSATSDSLFMLGVLLGSFIFGQ :*: ****:***********::****************:******:**** C1 MSDKLGRKPTFFASLVLQLIFGVLAAVAPEYFSYTISRMIVGATTSGVFL C2 MSDKLGRKPTFFASLVLQLIFGVFAAVAPEYFSYTISRMIVGATTSGVFL C3 MSDKLGRKPTFFASLVLQVIFGVLAAVAPEYVSYTISRIIVGATTSGVFL C4 MSDKLGRKPTFFASLVIQLIFGVLAAVAPEYFSYTISRMIVGATTSGVFL ****************:*:****:*******.******:*********** C1 VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQIAI C2 VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQVAL C3 VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQISL C4 VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQIAL ***********************************************::: C1 TLPGLLFLCYYWIIPESARWLLMKGRKDEAFVIIEKAAKENKVEVPNEIY C2 TLPGLLFLCYYWIIPESARWLLMKGRKDEAFVIIEKAAKENKVEVPNEVY C3 TLPGLLFICYYWIIPESARWLLLKGRKDEAFVIIEKAAKENRVEIPNEIY C4 TLPGLLFVCYYWIIPESARWLLLKGRKDEAFVIIEKAAKENRVEIPSEIY *******:**************:******************:**:*.*:* C1 EQLVDEVAEKKKQDEMAASQPAATVFDLLRYPNLRRKTLLIFFDWFVNSG C2 EQLVDEVAEKKKQDEMAASQPAATVFDLLRYPNLRRKTLLIFFDWFVNSG C3 EQLVDEVAEKKKQDELTASQPAATVFDLLRFPNLRRKTLLIFFDWFVNSG C4 EQLVDEVAEKKKQDELTASQPAATVFDLLRFPNLRRKTLLIFFDWFVNSG ***************::*************:******************* C1 VYYGLSWNTNNLGGNQLVNFMISGAVEIPGYTLLLFTLNRWGRRSILCGT C2 VYYGLSWNTNNLGGNQLVNFVISGAVEIPGYTLLLFTLNRWGRRSILCGT C3 VYYGLSWNTNNLGGNQLVNFVISGGVEIPGYVLLLFTLNRWGRRSILCGT C4 VYYGLSWNTNNLGGNQLVNFMISGAVEIPGYVLLLFTLNRWGRRSILCGT ********************:***.******.****************** C1 MMVAGISLLATIFVPSDMNWLIVACAMIGKLAITSSYGTIYIFSAEQFPT C2 MLVAGISLLATIFVPSDMNWLIIACAMIGKLAITSSYGTIYIFSAEQFPT C3 MVVAGVSLLATIFVPGDMNWLIIACAMIGKMAITASYGTIYIFSAEQFPT C4 MMVAGVSLLATIFVPADLNWLIIACAMIGKLAITASYGTIYIFSAEQFPT *:***:*********.*:****:*******:***:*************** C1 VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS C2 VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS C3 VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS C4 VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS ************************************************** C1 LLLPETLNKPMPETIEDGENFGKKPAPQETAEEGGTQELSGMLNGKSG-- C2 LLLPETLNKPMPETIEDGENFGKKPAPQEAAEDGGTQELNGMLNGRSG-- C3 LLLPETLNKPMPETIEDGENFGKKKAPQDSA------ELAGMLNGKSSoo C4 LLLPETLNKPMPETIEDGENFGKKTAPQESAEEGGSQELAGMLNEKSG-- ************************ ***::* ** **** :*. C1 ---- C2 ---- C3 oooo C4 ---- PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6678] Library Relaxation: Multi_proc [72] Relaxation Summary: [6678]--->[6644] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/336/Orct-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.271 Mb, Max= 30.650 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA LPYENGSIYELSPHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNETK TCSSYVYDRSKYLNSAVTEWNLVCSRSLLSATSDSLFMLGVLLGSLIFGQ MSDKLGRKPTFFASLVLQLIFGVLAAVAPEYFSYTISRMIVGATTSGVFL VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQIAI TLPGLLFLCYYWIIPESARWLLMKGRKDEAFVIIEKAAKENKVEVPNEIY EQLVDEVAEKKKQDEMAASQPAATVFDLLRYPNLRRKTLLIFFDWFVNSG VYYGLSWNTNNLGGNQLVNFMISGAVEIPGYTLLLFTLNRWGRRSILCGT MMVAGISLLATIFVPSDMNWLIVACAMIGKLAITSSYGTIYIFSAEQFPT VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS LLLPETLNKPMPETIEDGENFGKKPAPQETAEEGGTQELSGMLNGKSG-- ---- >C2 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA LPFENGSTYELSPHLWNLSYPQNERCSYYDVDYTAEYLNGSIPRSSNDTK SCTSYVYDRSKYLNSAVTEWDMVCSRSLLSATSDSLFMLGVLLGSFIFGQ MSDKLGRKPTFFASLVLQLIFGVFAAVAPEYFSYTISRMIVGATTSGVFL VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQVAL TLPGLLFLCYYWIIPESARWLLMKGRKDEAFVIIEKAAKENKVEVPNEVY EQLVDEVAEKKKQDEMAASQPAATVFDLLRYPNLRRKTLLIFFDWFVNSG VYYGLSWNTNNLGGNQLVNFVISGAVEIPGYTLLLFTLNRWGRRSILCGT MLVAGISLLATIFVPSDMNWLIIACAMIGKLAITSSYGTIYIFSAEQFPT VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS LLLPETLNKPMPETIEDGENFGKKPAPQEAAEDGGTQELNGMLNGRSG-- ---- >C3 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA LPYENGSSYQLSPYLWNLSYPQGEVCAYYDVEFSEEYLNGSLPRSTNKTK SCTSYVYDQSKYLNSAVTEWDMVCSRSLLSATSDSLFMVGVLLGSFIFGQ MSDKLGRKPTFFASLVLQVIFGVLAAVAPEYVSYTISRIIVGATTSGVFL VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQISL TLPGLLFICYYWIIPESARWLLLKGRKDEAFVIIEKAAKENRVEIPNEIY EQLVDEVAEKKKQDELTASQPAATVFDLLRFPNLRRKTLLIFFDWFVNSG VYYGLSWNTNNLGGNQLVNFVISGGVEIPGYVLLLFTLNRWGRRSILCGT MVVAGVSLLATIFVPGDMNWLIIACAMIGKMAITASYGTIYIFSAEQFPT VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS LLLPETLNKPMPETIEDGENFGKKKAPQDSA------ELAGMLNGKSSoo oooo >C4 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA LPYENGSSYDLPPHLWNLSYPQDEVCAYYDVEYSEEYLNGSLPRSSNATK SCSRYVYDQSKYLNSAVTEWDMVCSRSLLSATSDSLFMLGVLLGSFIFGQ MSDKLGRKPTFFASLVIQLIFGVLAAVAPEYFSYTISRMIVGATTSGVFL VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQIAL TLPGLLFVCYYWIIPESARWLLLKGRKDEAFVIIEKAAKENRVEIPSEIY EQLVDEVAEKKKQDELTASQPAATVFDLLRFPNLRRKTLLIFFDWFVNSG VYYGLSWNTNNLGGNQLVNFMISGAVEIPGYVLLLFTLNRWGRRSILCGT MMVAGVSLLATIFVPADLNWLIIACAMIGKLAITASYGTIYIFSAEQFPT VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS LLLPETLNKPMPETIEDGENFGKKTAPQESAEEGGSQELAGMLNEKSG-- ---- FORMAT of file /tmp/tmp1794363284668497783aln Not Supported[FATAL:T-COFFEE] >C1 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA LPYENGSIYELSPHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNETK TCSSYVYDRSKYLNSAVTEWNLVCSRSLLSATSDSLFMLGVLLGSLIFGQ MSDKLGRKPTFFASLVLQLIFGVLAAVAPEYFSYTISRMIVGATTSGVFL VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQIAI TLPGLLFLCYYWIIPESARWLLMKGRKDEAFVIIEKAAKENKVEVPNEIY EQLVDEVAEKKKQDEMAASQPAATVFDLLRYPNLRRKTLLIFFDWFVNSG VYYGLSWNTNNLGGNQLVNFMISGAVEIPGYTLLLFTLNRWGRRSILCGT MMVAGISLLATIFVPSDMNWLIVACAMIGKLAITSSYGTIYIFSAEQFPT VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS LLLPETLNKPMPETIEDGENFGKKPAPQETAEEGGTQELSGMLNGKSG-- ---- >C2 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA LPFENGSTYELSPHLWNLSYPQNERCSYYDVDYTAEYLNGSIPRSSNDTK SCTSYVYDRSKYLNSAVTEWDMVCSRSLLSATSDSLFMLGVLLGSFIFGQ MSDKLGRKPTFFASLVLQLIFGVFAAVAPEYFSYTISRMIVGATTSGVFL VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQVAL TLPGLLFLCYYWIIPESARWLLMKGRKDEAFVIIEKAAKENKVEVPNEVY EQLVDEVAEKKKQDEMAASQPAATVFDLLRYPNLRRKTLLIFFDWFVNSG VYYGLSWNTNNLGGNQLVNFVISGAVEIPGYTLLLFTLNRWGRRSILCGT MLVAGISLLATIFVPSDMNWLIIACAMIGKLAITSSYGTIYIFSAEQFPT VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS LLLPETLNKPMPETIEDGENFGKKPAPQEAAEDGGTQELNGMLNGRSG-- ---- >C3 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA LPYENGSSYQLSPYLWNLSYPQGEVCAYYDVEFSEEYLNGSLPRSTNKTK SCTSYVYDQSKYLNSAVTEWDMVCSRSLLSATSDSLFMVGVLLGSFIFGQ MSDKLGRKPTFFASLVLQVIFGVLAAVAPEYVSYTISRIIVGATTSGVFL VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQISL TLPGLLFICYYWIIPESARWLLLKGRKDEAFVIIEKAAKENRVEIPNEIY EQLVDEVAEKKKQDELTASQPAATVFDLLRFPNLRRKTLLIFFDWFVNSG VYYGLSWNTNNLGGNQLVNFVISGGVEIPGYVLLLFTLNRWGRRSILCGT MVVAGVSLLATIFVPGDMNWLIIACAMIGKMAITASYGTIYIFSAEQFPT VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS LLLPETLNKPMPETIEDGENFGKKKAPQDSA------ELAGMLNGKSSoo oooo >C4 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA LPYENGSSYDLPPHLWNLSYPQDEVCAYYDVEYSEEYLNGSLPRSSNATK SCSRYVYDQSKYLNSAVTEWDMVCSRSLLSATSDSLFMLGVLLGSFIFGQ MSDKLGRKPTFFASLVIQLIFGVLAAVAPEYFSYTISRMIVGATTSGVFL VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQIAL TLPGLLFVCYYWIIPESARWLLLKGRKDEAFVIIEKAAKENRVEIPSEIY EQLVDEVAEKKKQDELTASQPAATVFDLLRFPNLRRKTLLIFFDWFVNSG VYYGLSWNTNNLGGNQLVNFMISGAVEIPGYVLLLFTLNRWGRRSILCGT MMVAGVSLLATIFVPADLNWLIIACAMIGKLAITASYGTIYIFSAEQFPT VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS LLLPETLNKPMPETIEDGENFGKKTAPQESAEEGGSQELAGMLNEKSG-- ---- input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:554 S:98 BS:554 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # PW_SEQ_DISTANCES BOT 0 1 96.17 C1 C2 96.17 TOP 1 0 96.17 C2 C1 96.17 BOT 0 2 91.51 C1 C3 91.51 TOP 2 0 91.51 C3 C1 91.51 BOT 0 3 93.07 C1 C4 93.07 TOP 3 0 93.07 C4 C1 93.07 BOT 1 2 92.07 C2 C3 92.07 TOP 2 1 92.07 C3 C2 92.07 BOT 1 3 92.52 C2 C4 92.52 TOP 3 1 92.52 C4 C2 92.52 BOT 2 3 95.02 C3 C4 95.02 TOP 3 2 95.02 C4 C3 95.02 AVG 0 C1 * 93.58 AVG 1 C2 * 93.58 AVG 2 C3 * 92.87 AVG 3 C4 * 93.53 TOT TOT * 93.39 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGGCTACGACGACGTCATCACCCACCTGGGTGAATTCGGTCCGTATCA C2 ATGGGCTACGACGACGTCATCACCCACCTGGGTGAATTCGGGCCGTATCA C3 ATGGGCTACGACGACGTCATCACCCACCTGGGTGAATTTGGTCCGTATCA C4 ATGGGCTACGACGACGTCATCACCCACCTGGGTGAATTTGGACCCTACCA ************************************** ** ** ** ** C1 GAAGCGCATCTACTACCTTCTCTGCCTGCCGGCTATAGTCTGCGCCTTCC C2 GAAGCGCATCTACTATCTTCTCTGCCTGCCGGCCATAGTGTGCGCCTTCC C3 GAAGCGGATCTACTACCTCCTCTGCCTGCCAGCCATTGTCTGCGCCTTCC C4 GAAACGCATCTACTATCTCCTCTGTCTGCCGGCCATTGTCTGCGCTTTCC ***.** ******** ** ***** *****.** **:** ***** **** C1 ACAAGCTGGCCGGAGTGTTCCTGCTGGCCAAACCCGACTTCCGATGTGCC C2 ACAAGCTGGCCGGGGTGTTCCTGCTGGCCAAGCCCGACTTCCGATGCGCC C3 ACAAACTGGCTGGGGTATTCCTCCTGGCCAAGCCCGACTTTCGATGTGCC C4 ACAAGCTGGCGGGGGTATTCCTTCTGGCGAAGCCAGACTTCCGATGTGCC ****.***** **.**.***** ***** **.**.***** ***** *** C1 CTGCCATACGAAAATGGCAGTATCTATGAACTATCACCCCACCTGTGGAA C2 CTGCCCTTCGAGAATGGCAGCACCTATGAACTGTCGCCCCACCTGTGGAA C3 CTGCCCTACGAGAATGGCAGTAGCTATCAGTTATCGCCCTACCTGTGGAA C4 CTGCCCTACGAGAACGGCAGCAGCTATGATTTGCCGCCCCACCTGTGGAA *****.*:***.** ***** * **** * *. *.*** ********** C1 CCTATCGTATCCGGAGAATGAAAGGTGCTCCTACTACGATGTGGATTACA C2 CCTATCGTACCCGCAGAATGAGCGCTGCTCCTACTACGACGTGGACTACA C3 CCTCTCGTATCCGCAGGGCGAGGTGTGCGCCTACTACGATGTGGAGTTCT C4 CCTCTCGTATCCGCAGGACGAGGTGTGCGCCTACTACGATGTGGAGTACT ***.***** *** **.. **. *** ********** ***** *:*: C1 CGGAGGAGTACCTGAATGGCAGCATTCCACGGAGCAGCAACGAAACCAAG C2 CGGCGGAGTACCTGAATGGCAGCATTCCACGGAGCAGCAACGACACCAAG C3 CGGAGGAGTACCTCAATGGCAGTCTGCCCCGGAGCACAAACAAAACCAAG C4 CGGAGGAGTACCTAAATGGCAGCCTGCCCCGGAGCAGCAACGCAACCAAG ***.********* ******** .* **.******* .***...****** C1 ACCTGTTCCAGCTACGTTTACGATCGGAGCAAGTATCTCAATAGTGCGGT C2 AGCTGCACCAGCTACGTTTACGATCGGAGCAAGTACCTCAACAGTGCTGT C3 AGCTGCACCAGCTACGTTTACGACCAGAGCAAGTACCTCAACAGTGCCGT C4 AGCTGTTCCCGCTACGTTTACGACCAGAGCAAGTACCTCAACAGTGCCGT * *** :**.************* *.********* ***** ***** ** C1 GACCGAGTGGAACCTGGTCTGCAGTCGAAGCCTGCTAAGTGCCACCAGTG C2 GACCGAGTGGGACATGGTCTGCAGCCGAAGCCTGCTGAGTGCCACCAGTG C3 CACCGAATGGGACATGGTGTGTAGCAGGAGTCTGCTGAGTGCCACCAGTG C4 CACCGAGTGGGACATGGTGTGCAGCCGGAGTCTGCTGAGTGCCACCAGCG *****.***.**.**** ** ** .*.** *****.*********** * C1 ATTCGTTATTCATGCTGGGCGTGCTCCTGGGCAGCTTAATCTTTGGCCAG C2 ATTCCCTGTTCATGCTGGGCGTGCTCCTGGGCAGCTTCATCTTTGGCCAG C3 ATTCGCTCTTCATGGTCGGCGTGCTCCTCGGCAGCTTCATCTTTGGCCAG C4 ACTCACTCTTCATGCTGGGTGTGCTCCTGGGCAGCTTCATCTTTGGCCAG * ** * ****** * ** ******** ********.************ C1 ATGTCCGACAAGCTGGGACGCAAGCCCACCTTCTTCGCCTCACTGGTGCT C2 ATGTCCGACAAGCTGGGACGCAAGCCCACCTTCTTCGCCTCGCTGGTGCT C3 ATGTCCGATAAGCTGGGACGCAAGCCCACCTTCTTCGCCTCCCTGGTGCT C4 ATGTCCGACAAGCTGGGACGCAAGCCCACCTTCTTCGCCTCGCTGGTGAT ******** ******************************** ******.* C1 TCAGCTAATCTTCGGCGTTTTGGCTGCCGTGGCACCCGAATACTTTAGCT C2 GCAGCTAATCTTCGGCGTTTTTGCCGCCGTGGCACCCGAGTACTTTAGCT C3 CCAGGTGATCTTTGGCGTGCTGGCTGCGGTGGCTCCCGAGTATGTTAGCT C4 CCAGCTGATCTTTGGCGTGCTGGCTGCCGTGGCTCCGGAGTACTTCAGCT *** *.***** ***** * ** ** *****:** **.** * **** C1 ACACGATTTCCCGTATGATTGTGGGCGCCACCACTTCGGGAGTCTTCCTG C2 ACACGATTTCCCGCATGATTGTGGGCGCCACCACTTCGGGAGTCTTCCTG C3 ACACCATTTCCCGCATTATTGTGGGTGCCACCACATCCGGAGTCTTCCTG C4 ACACCATTTCCCGCATGATCGTGGGCGCCACCACGTCCGGAGTCTTCCTG **** ******** ** ** ***** ******** ** ************ C1 GTTGCCTATGTCATCGCCCTGGAGATGGTGGGCTCCTCGTATCGCCTCTT C2 GTTGCCTATGTGATCGCCCTGGAGATGGTGGGCTCCTCGTATCGCCTCTT C3 GTGGCCTATGTCATTGCCCTGGAGATGGTGGGCTCCTCGTATCGCCTCTT C4 GTGGCCTATGTGATTGCCCTGGAGATGGTGGGCTCCTCGTACCGCCTCTT ** ******** ** ************************** ******** C1 TGCCGGCGTGGCCATGCAGATGTTCTTCTCCGTGGGCTTTATGCTCACGG C2 CGCTGGCGTGGCCATGCAGATGTTCTTCTCCGTGGGCTTTATGCTCACTG C3 CGCCGGCGTGGCCATGCAGATGTTCTTCTCCGTGGGCTTCATGCTCACCG C4 CGCCGGCGTGGCCATGCAAATGTTCTTCTCCGTGGGCTTTATGCTAACCG ** **************.******************** *****.** * C1 CCGGCTTTGCCTACTTCATCCACGACTGGCGTTGGCTGCAGATTGCTATA C2 CTGGCTTTGCGTACTTCATCCACGACTGGCGTTGGCTGCAGGTCGCTCTG C3 CTGGCTTTGCCTACTTCATCCACGACTGGCGCTGGCTGCAGATTTCCCTG C4 CCGGCTTCGCCTACTTCATCCACGACTGGCGCTGGCTGCAGATTGCCCTG * ***** ** ******************** *********.* * .*. C1 ACCTTGCCGGGACTGCTCTTCCTTTGCTACTACTGGATCATTCCGGAGTC C2 ACCTTGCCGGGATTGCTCTTCCTGTGCTACTACTGGATCATTCCGGAGTC C3 ACGCTGCCGGGACTCCTCTTCATTTGCTACTACTGGATCATTCCGGAGTC C4 ACGCTGCCGGGACTGCTCTTCGTTTGCTACTACTGGATCATTCCGGAGTC ** ******** * ****** * ************************** C1 TGCCCGTTGGCTCTTGATGAAGGGTCGCAAGGATGAGGCCTTTGTGATCA C2 GGCGCGTTGGCTCCTGATGAAGGGTCGCAAGGATGAGGCCTTTGTGATCA C3 TGCCCGGTGGCTCTTGCTCAAGGGTCGCAAGGATGAGGCCTTTGTGATCA C4 GGCCCGCTGGCTTTTGCTCAAGGGTCGCAAGGACGAGGCCTTCGTGATCA ** ** ***** **.* ************** ******** ******* C1 TCGAGAAGGCGGCCAAGGAGAACAAGGTGGAGGTGCCCAATGAAATCTAC C2 TCGAGAAGGCGGCCAAGGAGAACAAGGTGGAGGTGCCCAACGAAGTCTAC C3 TCGAGAAGGCGGCCAAGGAGAACCGGGTGGAGATACCCAATGAGATCTAT C4 TCGAGAAGGCGGCCAAGGAGAACCGGGTTGAGATTCCCAGCGAGATCTAC ***********************..*** ***.* ****. **..**** C1 GAGCAGCTGGTGGACGAGGTGGCCGAAAAGAAGAAGCAGGACGAGATGGC C2 GAGCAGCTGGTGGACGAGGTGGCCGAAAAAAAGAAGCAGGACGAGATGGC C3 GAGCAGCTGGTGGACGAGGTGGCCGAAAAGAAGAAACAGGATGAGCTGAC C4 GAGCAGCTGGTGGACGAGGTGGCCGAGAAGAAGAAACAGGACGAACTGAC **************************.**.*****.***** **..**.* C1 CGCCTCCCAACCAGCGGCCACTGTGTTCGATCTCCTGCGCTATCCGAATC C2 CGCATCCCAACCAGCGGCCACCGTGTTCGATCTCCTGCGCTATCCCAATC C3 GGCTTCCCAGCCGGCGGCCACCGTATTCGATCTCCTCCGGTTTCCCAATC C4 GGCCTCCCAGCCGGCGGCCACCGTATTTGATCTGCTCCGGTTTCCCAATC ** *****.**.******** **.** ***** ** ** *:*** **** C1 TTCGACGGAAAACCCTGCTCATCTTCTTCGATTGGTTTGTGAACAGTGGC C2 TTCGCCGGAAAACCCTGCTGATCTTCTTCGACTGGTTTGTGAACAGTGGC C3 TTCGCCGGAAAACCCTGTTGATCTTCTTCGATTGGTTTGTGAACAGTGGC C4 TTCGCCGGAAAACCCTGTTGATCTTCTTCGATTGGTTTGTGAACAGCGGC ****.************ * *********** ************** *** C1 GTTTACTACGGCCTGTCGTGGAACACCAACAATCTGGGTGGAAACCAATT C2 GTGTACTACGGCCTGTCGTGGAACACCAACAACCTCGGTGGAAACCAACT C3 GTGTACTATGGACTGTCCTGGAACACAAACAACCTCGGCGGTAATCAACT C4 GTGTACTACGGTCTGTCGTGGAACACTAACAACCTGGGCGGCAATCAACT ** ***** ** ***** ******** ***** ** ** ** ** *** * C1 GGTTAACTTTATGATCTCTGGTGCCGTGGAAATTCCCGGCTATACGCTGC C2 GGTTAACTTTGTAATCTCTGGTGCCGTGGAAATACCGGGTTATACGCTGC C3 GGTTAACTTTGTGATCTCAGGAGGCGTTGAGATTCCCGGCTATGTGCTGC C4 GGTTAACTTTATGATCTCCGGTGCCGTTGAGATCCCCGGCTATGTGCTGC **********.*.***** **:* *** **.** ** ** ***. ***** C1 TCCTCTTCACTTTGAACCGTTGGGGTCGTCGCTCCATCCTGTGCGGTACC C2 TCCTCTTCACTTTGAACCGTTGGGGTCGTCGCTCCATCCTGTGCGGCACC C3 TCCTCTTCACCCTCAACCGCTGGGGTCGTCGCTCCATCTTGTGCGGCACC C4 TCCTCTTCACCCTCAACCGCTGGGGTCGTCGCTCCATCCTGTGCGGCACC ********** * ***** ****************** ******* *** C1 ATGATGGTGGCCGGAATTAGTCTGCTGGCCACCATCTTCGTGCCGAGCGA C2 ATGCTGGTGGCCGGGATCAGTCTGCTGGCCACCATCTTCGTGCCGAGCGA C3 ATGGTGGTTGCTGGGGTCAGCCTGTTGGCCACCATCTTCGTTCCTGGTGA C4 ATGATGGTGGCCGGGGTCAGCCTGCTGGCCACCATCTTCGTGCCCGCGGA *** **** ** **..* ** *** **************** ** . ** C1 CATGAATTGGCTGATCGTTGCCTGCGCCATGATAGGAAAGCTGGCTATTA C2 CATGAACTGGCTGATCATCGCGTGCGCCATGATAGGAAAGCTGGCCATCA C3 CATGAACTGGCTGATCATCGCCTGCGCCATGATAGGAAAGATGGCCATCA C4 CTTGAACTGGCTGATCATCGCCTGTGCCATGATAGGAAAGCTGGCCATCA *:**** *********.* ** ** ***************.**** ** * C1 CCTCGTCGTATGGAACCATCTACATATTCTCAGCGGAACAGTTCCCGACT C2 CCTCGTCGTACGGCACCATCTACATCTTCTCGGCGGAGCAGTTCCCGACG C3 CCGCCTCCTACGGCACAATATACATCTTCTCGGCGGAACAATTCCCGACG C4 CCGCCTCCTATGGCACCATATACATCTTCTCGGCGGAACAGTTCCCGACG ** * ** ** **.**.**.*****.*****.*****.**.******** C1 GTGGTGCGGAATGTGGGTCTGGGAGCCTCCTCCATGGTGGCTCGCGTGGG C2 GTGGTCAGGAATGTGGGTCTGGGCGCCTCCTCCATGGTAGCTCGCGTGGG C3 GTGGTGAGGAACGTGGGTCTGGGTGCCTCCTCCATGGTGGCTCGAGTTGG C4 GTGGTTAGGAACGTGGGTCTGGGCGCCTCCTCTATGGTGGCACGAGTGGG ***** .**** *********** ******** *****.**:**.** ** C1 TGGCATTCTGGCACCCTACCTAAAACTGCTGGGCGAGATCTGGCGACCGC C2 TGGCATTCTGGCACCCTACCTGAAACTGCTGGGCGAGATCTGGCGACCGC C3 TGGCATCCTGGCGCCGTACCTCAAGTTGCTGGGCGAGATCTGGCGACCAT C4 CGGCATTCTGGCGCCATACCTCAAGTTGCTGGGCGAGATCTGGCGCCCAT ***** *****.** ***** **. *******************.**. C1 TGCCGCTGATCATCTGCGGAGCACTGTCTCTCACCGCTGGCCTGCTGTCC C2 TGCCGCTGATCATCTGCGGCGCTCTGTCCCTCACCGCCGGACTGCTGTCC C3 TGCCGCTGATCATCTGCGGAGCCCTGTCCCTCACCGCCGGATTGCTGTCG C4 TGCCACTGATCATCTGCGGCGCCCTGTCGCTCACCGCCGGACTGCTGTCC ****.**************.** ***** ******** **. ******* C1 CTGCTCTTGCCGGAGACCCTTAACAAACCCATGCCGGAGACCATCGAGGA C2 CTGCTCCTGCCGGAGACCCTGAACAAACCCATGCCGGAGACCATCGAGGA C3 CTCCTTCTGCCGGAGACTCTGAACAAACCCATGCCGGAAACCATCGAAGA C4 CTGCTGCTGCCGGAAACGCTCAACAAACCCATGCCGGAGACCATCGAGGA ** ** *******.** ** *****************.********.** C1 TGGGGAGAACTTCGGCAAGAAGCCGGCGCCGCAAGAAACCGCCGAGGAGG C2 TGGGGAGAACTTCGGCAAGAAGCCGGCGCCACAAGAAGCCGCCGAGGACG C3 TGGGGAGAACTTCGGCAAAAAGAAGGCGCCTCAAGATTCCGCT------- C4 TGGGGAGAACTTCGGCAAGAAGACGGCGCCACAAGAGTCCGCCGAGGAGG ******************.***..****** ***** **** C1 GTGGCACCCAGGAGCTGTCCGGAATGCTGAACGGAAAGTCCGGC------ C2 GCGGCACCCAAGAGCTCAACGGGATGCTCAACGGCAGGTCGGGC------ C3 -----------GAGCTGGCCGGGATGCTCAACGGAAAGTCCAGC------ C4 GCGGCTCCCAAGAGCTGGCCGGGATGCTCAACGAAAAGTCCGGC------ ***** .***.***** ****..*.*** .** C1 ------------ C2 ------------ C3 ------------ C4 ------------ >C1 ATGGGCTACGACGACGTCATCACCCACCTGGGTGAATTCGGTCCGTATCA GAAGCGCATCTACTACCTTCTCTGCCTGCCGGCTATAGTCTGCGCCTTCC ACAAGCTGGCCGGAGTGTTCCTGCTGGCCAAACCCGACTTCCGATGTGCC CTGCCATACGAAAATGGCAGTATCTATGAACTATCACCCCACCTGTGGAA CCTATCGTATCCGGAGAATGAAAGGTGCTCCTACTACGATGTGGATTACA CGGAGGAGTACCTGAATGGCAGCATTCCACGGAGCAGCAACGAAACCAAG ACCTGTTCCAGCTACGTTTACGATCGGAGCAAGTATCTCAATAGTGCGGT GACCGAGTGGAACCTGGTCTGCAGTCGAAGCCTGCTAAGTGCCACCAGTG ATTCGTTATTCATGCTGGGCGTGCTCCTGGGCAGCTTAATCTTTGGCCAG ATGTCCGACAAGCTGGGACGCAAGCCCACCTTCTTCGCCTCACTGGTGCT TCAGCTAATCTTCGGCGTTTTGGCTGCCGTGGCACCCGAATACTTTAGCT ACACGATTTCCCGTATGATTGTGGGCGCCACCACTTCGGGAGTCTTCCTG GTTGCCTATGTCATCGCCCTGGAGATGGTGGGCTCCTCGTATCGCCTCTT TGCCGGCGTGGCCATGCAGATGTTCTTCTCCGTGGGCTTTATGCTCACGG CCGGCTTTGCCTACTTCATCCACGACTGGCGTTGGCTGCAGATTGCTATA ACCTTGCCGGGACTGCTCTTCCTTTGCTACTACTGGATCATTCCGGAGTC TGCCCGTTGGCTCTTGATGAAGGGTCGCAAGGATGAGGCCTTTGTGATCA TCGAGAAGGCGGCCAAGGAGAACAAGGTGGAGGTGCCCAATGAAATCTAC GAGCAGCTGGTGGACGAGGTGGCCGAAAAGAAGAAGCAGGACGAGATGGC CGCCTCCCAACCAGCGGCCACTGTGTTCGATCTCCTGCGCTATCCGAATC TTCGACGGAAAACCCTGCTCATCTTCTTCGATTGGTTTGTGAACAGTGGC GTTTACTACGGCCTGTCGTGGAACACCAACAATCTGGGTGGAAACCAATT GGTTAACTTTATGATCTCTGGTGCCGTGGAAATTCCCGGCTATACGCTGC TCCTCTTCACTTTGAACCGTTGGGGTCGTCGCTCCATCCTGTGCGGTACC ATGATGGTGGCCGGAATTAGTCTGCTGGCCACCATCTTCGTGCCGAGCGA CATGAATTGGCTGATCGTTGCCTGCGCCATGATAGGAAAGCTGGCTATTA CCTCGTCGTATGGAACCATCTACATATTCTCAGCGGAACAGTTCCCGACT GTGGTGCGGAATGTGGGTCTGGGAGCCTCCTCCATGGTGGCTCGCGTGGG TGGCATTCTGGCACCCTACCTAAAACTGCTGGGCGAGATCTGGCGACCGC TGCCGCTGATCATCTGCGGAGCACTGTCTCTCACCGCTGGCCTGCTGTCC CTGCTCTTGCCGGAGACCCTTAACAAACCCATGCCGGAGACCATCGAGGA TGGGGAGAACTTCGGCAAGAAGCCGGCGCCGCAAGAAACCGCCGAGGAGG GTGGCACCCAGGAGCTGTCCGGAATGCTGAACGGAAAGTCCGGC------ ------------ >C2 ATGGGCTACGACGACGTCATCACCCACCTGGGTGAATTCGGGCCGTATCA GAAGCGCATCTACTATCTTCTCTGCCTGCCGGCCATAGTGTGCGCCTTCC ACAAGCTGGCCGGGGTGTTCCTGCTGGCCAAGCCCGACTTCCGATGCGCC CTGCCCTTCGAGAATGGCAGCACCTATGAACTGTCGCCCCACCTGTGGAA CCTATCGTACCCGCAGAATGAGCGCTGCTCCTACTACGACGTGGACTACA CGGCGGAGTACCTGAATGGCAGCATTCCACGGAGCAGCAACGACACCAAG AGCTGCACCAGCTACGTTTACGATCGGAGCAAGTACCTCAACAGTGCTGT GACCGAGTGGGACATGGTCTGCAGCCGAAGCCTGCTGAGTGCCACCAGTG ATTCCCTGTTCATGCTGGGCGTGCTCCTGGGCAGCTTCATCTTTGGCCAG ATGTCCGACAAGCTGGGACGCAAGCCCACCTTCTTCGCCTCGCTGGTGCT GCAGCTAATCTTCGGCGTTTTTGCCGCCGTGGCACCCGAGTACTTTAGCT ACACGATTTCCCGCATGATTGTGGGCGCCACCACTTCGGGAGTCTTCCTG GTTGCCTATGTGATCGCCCTGGAGATGGTGGGCTCCTCGTATCGCCTCTT CGCTGGCGTGGCCATGCAGATGTTCTTCTCCGTGGGCTTTATGCTCACTG CTGGCTTTGCGTACTTCATCCACGACTGGCGTTGGCTGCAGGTCGCTCTG ACCTTGCCGGGATTGCTCTTCCTGTGCTACTACTGGATCATTCCGGAGTC GGCGCGTTGGCTCCTGATGAAGGGTCGCAAGGATGAGGCCTTTGTGATCA TCGAGAAGGCGGCCAAGGAGAACAAGGTGGAGGTGCCCAACGAAGTCTAC GAGCAGCTGGTGGACGAGGTGGCCGAAAAAAAGAAGCAGGACGAGATGGC CGCATCCCAACCAGCGGCCACCGTGTTCGATCTCCTGCGCTATCCCAATC TTCGCCGGAAAACCCTGCTGATCTTCTTCGACTGGTTTGTGAACAGTGGC GTGTACTACGGCCTGTCGTGGAACACCAACAACCTCGGTGGAAACCAACT GGTTAACTTTGTAATCTCTGGTGCCGTGGAAATACCGGGTTATACGCTGC TCCTCTTCACTTTGAACCGTTGGGGTCGTCGCTCCATCCTGTGCGGCACC ATGCTGGTGGCCGGGATCAGTCTGCTGGCCACCATCTTCGTGCCGAGCGA CATGAACTGGCTGATCATCGCGTGCGCCATGATAGGAAAGCTGGCCATCA CCTCGTCGTACGGCACCATCTACATCTTCTCGGCGGAGCAGTTCCCGACG GTGGTCAGGAATGTGGGTCTGGGCGCCTCCTCCATGGTAGCTCGCGTGGG TGGCATTCTGGCACCCTACCTGAAACTGCTGGGCGAGATCTGGCGACCGC TGCCGCTGATCATCTGCGGCGCTCTGTCCCTCACCGCCGGACTGCTGTCC CTGCTCCTGCCGGAGACCCTGAACAAACCCATGCCGGAGACCATCGAGGA TGGGGAGAACTTCGGCAAGAAGCCGGCGCCACAAGAAGCCGCCGAGGACG GCGGCACCCAAGAGCTCAACGGGATGCTCAACGGCAGGTCGGGC------ ------------ >C3 ATGGGCTACGACGACGTCATCACCCACCTGGGTGAATTTGGTCCGTATCA GAAGCGGATCTACTACCTCCTCTGCCTGCCAGCCATTGTCTGCGCCTTCC ACAAACTGGCTGGGGTATTCCTCCTGGCCAAGCCCGACTTTCGATGTGCC CTGCCCTACGAGAATGGCAGTAGCTATCAGTTATCGCCCTACCTGTGGAA CCTCTCGTATCCGCAGGGCGAGGTGTGCGCCTACTACGATGTGGAGTTCT CGGAGGAGTACCTCAATGGCAGTCTGCCCCGGAGCACAAACAAAACCAAG AGCTGCACCAGCTACGTTTACGACCAGAGCAAGTACCTCAACAGTGCCGT CACCGAATGGGACATGGTGTGTAGCAGGAGTCTGCTGAGTGCCACCAGTG ATTCGCTCTTCATGGTCGGCGTGCTCCTCGGCAGCTTCATCTTTGGCCAG ATGTCCGATAAGCTGGGACGCAAGCCCACCTTCTTCGCCTCCCTGGTGCT CCAGGTGATCTTTGGCGTGCTGGCTGCGGTGGCTCCCGAGTATGTTAGCT ACACCATTTCCCGCATTATTGTGGGTGCCACCACATCCGGAGTCTTCCTG GTGGCCTATGTCATTGCCCTGGAGATGGTGGGCTCCTCGTATCGCCTCTT CGCCGGCGTGGCCATGCAGATGTTCTTCTCCGTGGGCTTCATGCTCACCG CTGGCTTTGCCTACTTCATCCACGACTGGCGCTGGCTGCAGATTTCCCTG ACGCTGCCGGGACTCCTCTTCATTTGCTACTACTGGATCATTCCGGAGTC TGCCCGGTGGCTCTTGCTCAAGGGTCGCAAGGATGAGGCCTTTGTGATCA TCGAGAAGGCGGCCAAGGAGAACCGGGTGGAGATACCCAATGAGATCTAT GAGCAGCTGGTGGACGAGGTGGCCGAAAAGAAGAAACAGGATGAGCTGAC GGCTTCCCAGCCGGCGGCCACCGTATTCGATCTCCTCCGGTTTCCCAATC TTCGCCGGAAAACCCTGTTGATCTTCTTCGATTGGTTTGTGAACAGTGGC GTGTACTATGGACTGTCCTGGAACACAAACAACCTCGGCGGTAATCAACT GGTTAACTTTGTGATCTCAGGAGGCGTTGAGATTCCCGGCTATGTGCTGC TCCTCTTCACCCTCAACCGCTGGGGTCGTCGCTCCATCTTGTGCGGCACC ATGGTGGTTGCTGGGGTCAGCCTGTTGGCCACCATCTTCGTTCCTGGTGA CATGAACTGGCTGATCATCGCCTGCGCCATGATAGGAAAGATGGCCATCA CCGCCTCCTACGGCACAATATACATCTTCTCGGCGGAACAATTCCCGACG GTGGTGAGGAACGTGGGTCTGGGTGCCTCCTCCATGGTGGCTCGAGTTGG TGGCATCCTGGCGCCGTACCTCAAGTTGCTGGGCGAGATCTGGCGACCAT TGCCGCTGATCATCTGCGGAGCCCTGTCCCTCACCGCCGGATTGCTGTCG CTCCTTCTGCCGGAGACTCTGAACAAACCCATGCCGGAAACCATCGAAGA TGGGGAGAACTTCGGCAAAAAGAAGGCGCCTCAAGATTCCGCT------- -----------GAGCTGGCCGGGATGCTCAACGGAAAGTCCAGC------ ------------ >C4 ATGGGCTACGACGACGTCATCACCCACCTGGGTGAATTTGGACCCTACCA GAAACGCATCTACTATCTCCTCTGTCTGCCGGCCATTGTCTGCGCTTTCC ACAAGCTGGCGGGGGTATTCCTTCTGGCGAAGCCAGACTTCCGATGTGCC CTGCCCTACGAGAACGGCAGCAGCTATGATTTGCCGCCCCACCTGTGGAA CCTCTCGTATCCGCAGGACGAGGTGTGCGCCTACTACGATGTGGAGTACT CGGAGGAGTACCTAAATGGCAGCCTGCCCCGGAGCAGCAACGCAACCAAG AGCTGTTCCCGCTACGTTTACGACCAGAGCAAGTACCTCAACAGTGCCGT CACCGAGTGGGACATGGTGTGCAGCCGGAGTCTGCTGAGTGCCACCAGCG ACTCACTCTTCATGCTGGGTGTGCTCCTGGGCAGCTTCATCTTTGGCCAG ATGTCCGACAAGCTGGGACGCAAGCCCACCTTCTTCGCCTCGCTGGTGAT CCAGCTGATCTTTGGCGTGCTGGCTGCCGTGGCTCCGGAGTACTTCAGCT ACACCATTTCCCGCATGATCGTGGGCGCCACCACGTCCGGAGTCTTCCTG GTGGCCTATGTGATTGCCCTGGAGATGGTGGGCTCCTCGTACCGCCTCTT CGCCGGCGTGGCCATGCAAATGTTCTTCTCCGTGGGCTTTATGCTAACCG CCGGCTTCGCCTACTTCATCCACGACTGGCGCTGGCTGCAGATTGCCCTG ACGCTGCCGGGACTGCTCTTCGTTTGCTACTACTGGATCATTCCGGAGTC GGCCCGCTGGCTTTTGCTCAAGGGTCGCAAGGACGAGGCCTTCGTGATCA TCGAGAAGGCGGCCAAGGAGAACCGGGTTGAGATTCCCAGCGAGATCTAC GAGCAGCTGGTGGACGAGGTGGCCGAGAAGAAGAAACAGGACGAACTGAC GGCCTCCCAGCCGGCGGCCACCGTATTTGATCTGCTCCGGTTTCCCAATC TTCGCCGGAAAACCCTGTTGATCTTCTTCGATTGGTTTGTGAACAGCGGC GTGTACTACGGTCTGTCGTGGAACACTAACAACCTGGGCGGCAATCAACT GGTTAACTTTATGATCTCCGGTGCCGTTGAGATCCCCGGCTATGTGCTGC TCCTCTTCACCCTCAACCGCTGGGGTCGTCGCTCCATCCTGTGCGGCACC ATGATGGTGGCCGGGGTCAGCCTGCTGGCCACCATCTTCGTGCCCGCGGA CTTGAACTGGCTGATCATCGCCTGTGCCATGATAGGAAAGCTGGCCATCA CCGCCTCCTATGGCACCATATACATCTTCTCGGCGGAACAGTTCCCGACG GTGGTTAGGAACGTGGGTCTGGGCGCCTCCTCTATGGTGGCACGAGTGGG CGGCATTCTGGCGCCATACCTCAAGTTGCTGGGCGAGATCTGGCGCCCAT TGCCACTGATCATCTGCGGCGCCCTGTCGCTCACCGCCGGACTGCTGTCC CTGCTGCTGCCGGAAACGCTCAACAAACCCATGCCGGAGACCATCGAGGA TGGGGAGAACTTCGGCAAGAAGACGGCGCCACAAGAGTCCGCCGAGGAGG GCGGCTCCCAAGAGCTGGCCGGGATGCTCAACGAAAAGTCCGGC------ ------------ >C1 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA LPYENGSIYELSPHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNETK TCSSYVYDRSKYLNSAVTEWNLVCSRSLLSATSDSLFMLGVLLGSLIFGQ MSDKLGRKPTFFASLVLQLIFGVLAAVAPEYFSYTISRMIVGATTSGVFL VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQIAI TLPGLLFLCYYWIIPESARWLLMKGRKDEAFVIIEKAAKENKVEVPNEIY EQLVDEVAEKKKQDEMAASQPAATVFDLLRYPNLRRKTLLIFFDWFVNSG VYYGLSWNTNNLGGNQLVNFMISGAVEIPGYTLLLFTLNRWGRRSILCGT MMVAGISLLATIFVPSDMNWLIVACAMIGKLAITSSYGTIYIFSAEQFPT VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS LLLPETLNKPMPETIEDGENFGKKPAPQETAEEGGTQELSGMLNGKSG >C2 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA LPFENGSTYELSPHLWNLSYPQNERCSYYDVDYTAEYLNGSIPRSSNDTK SCTSYVYDRSKYLNSAVTEWDMVCSRSLLSATSDSLFMLGVLLGSFIFGQ MSDKLGRKPTFFASLVLQLIFGVFAAVAPEYFSYTISRMIVGATTSGVFL VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQVAL TLPGLLFLCYYWIIPESARWLLMKGRKDEAFVIIEKAAKENKVEVPNEVY EQLVDEVAEKKKQDEMAASQPAATVFDLLRYPNLRRKTLLIFFDWFVNSG VYYGLSWNTNNLGGNQLVNFVISGAVEIPGYTLLLFTLNRWGRRSILCGT MLVAGISLLATIFVPSDMNWLIIACAMIGKLAITSSYGTIYIFSAEQFPT VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS LLLPETLNKPMPETIEDGENFGKKPAPQEAAEDGGTQELNGMLNGRSG >C3 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA LPYENGSSYQLSPYLWNLSYPQGEVCAYYDVEFSEEYLNGSLPRSTNKTK SCTSYVYDQSKYLNSAVTEWDMVCSRSLLSATSDSLFMVGVLLGSFIFGQ MSDKLGRKPTFFASLVLQVIFGVLAAVAPEYVSYTISRIIVGATTSGVFL VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQISL TLPGLLFICYYWIIPESARWLLLKGRKDEAFVIIEKAAKENRVEIPNEIY EQLVDEVAEKKKQDELTASQPAATVFDLLRFPNLRRKTLLIFFDWFVNSG VYYGLSWNTNNLGGNQLVNFVISGGVEIPGYVLLLFTLNRWGRRSILCGT MVVAGVSLLATIFVPGDMNWLIIACAMIGKMAITASYGTIYIFSAEQFPT VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS LLLPETLNKPMPETIEDGENFGKKKAPQDSAooooooELAGMLNGKSS >C4 MGYDDVITHLGEFGPYQKRIYYLLCLPAIVCAFHKLAGVFLLAKPDFRCA LPYENGSSYDLPPHLWNLSYPQDEVCAYYDVEYSEEYLNGSLPRSSNATK SCSRYVYDQSKYLNSAVTEWDMVCSRSLLSATSDSLFMLGVLLGSFIFGQ MSDKLGRKPTFFASLVIQLIFGVLAAVAPEYFSYTISRMIVGATTSGVFL VAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQIAL TLPGLLFVCYYWIIPESARWLLLKGRKDEAFVIIEKAAKENRVEIPSEIY EQLVDEVAEKKKQDELTASQPAATVFDLLRFPNLRRKTLLIFFDWFVNSG VYYGLSWNTNNLGGNQLVNFMISGAVEIPGYVLLLFTLNRWGRRSILCGT MMVAGVSLLATIFVPADLNWLIIACAMIGKLAITASYGTIYIFSAEQFPT VVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLS LLLPETLNKPMPETIEDGENFGKKTAPQESAEEGGSQELAGMLNEKSG MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/336/Orct-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 4 taxa and 1662 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1480083010 Setting output file names to "/opt/ADOPS/336/Orct-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1127985729 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 6467351508 Seed = 1704602164 Swapseed = 1480083010 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.35 % Dirichlet(Revmat{all}) 1.35 % Slider(Revmat{all}) 1.35 % Dirichlet(Pi{all}) 1.35 % Slider(Pi{all}) 2.70 % Multiplier(Alpha{1,2}) 2.70 % Multiplier(Alpha{3}) 2.70 % Slider(Pinvar{all}) 13.51 % NNI(Tau{all},V{all}) 13.51 % ParsSPR(Tau{all},V{all}) 40.54 % Multiplier(V{all}) 13.51 % Nodeslider(V{all}) 5.41 % TLMultiplier(V{all}) Division 1 has 43 unique site patterns Division 2 has 28 unique site patterns Division 3 has 92 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -4429.000899 -- -26.620141 Chain 2 -- -4429.000899 -- -26.620141 Chain 3 -- -4429.000899 -- -26.620141 Chain 4 -- -4429.000899 -- -26.620141 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -4429.000899 -- -26.620141 Chain 2 -- -4228.196487 -- -26.620141 Chain 3 -- -4435.176671 -- -26.620141 Chain 4 -- -4435.176671 -- -26.620141 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-4429.001] (-4429.001) (-4429.001) (-4429.001) * [-4429.001] (-4228.196) (-4435.177) (-4435.177) 500 -- (-4050.909) [-4023.348] (-4044.188) (-4031.612) * (-4051.022) (-4040.510) (-4049.104) [-4054.039] -- 0:00:00 1000 -- (-4027.437) [-3977.026] (-4004.522) (-4014.636) * (-4037.723) [-4015.999] (-4038.448) (-4027.515) -- 0:00:00 1500 -- (-3997.044) [-3947.289] (-3966.551) (-4001.602) * (-4002.175) (-3984.580) (-3984.051) [-3982.821] -- 0:11:05 2000 -- (-3963.847) [-3935.883] (-3942.892) (-3951.239) * (-3947.787) (-3957.047) (-3969.374) [-3944.569] -- 0:08:19 2500 -- (-3946.862) (-3937.868) (-3935.997) [-3940.291] * (-3949.676) (-3943.132) (-3967.475) [-3936.364] -- 0:06:39 3000 -- (-3938.444) [-3935.097] (-3936.888) (-3942.113) * (-3944.704) (-3937.774) (-3958.249) [-3941.666] -- 0:05:32 3500 -- (-3938.790) (-3934.530) (-3939.121) [-3940.135] * (-3947.604) (-3938.363) [-3945.342] (-3949.754) -- 0:04:44 4000 -- (-3938.300) (-3938.105) (-3944.591) [-3940.042] * (-3936.907) [-3934.906] (-3939.278) (-3942.983) -- 0:04:09 4500 -- (-3936.881) [-3934.452] (-3938.930) (-3944.428) * [-3944.316] (-3941.264) (-3932.775) (-3943.407) -- 0:03:41 5000 -- [-3933.338] (-3934.293) (-3940.903) (-3936.958) * [-3942.124] (-3939.901) (-3938.945) (-3951.863) -- 0:03:19 Average standard deviation of split frequencies: 0.000000 5500 -- (-3940.798) [-3936.590] (-3935.061) (-3949.526) * (-3939.356) (-3936.663) [-3937.115] (-3943.029) -- 0:03:00 6000 -- (-3938.099) (-3934.649) (-3937.895) [-3944.709] * (-3938.907) [-3940.647] (-3936.394) (-3938.758) -- 0:05:31 6500 -- (-3936.941) [-3938.124] (-3934.556) (-3943.035) * (-3937.567) (-3937.465) [-3936.500] (-3938.084) -- 0:05:05 7000 -- (-3935.702) (-3943.540) (-3945.856) [-3939.880] * (-3937.261) (-3944.519) [-3935.668] (-3933.580) -- 0:04:43 7500 -- (-3934.074) (-3949.747) [-3937.704] (-3938.623) * (-3944.448) [-3938.098] (-3939.670) (-3939.168) -- 0:04:24 8000 -- [-3940.061] (-3941.339) (-3936.763) (-3944.854) * (-3943.047) (-3939.765) [-3932.691] (-3934.695) -- 0:04:08 8500 -- (-3940.037) (-3932.936) [-3936.794] (-3939.398) * (-3937.611) [-3937.224] (-3936.945) (-3935.542) -- 0:03:53 9000 -- (-3942.400) (-3938.842) [-3939.200] (-3947.951) * (-3938.889) [-3933.433] (-3938.126) (-3940.516) -- 0:03:40 9500 -- [-3935.729] (-3934.556) (-3932.754) (-3942.572) * (-3953.630) (-3940.064) [-3943.523] (-3933.663) -- 0:03:28 10000 -- (-3946.785) (-3940.514) [-3935.926] (-3944.442) * (-3937.014) [-3942.048] (-3939.100) (-3936.287) -- 0:03:18 Average standard deviation of split frequencies: 0.000000 10500 -- [-3938.990] (-3945.450) (-3936.505) (-3937.387) * (-3935.466) (-3938.597) [-3937.240] (-3938.289) -- 0:04:42 11000 -- (-3940.260) [-3937.115] (-3933.341) (-3939.438) * (-3941.616) (-3941.478) [-3936.027] (-3937.814) -- 0:04:29 11500 -- (-3940.441) (-3934.524) [-3937.903] (-3937.269) * [-3938.524] (-3934.040) (-3933.062) (-3937.148) -- 0:04:17 12000 -- (-3936.851) (-3933.672) (-3940.855) [-3940.075] * [-3939.075] (-3940.178) (-3937.984) (-3945.099) -- 0:04:07 12500 -- (-3939.687) (-3934.988) [-3941.199] (-3940.068) * (-3939.268) (-3949.321) [-3941.703] (-3935.936) -- 0:03:57 13000 -- (-3936.757) [-3939.046] (-3940.497) (-3934.841) * (-3942.147) (-3938.707) (-3932.880) [-3936.315] -- 0:03:47 13500 -- [-3936.161] (-3941.313) (-3936.761) (-3942.812) * [-3943.424] (-3935.983) (-3936.078) (-3940.493) -- 0:03:39 14000 -- (-3938.197) [-3940.239] (-3945.070) (-3939.935) * (-3945.303) [-3934.288] (-3937.142) (-3935.939) -- 0:03:31 14500 -- (-3938.582) [-3933.733] (-3936.575) (-3935.309) * (-3937.808) [-3932.719] (-3938.310) (-3933.425) -- 0:03:23 15000 -- [-3937.610] (-3938.848) (-3935.230) (-3934.311) * (-3943.763) (-3939.661) [-3940.426] (-3943.501) -- 0:04:22 Average standard deviation of split frequencies: 0.000000 15500 -- (-3936.272) (-3933.311) [-3937.776] (-3935.897) * (-3944.424) (-3937.950) [-3936.917] (-3937.173) -- 0:04:14 16000 -- (-3935.142) (-3934.707) (-3946.249) [-3934.909] * (-3941.883) (-3940.314) [-3934.275] (-3950.144) -- 0:04:06 16500 -- (-3937.990) (-3935.351) (-3942.510) [-3935.945] * (-3939.638) (-3935.956) [-3936.438] (-3942.223) -- 0:03:58 17000 -- [-3944.326] (-3936.526) (-3940.354) (-3944.038) * (-3937.794) [-3936.159] (-3936.106) (-3939.685) -- 0:03:51 17500 -- [-3936.778] (-3934.983) (-3937.783) (-3939.007) * (-3938.118) [-3938.546] (-3939.983) (-3936.677) -- 0:03:44 18000 -- (-3939.887) (-3944.863) (-3949.685) [-3943.036] * (-3939.823) (-3936.718) (-3934.155) [-3940.105] -- 0:03:38 18500 -- (-3939.296) [-3939.045] (-3939.959) (-3937.402) * (-3939.893) [-3938.169] (-3940.658) (-3943.244) -- 0:03:32 19000 -- (-3942.578) (-3937.317) (-3934.896) [-3938.433] * (-3938.168) (-3939.252) [-3940.469] (-3939.718) -- 0:04:18 19500 -- (-3938.670) (-3945.667) (-3937.804) [-3938.653] * [-3939.689] (-3945.373) (-3941.779) (-3936.082) -- 0:04:11 20000 -- [-3937.315] (-3937.039) (-3937.089) (-3935.816) * (-3938.211) (-3936.203) (-3938.978) [-3936.932] -- 0:04:05 Average standard deviation of split frequencies: 0.000000 20500 -- (-3941.878) (-3939.662) (-3941.025) [-3940.477] * (-3941.910) [-3938.051] (-3937.868) (-3939.860) -- 0:03:58 21000 -- (-3936.965) [-3936.606] (-3943.548) (-3939.944) * (-3935.532) (-3937.609) [-3938.794] (-3941.562) -- 0:03:53 21500 -- (-3938.665) (-3938.255) (-3936.830) [-3939.527] * (-3932.331) [-3935.406] (-3938.317) (-3939.976) -- 0:03:47 22000 -- (-3944.888) (-3939.365) [-3937.492] (-3937.770) * (-3938.095) [-3934.252] (-3938.981) (-3936.731) -- 0:03:42 22500 -- [-3943.425] (-3936.592) (-3940.820) (-3943.394) * (-3942.384) (-3941.881) (-3941.977) [-3938.169] -- 0:03:37 23000 -- (-3938.132) (-3936.700) [-3939.036] (-3938.438) * (-3937.208) [-3949.746] (-3936.215) (-3933.633) -- 0:03:32 23500 -- (-3940.786) (-3939.896) (-3941.221) [-3934.450] * (-3941.654) (-3935.564) [-3940.109] (-3939.092) -- 0:04:09 24000 -- (-3946.041) (-3944.928) (-3937.615) [-3935.431] * (-3939.616) [-3937.313] (-3935.962) (-3938.645) -- 0:04:04 24500 -- [-3935.339] (-3945.662) (-3943.305) (-3936.848) * (-3945.348) (-3947.166) (-3944.363) [-3939.526] -- 0:03:58 25000 -- (-3936.185) (-3937.882) [-3939.161] (-3938.648) * (-3940.216) (-3934.647) [-3936.556] (-3933.305) -- 0:03:54 Average standard deviation of split frequencies: 0.000000 25500 -- [-3935.642] (-3941.706) (-3938.990) (-3937.684) * (-3942.330) [-3937.144] (-3943.451) (-3939.463) -- 0:03:49 26000 -- (-3938.126) [-3947.253] (-3936.921) (-3943.626) * (-3939.019) (-3944.654) (-3938.535) [-3940.483] -- 0:03:44 26500 -- (-3947.971) (-3943.078) (-3939.208) [-3933.992] * [-3934.591] (-3939.229) (-3938.815) (-3934.975) -- 0:03:40 27000 -- (-3935.347) (-3939.162) [-3941.428] (-3935.933) * (-3946.898) [-3936.207] (-3938.784) (-3937.128) -- 0:03:36 27500 -- [-3938.508] (-3933.841) (-3938.768) (-3944.466) * [-3939.183] (-3937.199) (-3940.630) (-3937.584) -- 0:03:32 28000 -- (-3941.903) (-3941.783) [-3938.421] (-3938.718) * (-3943.598) (-3933.156) (-3937.743) [-3942.172] -- 0:04:03 28500 -- (-3945.075) [-3934.928] (-3938.286) (-3944.341) * (-3950.021) [-3933.577] (-3941.675) (-3938.066) -- 0:03:58 29000 -- (-3942.057) (-3938.648) [-3937.336] (-3944.107) * (-3938.990) (-3944.653) (-3938.951) [-3938.553] -- 0:03:54 29500 -- (-3942.124) (-3941.174) [-3935.904] (-3941.923) * (-3946.706) (-3939.736) [-3938.883] (-3937.220) -- 0:03:50 30000 -- [-3941.665] (-3937.257) (-3936.027) (-3939.311) * (-3936.564) (-3945.268) (-3934.785) [-3935.127] -- 0:03:46 Average standard deviation of split frequencies: 0.000000 30500 -- [-3939.812] (-3941.273) (-3937.828) (-3939.326) * (-3940.044) (-3943.722) (-3948.602) [-3937.878] -- 0:03:42 31000 -- [-3936.065] (-3942.930) (-3934.765) (-3950.766) * (-3937.172) (-3953.241) (-3941.591) [-3934.796] -- 0:03:38 31500 -- (-3941.074) (-3945.332) [-3940.096] (-3944.758) * (-3940.263) (-3936.822) (-3943.971) [-3936.866] -- 0:03:35 32000 -- (-3937.330) (-3950.653) (-3941.454) [-3939.123] * (-3936.177) (-3937.112) (-3939.324) [-3940.413] -- 0:03:31 32500 -- [-3943.194] (-3945.555) (-3942.569) (-3937.048) * (-3935.604) [-3937.566] (-3941.098) (-3946.742) -- 0:03:58 33000 -- (-3938.219) (-3948.258) [-3941.323] (-3936.956) * (-3938.715) [-3936.293] (-3936.900) (-3942.082) -- 0:03:54 33500 -- (-3940.178) (-3944.506) [-3934.543] (-3936.508) * [-3936.820] (-3934.912) (-3941.589) (-3936.026) -- 0:03:50 34000 -- [-3937.967] (-3935.793) (-3940.753) (-3941.101) * (-3936.543) (-3938.386) [-3937.400] (-3938.007) -- 0:03:47 34500 -- (-3945.271) (-3939.450) [-3936.909] (-3941.032) * (-3932.802) (-3937.412) (-3943.239) [-3935.459] -- 0:03:43 35000 -- (-3942.958) (-3944.067) [-3932.729] (-3938.707) * (-3932.180) [-3933.948] (-3954.807) (-3940.098) -- 0:03:40 Average standard deviation of split frequencies: 0.000000 35500 -- [-3938.545] (-3945.344) (-3939.909) (-3946.738) * (-3936.387) [-3937.845] (-3941.364) (-3930.984) -- 0:03:37 36000 -- (-3939.646) (-3938.021) (-3942.707) [-3941.684] * (-3940.866) (-3932.772) (-3943.476) [-3945.185] -- 0:03:34 36500 -- (-3940.399) (-3936.037) (-3937.276) [-3936.439] * (-3941.226) (-3941.031) [-3935.022] (-3937.931) -- 0:03:57 37000 -- (-3939.297) (-3941.990) (-3941.717) [-3937.100] * (-3941.747) [-3933.558] (-3939.329) (-3941.804) -- 0:03:54 37500 -- (-3936.013) (-3938.881) [-3938.870] (-3940.385) * [-3938.659] (-3937.070) (-3936.665) (-3938.811) -- 0:03:51 38000 -- [-3940.968] (-3943.435) (-3936.290) (-3940.485) * [-3935.582] (-3935.899) (-3939.153) (-3947.091) -- 0:03:47 38500 -- (-3936.972) [-3942.754] (-3940.423) (-3935.811) * (-3935.177) (-3938.787) [-3935.707] (-3938.189) -- 0:03:44 39000 -- (-3935.876) (-3939.592) [-3934.747] (-3938.982) * (-3939.278) [-3938.085] (-3937.204) (-3939.205) -- 0:03:41 39500 -- [-3935.117] (-3948.051) (-3937.873) (-3932.614) * (-3941.708) [-3937.569] (-3947.214) (-3936.946) -- 0:03:38 40000 -- (-3944.055) (-3945.808) [-3933.213] (-3939.632) * [-3935.949] (-3935.071) (-3936.152) (-3941.130) -- 0:03:36 Average standard deviation of split frequencies: 0.000000 40500 -- (-3939.395) (-3940.473) [-3934.324] (-3941.171) * [-3941.141] (-3933.996) (-3946.161) (-3945.944) -- 0:03:33 41000 -- (-3941.382) (-3944.945) (-3938.446) [-3938.679] * [-3934.834] (-3943.066) (-3943.018) (-3940.107) -- 0:03:53 41500 -- (-3939.021) [-3938.437] (-3938.122) (-3935.382) * (-3939.690) (-3936.542) [-3939.038] (-3936.236) -- 0:03:50 42000 -- (-3935.604) (-3939.523) (-3945.546) [-3937.328] * (-3937.250) (-3940.431) [-3937.087] (-3937.343) -- 0:03:48 42500 -- [-3934.458] (-3934.109) (-3942.845) (-3939.874) * [-3939.895] (-3944.041) (-3938.825) (-3934.032) -- 0:03:45 43000 -- [-3935.021] (-3943.690) (-3940.121) (-3936.634) * (-3935.890) [-3935.381] (-3940.100) (-3945.597) -- 0:03:42 43500 -- (-3939.419) (-3938.526) (-3942.893) [-3932.952] * (-3936.721) [-3944.745] (-3933.162) (-3941.000) -- 0:03:39 44000 -- (-3938.749) (-3936.284) (-3941.593) [-3936.672] * (-3938.165) [-3935.306] (-3946.779) (-3946.247) -- 0:03:37 44500 -- [-3938.503] (-3941.524) (-3940.214) (-3937.607) * (-3944.389) (-3941.845) (-3939.164) [-3936.301] -- 0:03:34 45000 -- (-3938.475) [-3934.487] (-3935.355) (-3942.412) * (-3934.574) (-3945.386) [-3935.110] (-3938.004) -- 0:03:32 Average standard deviation of split frequencies: 0.000000 45500 -- [-3939.224] (-3939.575) (-3937.370) (-3941.356) * (-3937.729) (-3937.113) (-3940.201) [-3935.194] -- 0:03:50 46000 -- (-3943.206) (-3946.233) [-3937.923] (-3935.344) * (-3936.749) (-3942.650) [-3939.572] (-3938.413) -- 0:03:48 46500 -- (-3936.309) [-3936.024] (-3938.805) (-3937.297) * [-3938.457] (-3939.365) (-3944.877) (-3933.347) -- 0:03:45 47000 -- (-3938.754) (-3941.948) (-3944.904) [-3935.071] * (-3943.081) (-3940.648) (-3943.837) [-3932.627] -- 0:03:43 47500 -- (-3936.337) [-3936.320] (-3935.229) (-3938.248) * (-3942.913) (-3937.385) (-3932.760) [-3933.560] -- 0:03:40 48000 -- (-3934.880) (-3940.842) [-3931.148] (-3936.699) * (-3938.326) (-3938.543) (-3933.446) [-3938.243] -- 0:03:38 48500 -- (-3939.887) (-3937.572) [-3931.977] (-3939.176) * (-3934.551) [-3936.478] (-3934.341) (-3942.183) -- 0:03:35 49000 -- (-3937.292) (-3936.982) (-3942.169) [-3938.409] * (-3934.713) (-3939.921) [-3944.798] (-3935.581) -- 0:03:33 49500 -- (-3946.303) [-3938.009] (-3940.970) (-3935.371) * (-3937.958) (-3936.574) [-3939.497] (-3934.606) -- 0:03:31 50000 -- (-3940.571) (-3936.554) [-3944.588] (-3936.190) * (-3935.602) (-3939.058) [-3933.954] (-3936.724) -- 0:03:48 Average standard deviation of split frequencies: 0.000000 50500 -- (-3943.009) (-3936.229) (-3935.614) [-3934.875] * (-3934.550) (-3937.863) [-3932.889] (-3942.574) -- 0:03:45 51000 -- (-3934.809) [-3941.727] (-3934.951) (-3935.194) * [-3938.637] (-3935.164) (-3932.654) (-3934.541) -- 0:03:43 51500 -- (-3933.971) (-3940.972) (-3937.676) [-3936.171] * (-3943.115) [-3938.509] (-3933.522) (-3932.862) -- 0:03:41 52000 -- (-3935.928) (-3940.398) [-3940.526] (-3935.603) * (-3939.881) (-3944.164) (-3942.884) [-3939.914] -- 0:03:38 52500 -- (-3934.879) (-3938.204) (-3945.626) [-3935.344] * (-3935.899) (-3939.535) [-3935.508] (-3938.448) -- 0:03:36 53000 -- (-3936.311) (-3946.492) (-3934.973) [-3942.801] * (-3940.783) (-3935.476) [-3936.697] (-3933.817) -- 0:03:34 53500 -- (-3937.052) (-3947.446) (-3934.206) [-3940.542] * (-3941.040) [-3933.791] (-3940.577) (-3936.711) -- 0:03:32 54000 -- [-3938.505] (-3937.854) (-3938.773) (-3937.221) * (-3940.531) (-3938.648) (-3939.944) [-3936.615] -- 0:03:30 54500 -- (-3938.676) (-3935.494) [-3934.886] (-3938.360) * (-3938.453) [-3935.128] (-3937.543) (-3937.220) -- 0:03:45 55000 -- (-3936.629) (-3936.210) (-3933.682) [-3934.150] * (-3938.799) (-3938.427) [-3935.884] (-3935.628) -- 0:03:43 Average standard deviation of split frequencies: 0.000000 55500 -- (-3937.950) (-3935.454) [-3934.710] (-3936.407) * (-3946.470) [-3937.624] (-3944.578) (-3935.254) -- 0:03:41 56000 -- (-3931.350) [-3935.815] (-3941.285) (-3936.774) * (-3939.137) [-3936.750] (-3937.417) (-3937.364) -- 0:03:39 56500 -- (-3939.011) (-3941.085) [-3938.440] (-3937.555) * (-3936.966) (-3940.087) [-3935.358] (-3942.359) -- 0:03:37 57000 -- (-3936.423) [-3940.219] (-3938.745) (-3938.426) * [-3935.269] (-3941.315) (-3937.024) (-3937.118) -- 0:03:35 57500 -- (-3939.450) (-3940.497) (-3935.641) [-3936.117] * (-3947.818) (-3935.072) [-3941.580] (-3937.062) -- 0:03:33 58000 -- (-3940.626) [-3939.254] (-3937.936) (-3948.607) * (-3939.256) (-3938.051) (-3937.076) [-3936.567] -- 0:03:31 58500 -- [-3932.103] (-3940.938) (-3940.750) (-3941.775) * (-3936.251) (-3934.204) [-3937.021] (-3935.971) -- 0:03:29 59000 -- [-3937.355] (-3937.201) (-3936.916) (-3943.824) * (-3933.000) (-3937.766) [-3932.829] (-3940.656) -- 0:03:43 59500 -- (-3939.717) (-3932.770) (-3946.714) [-3937.887] * [-3935.407] (-3943.197) (-3942.569) (-3940.477) -- 0:03:41 60000 -- (-3942.436) (-3935.028) [-3941.871] (-3936.230) * (-3936.862) (-3942.847) [-3940.918] (-3943.079) -- 0:03:39 Average standard deviation of split frequencies: 0.000000 60500 -- (-3941.965) (-3943.746) (-3950.954) [-3935.424] * (-3938.990) (-3942.783) [-3938.408] (-3936.651) -- 0:03:37 61000 -- (-3935.335) [-3941.495] (-3935.170) (-3940.545) * (-3938.897) [-3938.274] (-3936.686) (-3937.673) -- 0:03:35 61500 -- [-3933.771] (-3942.294) (-3935.584) (-3942.727) * [-3941.160] (-3936.576) (-3943.863) (-3939.243) -- 0:03:33 62000 -- (-3948.264) (-3935.985) [-3943.711] (-3937.997) * (-3943.111) (-3937.070) (-3937.557) [-3940.252] -- 0:03:31 62500 -- (-3937.018) (-3941.654) [-3935.010] (-3939.624) * (-3941.224) (-3936.533) [-3939.073] (-3939.029) -- 0:03:30 63000 -- (-3934.280) [-3936.499] (-3942.592) (-3945.827) * (-3945.918) [-3937.106] (-3945.388) (-3936.119) -- 0:03:43 63500 -- (-3935.935) [-3934.270] (-3936.328) (-3942.606) * (-3942.793) [-3935.070] (-3940.357) (-3938.159) -- 0:03:41 64000 -- (-3941.433) (-3933.249) [-3944.737] (-3938.146) * (-3942.328) (-3939.888) [-3933.776] (-3937.757) -- 0:03:39 64500 -- [-3932.465] (-3938.498) (-3932.797) (-3934.694) * (-3941.202) (-3943.401) [-3934.983] (-3947.314) -- 0:03:37 65000 -- (-3939.188) (-3940.431) [-3938.345] (-3940.702) * (-3943.363) (-3936.251) [-3937.032] (-3939.926) -- 0:03:35 Average standard deviation of split frequencies: 0.000000 65500 -- (-3941.910) (-3934.898) [-3934.372] (-3943.814) * (-3936.010) (-3937.802) [-3934.957] (-3944.880) -- 0:03:34 66000 -- (-3940.749) (-3934.614) (-3938.702) [-3938.110] * (-3939.320) [-3935.169] (-3939.334) (-3940.248) -- 0:03:32 66500 -- [-3941.556] (-3943.466) (-3940.643) (-3935.136) * [-3939.763] (-3937.437) (-3935.838) (-3942.546) -- 0:03:30 67000 -- (-3939.028) [-3938.069] (-3943.650) (-3937.922) * [-3937.408] (-3940.937) (-3941.286) (-3937.754) -- 0:03:28 67500 -- (-3940.080) (-3935.397) (-3946.367) [-3935.173] * (-3940.425) [-3934.958] (-3939.566) (-3935.914) -- 0:03:41 68000 -- (-3944.210) (-3935.226) (-3940.512) [-3941.956] * (-3933.720) (-3935.801) [-3933.599] (-3931.980) -- 0:03:39 68500 -- (-3941.490) (-3939.924) [-3936.665] (-3942.117) * (-3935.952) (-3949.253) [-3938.225] (-3943.327) -- 0:03:37 69000 -- (-3939.673) (-3946.195) (-3941.854) [-3937.406] * [-3934.573] (-3941.034) (-3935.987) (-3941.888) -- 0:03:35 69500 -- (-3936.927) [-3944.398] (-3939.631) (-3939.932) * [-3934.802] (-3933.261) (-3938.556) (-3946.104) -- 0:03:34 70000 -- (-3937.531) (-3945.691) [-3935.654] (-3942.656) * (-3937.886) [-3941.301] (-3939.979) (-3936.528) -- 0:03:32 Average standard deviation of split frequencies: 0.000000 70500 -- (-3939.970) [-3936.813] (-3938.400) (-3942.265) * (-3937.153) [-3937.099] (-3937.037) (-3935.582) -- 0:03:30 71000 -- (-3937.275) (-3938.583) [-3941.688] (-3936.246) * (-3936.914) [-3933.889] (-3935.263) (-3936.910) -- 0:03:29 71500 -- (-3935.875) (-3940.534) [-3935.991] (-3937.861) * [-3939.674] (-3937.793) (-3937.971) (-3948.411) -- 0:03:27 72000 -- (-3932.747) [-3932.861] (-3936.467) (-3941.898) * (-3941.293) (-3936.681) (-3940.042) [-3936.081] -- 0:03:39 72500 -- [-3940.479] (-3941.126) (-3944.754) (-3942.883) * [-3939.423] (-3935.824) (-3936.718) (-3940.557) -- 0:03:37 73000 -- (-3952.519) (-3935.604) (-3945.019) [-3935.842] * (-3939.530) (-3938.240) [-3935.916] (-3939.626) -- 0:03:35 73500 -- (-3935.664) [-3941.297] (-3936.390) (-3939.759) * (-3937.698) (-3941.745) (-3943.554) [-3940.680] -- 0:03:34 74000 -- [-3937.161] (-3935.540) (-3940.170) (-3939.784) * (-3947.145) (-3941.304) (-3943.157) [-3935.955] -- 0:03:32 74500 -- (-3932.719) [-3937.370] (-3939.557) (-3940.774) * (-3940.113) [-3937.611] (-3943.870) (-3936.773) -- 0:03:31 75000 -- (-3934.437) (-3934.865) (-3948.419) [-3936.422] * (-3937.861) (-3935.950) (-3939.075) [-3934.064] -- 0:03:29 Average standard deviation of split frequencies: 0.000000 75500 -- (-3936.759) (-3937.563) [-3944.402] (-3936.931) * [-3937.549] (-3939.841) (-3939.854) (-3939.991) -- 0:03:28 76000 -- (-3942.864) (-3942.330) (-3948.638) [-3936.099] * (-3936.017) [-3933.088] (-3945.688) (-3939.336) -- 0:03:26 76500 -- [-3939.418] (-3937.299) (-3946.871) (-3944.134) * (-3938.542) (-3936.757) (-3939.767) [-3942.699] -- 0:03:37 77000 -- (-3940.138) (-3938.764) [-3940.254] (-3940.538) * [-3936.594] (-3934.362) (-3941.072) (-3939.101) -- 0:03:35 77500 -- (-3937.254) (-3941.444) (-3939.147) [-3942.360] * (-3941.662) (-3942.943) (-3941.611) [-3937.176] -- 0:03:34 78000 -- [-3942.026] (-3944.626) (-3934.768) (-3944.944) * (-3939.265) (-3937.373) [-3934.234] (-3939.975) -- 0:03:32 78500 -- [-3936.827] (-3935.601) (-3942.656) (-3937.082) * (-3941.008) [-3937.999] (-3943.166) (-3940.525) -- 0:03:31 79000 -- (-3944.550) (-3936.952) (-3943.662) [-3936.454] * [-3938.384] (-3941.498) (-3943.357) (-3941.014) -- 0:03:29 79500 -- [-3939.569] (-3937.106) (-3943.739) (-3935.045) * (-3941.726) (-3945.169) (-3938.980) [-3937.956] -- 0:03:28 80000 -- (-3935.782) (-3945.311) (-3941.877) [-3932.308] * [-3942.046] (-3940.409) (-3942.111) (-3944.023) -- 0:03:27 Average standard deviation of split frequencies: 0.000000 80500 -- (-3940.100) (-3943.288) (-3942.728) [-3935.083] * (-3939.136) [-3944.123] (-3938.479) (-3940.862) -- 0:03:25 81000 -- (-3942.743) (-3948.188) (-3943.701) [-3937.358] * [-3941.101] (-3943.630) (-3946.773) (-3937.558) -- 0:03:35 81500 -- (-3942.128) (-3936.029) (-3935.329) [-3939.124] * (-3933.690) (-3943.370) [-3947.366] (-3938.979) -- 0:03:34 82000 -- (-3936.672) [-3939.350] (-3938.482) (-3944.698) * (-3948.157) [-3936.847] (-3942.128) (-3945.249) -- 0:03:32 82500 -- (-3945.466) (-3936.730) (-3939.434) [-3938.783] * (-3939.350) [-3935.534] (-3944.063) (-3945.128) -- 0:03:31 83000 -- (-3935.048) [-3933.249] (-3938.501) (-3939.350) * (-3935.809) [-3934.958] (-3940.408) (-3940.806) -- 0:03:29 83500 -- [-3941.147] (-3937.438) (-3937.686) (-3939.187) * (-3942.688) (-3938.490) (-3936.988) [-3944.342] -- 0:03:28 84000 -- (-3941.160) [-3938.842] (-3936.442) (-3937.160) * (-3944.333) [-3934.393] (-3938.292) (-3941.577) -- 0:03:27 84500 -- (-3941.712) (-3937.961) (-3935.487) [-3936.655] * [-3935.083] (-3936.315) (-3938.862) (-3943.981) -- 0:03:25 85000 -- (-3940.521) [-3936.482] (-3934.129) (-3937.126) * [-3935.691] (-3948.470) (-3935.804) (-3941.668) -- 0:03:24 Average standard deviation of split frequencies: 0.000000 85500 -- (-3933.230) [-3934.898] (-3936.024) (-3935.537) * (-3931.890) (-3947.236) (-3939.483) [-3937.266] -- 0:03:33 86000 -- (-3938.643) [-3935.238] (-3936.846) (-3941.618) * (-3932.289) (-3937.254) (-3939.683) [-3939.516] -- 0:03:32 86500 -- (-3939.798) [-3935.129] (-3939.061) (-3937.934) * (-3938.724) (-3936.981) (-3937.604) [-3937.839] -- 0:03:31 87000 -- (-3938.973) [-3942.818] (-3935.559) (-3939.455) * (-3937.421) (-3944.546) (-3940.518) [-3937.167] -- 0:03:29 87500 -- [-3942.487] (-3937.785) (-3936.001) (-3943.988) * [-3937.989] (-3949.725) (-3933.460) (-3933.857) -- 0:03:28 88000 -- (-3939.669) (-3940.240) (-3935.600) [-3933.454] * [-3937.862] (-3942.205) (-3937.205) (-3942.361) -- 0:03:27 88500 -- [-3939.375] (-3941.416) (-3937.823) (-3938.807) * (-3933.190) (-3938.043) (-3935.529) [-3937.419] -- 0:03:25 89000 -- (-3936.861) (-3938.466) [-3940.220] (-3938.425) * (-3947.263) (-3939.730) [-3937.643] (-3939.144) -- 0:03:24 89500 -- (-3939.040) [-3940.902] (-3944.306) (-3939.927) * (-3944.121) [-3937.856] (-3941.220) (-3942.600) -- 0:03:23 90000 -- [-3932.290] (-3939.460) (-3941.270) (-3937.343) * (-3939.091) (-3940.420) (-3938.361) [-3934.008] -- 0:03:32 Average standard deviation of split frequencies: 0.000000 90500 -- (-3934.429) (-3938.708) [-3943.082] (-3939.540) * (-3941.510) [-3943.409] (-3943.756) (-3937.483) -- 0:03:31 91000 -- (-3933.481) (-3935.525) (-3941.454) [-3933.674] * (-3936.183) (-3939.114) (-3939.260) [-3934.801] -- 0:03:29 91500 -- [-3939.868] (-3944.806) (-3938.209) (-3942.723) * (-3941.139) (-3937.553) (-3935.871) [-3940.407] -- 0:03:28 92000 -- (-3938.377) (-3943.009) (-3934.988) [-3940.774] * (-3947.704) (-3934.860) (-3941.273) [-3937.035] -- 0:03:27 92500 -- [-3939.017] (-3933.972) (-3936.849) (-3940.573) * (-3945.138) [-3936.354] (-3939.486) (-3937.504) -- 0:03:26 93000 -- (-3940.306) [-3931.841] (-3934.681) (-3941.110) * (-3941.080) (-3937.628) [-3937.652] (-3938.505) -- 0:03:24 93500 -- (-3937.102) [-3938.854] (-3937.497) (-3935.303) * (-3948.759) (-3931.744) [-3938.907] (-3935.085) -- 0:03:23 94000 -- (-3941.345) (-3937.708) [-3937.958] (-3940.789) * (-3938.661) [-3938.073] (-3945.350) (-3935.768) -- 0:03:32 94500 -- [-3938.284] (-3942.236) (-3938.176) (-3935.104) * (-3936.625) [-3933.318] (-3936.359) (-3946.241) -- 0:03:30 95000 -- (-3942.835) [-3934.521] (-3940.892) (-3935.769) * (-3934.740) [-3940.687] (-3937.142) (-3935.524) -- 0:03:29 Average standard deviation of split frequencies: 0.000000 95500 -- [-3937.256] (-3936.222) (-3937.299) (-3936.525) * (-3937.022) [-3939.389] (-3942.026) (-3934.265) -- 0:03:28 96000 -- (-3936.497) (-3946.441) [-3942.901] (-3938.149) * (-3940.231) (-3940.513) (-3936.671) [-3939.896] -- 0:03:27 96500 -- [-3943.515] (-3940.239) (-3946.340) (-3935.668) * (-3940.923) (-3936.870) (-3936.139) [-3933.447] -- 0:03:25 97000 -- (-3939.675) (-3938.729) (-3940.362) [-3934.508] * [-3935.167] (-3937.070) (-3934.493) (-3941.712) -- 0:03:24 97500 -- (-3937.854) [-3940.892] (-3935.587) (-3938.004) * (-3937.180) (-3940.795) (-3935.668) [-3934.925] -- 0:03:23 98000 -- (-3937.568) (-3936.674) [-3937.960] (-3939.312) * [-3945.274] (-3938.260) (-3937.523) (-3937.984) -- 0:03:22 98500 -- (-3940.343) (-3939.132) [-3942.135] (-3941.047) * (-3938.679) (-3939.936) (-3934.593) [-3938.253] -- 0:03:30 99000 -- (-3939.378) [-3937.950] (-3937.821) (-3937.573) * (-3935.144) [-3935.345] (-3941.316) (-3939.076) -- 0:03:29 99500 -- (-3943.323) [-3936.858] (-3938.181) (-3940.859) * [-3938.307] (-3939.249) (-3936.396) (-3940.428) -- 0:03:28 100000 -- [-3938.752] (-3939.188) (-3939.932) (-3946.160) * (-3935.664) (-3943.275) [-3937.024] (-3934.741) -- 0:03:27 Average standard deviation of split frequencies: 0.000000 100500 -- [-3935.626] (-3937.332) (-3941.335) (-3952.103) * (-3933.899) [-3936.163] (-3938.655) (-3934.711) -- 0:03:25 101000 -- (-3936.431) (-3938.080) (-3941.145) [-3933.833] * (-3936.235) [-3936.029] (-3938.256) (-3935.832) -- 0:03:24 101500 -- (-3939.573) (-3947.028) (-3936.207) [-3934.514] * (-3933.883) (-3936.254) [-3944.751] (-3942.829) -- 0:03:23 102000 -- (-3935.292) [-3934.523] (-3936.589) (-3940.119) * (-3936.412) (-3934.660) (-3937.030) [-3936.333] -- 0:03:22 102500 -- (-3942.922) (-3936.347) (-3936.564) [-3943.892] * [-3935.136] (-3936.469) (-3936.366) (-3932.496) -- 0:03:21 103000 -- (-3945.583) (-3937.781) (-3937.889) [-3944.291] * (-3939.006) (-3943.454) [-3943.796] (-3933.709) -- 0:03:29 103500 -- (-3952.091) [-3940.301] (-3940.739) (-3941.444) * [-3930.498] (-3938.968) (-3937.887) (-3933.009) -- 0:03:27 104000 -- (-3948.627) [-3933.609] (-3933.002) (-3938.615) * (-3934.244) (-3937.725) (-3939.596) [-3941.399] -- 0:03:26 104500 -- (-3937.305) (-3937.886) [-3936.078] (-3943.195) * (-3938.242) (-3938.762) (-3943.128) [-3938.227] -- 0:03:25 105000 -- (-3941.993) (-3933.958) (-3936.248) [-3939.513] * (-3936.510) (-3941.323) (-3938.841) [-3939.625] -- 0:03:24 Average standard deviation of split frequencies: 0.000000 105500 -- (-3944.217) [-3937.567] (-3935.752) (-3939.571) * (-3937.641) (-3934.559) (-3940.841) [-3935.919] -- 0:03:23 106000 -- [-3940.161] (-3945.639) (-3938.322) (-3937.024) * (-3942.876) [-3936.129] (-3938.755) (-3936.193) -- 0:03:22 106500 -- (-3939.776) (-3939.513) [-3939.597] (-3939.797) * (-3936.257) [-3936.019] (-3943.570) (-3941.039) -- 0:03:21 107000 -- (-3933.444) (-3939.994) [-3936.553] (-3941.647) * (-3940.463) [-3938.822] (-3937.613) (-3939.981) -- 0:03:20 107500 -- (-3933.100) (-3942.170) [-3941.270] (-3941.625) * [-3936.120] (-3937.426) (-3937.171) (-3939.037) -- 0:03:27 108000 -- [-3938.856] (-3935.393) (-3938.411) (-3946.369) * (-3938.539) [-3934.503] (-3940.186) (-3938.371) -- 0:03:26 108500 -- (-3932.569) (-3938.400) (-3939.986) [-3938.166] * [-3935.463] (-3938.187) (-3940.626) (-3939.233) -- 0:03:25 109000 -- (-3940.020) (-3932.503) (-3939.692) [-3940.072] * (-3935.474) [-3941.044] (-3935.376) (-3935.633) -- 0:03:24 109500 -- (-3942.436) [-3934.376] (-3946.467) (-3942.349) * (-3941.519) (-3938.648) (-3938.641) [-3939.319] -- 0:03:23 110000 -- (-3945.710) [-3943.431] (-3942.318) (-3938.060) * (-3936.820) (-3935.269) [-3936.452] (-3937.717) -- 0:03:22 Average standard deviation of split frequencies: 0.000000 110500 -- (-3941.165) [-3936.279] (-3933.088) (-3938.427) * (-3943.510) (-3937.488) [-3939.303] (-3937.785) -- 0:03:21 111000 -- (-3944.292) (-3932.539) [-3945.348] (-3942.356) * (-3939.135) (-3940.856) [-3934.439] (-3938.328) -- 0:03:20 111500 -- (-3939.092) (-3942.108) [-3939.093] (-3935.137) * (-3939.645) (-3939.696) [-3936.623] (-3946.117) -- 0:03:19 112000 -- (-3934.182) (-3938.709) [-3933.548] (-3936.191) * (-3939.143) (-3939.740) [-3934.974] (-3945.216) -- 0:03:26 112500 -- (-3938.692) (-3935.200) [-3936.005] (-3934.028) * (-3933.029) [-3937.612] (-3948.276) (-3947.824) -- 0:03:25 113000 -- (-3935.494) (-3932.943) (-3940.823) [-3937.135] * (-3940.584) [-3940.183] (-3939.649) (-3943.591) -- 0:03:24 113500 -- (-3934.596) (-3940.441) [-3938.286] (-3936.449) * (-3936.391) [-3933.593] (-3938.503) (-3938.191) -- 0:03:23 114000 -- (-3933.049) [-3941.790] (-3938.444) (-3937.733) * (-3937.884) [-3936.935] (-3941.358) (-3941.495) -- 0:03:22 114500 -- (-3936.313) (-3935.924) [-3942.687] (-3941.000) * (-3938.521) [-3935.114] (-3939.028) (-3940.683) -- 0:03:21 115000 -- (-3932.964) (-3937.052) [-3934.679] (-3941.935) * (-3938.100) [-3936.223] (-3946.615) (-3935.317) -- 0:03:20 Average standard deviation of split frequencies: 0.000000 115500 -- (-3949.037) (-3936.967) [-3932.147] (-3940.621) * (-3942.499) (-3936.425) [-3949.216] (-3937.044) -- 0:03:19 116000 -- (-3944.499) [-3935.969] (-3939.484) (-3943.193) * (-3935.684) [-3938.726] (-3943.342) (-3936.897) -- 0:03:18 116500 -- (-3941.624) (-3933.828) [-3940.037] (-3944.447) * (-3934.638) [-3942.064] (-3941.799) (-3937.622) -- 0:03:24 117000 -- (-3939.228) (-3939.427) [-3938.028] (-3939.730) * (-3930.640) [-3934.375] (-3942.145) (-3935.913) -- 0:03:23 117500 -- (-3943.468) (-3941.349) (-3943.040) [-3935.820] * (-3937.862) (-3938.469) (-3941.968) [-3931.673] -- 0:03:22 118000 -- (-3948.484) (-3945.348) (-3942.459) [-3941.267] * (-3940.874) (-3935.274) (-3940.558) [-3933.367] -- 0:03:21 118500 -- (-3938.543) (-3940.561) (-3942.368) [-3937.815] * (-3938.856) (-3937.307) [-3939.968] (-3932.944) -- 0:03:20 119000 -- (-3941.139) (-3936.876) (-3943.938) [-3935.985] * (-3936.323) [-3932.980] (-3934.862) (-3940.611) -- 0:03:19 119500 -- (-3946.952) (-3937.372) (-3936.802) [-3937.521] * (-3935.719) (-3939.112) [-3936.202] (-3935.470) -- 0:03:18 120000 -- [-3941.550] (-3942.556) (-3944.485) (-3938.517) * (-3939.400) [-3935.968] (-3939.896) (-3943.040) -- 0:03:18 Average standard deviation of split frequencies: 0.000000 120500 -- (-3940.082) (-3940.564) [-3934.022] (-3940.034) * [-3936.786] (-3941.447) (-3941.103) (-3943.974) -- 0:03:17 121000 -- (-3943.316) (-3933.119) [-3933.776] (-3939.152) * (-3938.876) [-3935.115] (-3939.367) (-3945.421) -- 0:03:23 121500 -- (-3938.748) (-3937.123) (-3939.360) [-3935.200] * (-3936.717) [-3937.871] (-3940.184) (-3944.334) -- 0:03:22 122000 -- [-3937.950] (-3941.709) (-3938.247) (-3937.577) * (-3940.232) (-3940.552) (-3940.313) [-3936.660] -- 0:03:21 122500 -- (-3943.876) (-3935.921) [-3941.656] (-3936.992) * [-3937.292] (-3937.145) (-3937.235) (-3938.001) -- 0:03:20 123000 -- (-3941.651) (-3934.571) [-3939.962] (-3937.332) * (-3945.180) (-3936.603) (-3937.872) [-3943.815] -- 0:03:19 123500 -- (-3936.283) [-3932.993] (-3935.316) (-3939.461) * (-3939.446) (-3937.566) (-3939.323) [-3933.071] -- 0:03:18 124000 -- (-3944.541) [-3938.865] (-3948.866) (-3939.781) * (-3938.266) (-3937.058) (-3936.609) [-3949.378] -- 0:03:17 124500 -- [-3941.543] (-3932.445) (-3940.382) (-3944.456) * (-3944.297) (-3938.744) [-3937.555] (-3935.796) -- 0:03:16 125000 -- [-3936.881] (-3939.022) (-3943.151) (-3935.960) * (-3939.768) [-3938.324] (-3936.644) (-3942.238) -- 0:03:16 Average standard deviation of split frequencies: 0.000000 125500 -- [-3937.665] (-3938.115) (-3936.208) (-3933.140) * (-3936.408) [-3937.771] (-3943.069) (-3939.548) -- 0:03:22 126000 -- [-3937.990] (-3935.240) (-3937.181) (-3938.192) * (-3939.131) [-3944.400] (-3938.437) (-3939.615) -- 0:03:21 126500 -- [-3934.304] (-3934.859) (-3937.082) (-3937.540) * (-3942.378) (-3940.863) [-3934.593] (-3942.368) -- 0:03:20 127000 -- (-3935.501) [-3933.808] (-3935.695) (-3942.365) * (-3936.255) (-3937.344) (-3934.896) [-3935.119] -- 0:03:19 127500 -- (-3938.151) (-3935.036) [-3934.314] (-3937.654) * (-3943.010) (-3948.499) [-3938.484] (-3937.550) -- 0:03:18 128000 -- (-3936.244) (-3936.598) (-3938.631) [-3934.147] * (-3938.183) (-3943.924) [-3945.383] (-3932.328) -- 0:03:17 128500 -- (-3938.613) [-3941.082] (-3936.637) (-3935.884) * [-3940.077] (-3943.463) (-3942.079) (-3936.209) -- 0:03:16 129000 -- (-3935.923) (-3935.794) (-3933.599) [-3934.881] * (-3936.573) [-3937.005] (-3939.504) (-3935.890) -- 0:03:15 129500 -- (-3933.962) (-3943.586) (-3938.832) [-3938.298] * [-3937.772] (-3935.035) (-3945.638) (-3936.819) -- 0:03:14 130000 -- [-3936.265] (-3935.996) (-3936.025) (-3939.314) * (-3939.996) (-3940.974) (-3945.282) [-3934.986] -- 0:03:20 Average standard deviation of split frequencies: 0.000000 130500 -- (-3938.773) (-3939.079) [-3936.030] (-3941.357) * [-3942.869] (-3940.771) (-3943.219) (-3938.775) -- 0:03:19 131000 -- [-3937.665] (-3939.201) (-3940.442) (-3945.100) * (-3939.928) (-3937.583) (-3942.093) [-3934.696] -- 0:03:19 131500 -- [-3935.380] (-3942.918) (-3940.828) (-3940.330) * (-3938.957) [-3935.905] (-3940.631) (-3933.659) -- 0:03:18 132000 -- [-3937.824] (-3942.074) (-3943.429) (-3938.719) * (-3935.523) (-3939.017) (-3940.596) [-3933.151] -- 0:03:17 132500 -- (-3944.195) (-3943.416) (-3939.556) [-3944.480] * (-3936.541) (-3942.914) (-3941.080) [-3936.717] -- 0:03:16 133000 -- [-3938.679] (-3938.398) (-3937.379) (-3939.049) * (-3941.126) (-3942.351) [-3935.283] (-3937.109) -- 0:03:15 133500 -- (-3939.523) [-3936.643] (-3932.522) (-3941.595) * [-3932.256] (-3945.144) (-3934.822) (-3935.180) -- 0:03:14 134000 -- [-3936.321] (-3937.114) (-3940.281) (-3938.321) * (-3933.650) (-3945.242) (-3938.141) [-3933.337] -- 0:03:13 134500 -- (-3939.661) (-3943.692) (-3937.572) [-3935.092] * (-3936.792) (-3946.593) (-3933.482) [-3940.813] -- 0:03:19 135000 -- (-3938.833) [-3941.213] (-3937.945) (-3933.292) * [-3934.535] (-3939.806) (-3940.764) (-3937.434) -- 0:03:18 Average standard deviation of split frequencies: 0.000000 135500 -- (-3941.645) (-3936.535) [-3936.926] (-3937.839) * (-3935.463) [-3943.125] (-3938.909) (-3936.293) -- 0:03:17 136000 -- (-3940.202) (-3935.724) (-3943.304) [-3936.623] * (-3938.378) (-3937.613) (-3934.233) [-3936.565] -- 0:03:16 136500 -- (-3937.025) (-3936.648) (-3934.543) [-3937.333] * (-3940.216) (-3941.459) (-3933.895) [-3935.115] -- 0:03:16 137000 -- [-3936.616] (-3933.696) (-3933.921) (-3940.140) * [-3933.207] (-3941.759) (-3936.280) (-3939.536) -- 0:03:15 137500 -- (-3947.692) [-3940.187] (-3940.628) (-3938.388) * (-3936.302) (-3941.389) (-3938.851) [-3939.540] -- 0:03:14 138000 -- (-3935.679) (-3938.717) [-3945.139] (-3952.393) * [-3935.299] (-3943.782) (-3939.937) (-3934.792) -- 0:03:13 138500 -- (-3936.435) (-3940.200) [-3942.518] (-3937.477) * [-3938.081] (-3935.699) (-3940.169) (-3939.086) -- 0:03:19 139000 -- (-3938.813) [-3941.096] (-3938.021) (-3939.716) * [-3939.711] (-3938.737) (-3932.007) (-3938.327) -- 0:03:18 139500 -- (-3939.094) (-3938.034) (-3936.250) [-3935.534] * (-3933.595) (-3939.031) [-3938.817] (-3934.175) -- 0:03:17 140000 -- [-3935.936] (-3936.721) (-3931.311) (-3940.327) * (-3942.959) [-3936.133] (-3934.203) (-3936.576) -- 0:03:16 Average standard deviation of split frequencies: 0.000000 140500 -- (-3934.593) (-3942.291) (-3934.893) [-3946.427] * [-3941.628] (-3938.847) (-3937.667) (-3935.011) -- 0:03:15 141000 -- [-3936.979] (-3938.753) (-3932.951) (-3939.267) * (-3946.245) (-3937.183) (-3937.061) [-3935.119] -- 0:03:14 141500 -- (-3938.930) (-3938.618) [-3941.006] (-3945.367) * (-3936.241) [-3938.001] (-3941.863) (-3935.296) -- 0:03:14 142000 -- (-3934.627) [-3940.812] (-3934.470) (-3941.392) * (-3939.278) (-3940.026) [-3934.014] (-3941.383) -- 0:03:13 142500 -- (-3938.673) [-3942.179] (-3937.540) (-3942.645) * (-3933.517) (-3936.507) [-3933.518] (-3938.851) -- 0:03:12 143000 -- (-3940.803) [-3936.610] (-3935.155) (-3938.296) * (-3937.121) [-3946.137] (-3940.349) (-3943.700) -- 0:03:17 143500 -- (-3943.359) (-3941.179) [-3932.722] (-3933.455) * (-3938.407) [-3935.587] (-3945.175) (-3936.664) -- 0:03:16 144000 -- (-3944.970) (-3938.630) [-3937.085] (-3937.092) * (-3937.605) (-3935.923) (-3934.613) [-3939.929] -- 0:03:16 144500 -- (-3936.662) (-3939.191) [-3940.174] (-3937.597) * (-3937.700) (-3938.510) (-3936.637) [-3936.268] -- 0:03:15 145000 -- (-3936.480) (-3940.409) (-3938.860) [-3934.930] * (-3935.972) [-3940.168] (-3935.637) (-3937.211) -- 0:03:14 Average standard deviation of split frequencies: 0.000000 145500 -- (-3935.875) (-3938.299) (-3937.406) [-3938.859] * [-3937.922] (-3940.977) (-3939.035) (-3935.946) -- 0:03:13 146000 -- (-3936.369) [-3930.719] (-3941.690) (-3940.015) * (-3936.237) (-3945.186) (-3937.077) [-3935.717] -- 0:03:13 146500 -- (-3937.612) (-3936.538) [-3943.129] (-3941.834) * (-3935.563) (-3942.872) [-3935.974] (-3942.611) -- 0:03:12 147000 -- (-3936.516) (-3939.325) [-3940.484] (-3943.628) * (-3942.643) (-3938.346) [-3938.025] (-3947.567) -- 0:03:11 147500 -- (-3945.953) (-3935.950) [-3935.956] (-3946.150) * (-3941.112) (-3944.042) [-3934.969] (-3939.492) -- 0:03:16 148000 -- (-3936.932) (-3941.657) [-3948.280] (-3939.661) * (-3939.422) [-3936.395] (-3938.391) (-3935.709) -- 0:03:15 148500 -- (-3940.507) [-3934.003] (-3937.846) (-3938.010) * (-3940.322) [-3935.826] (-3932.510) (-3933.597) -- 0:03:14 149000 -- (-3937.061) (-3935.751) [-3937.779] (-3939.862) * (-3943.249) (-3937.890) [-3936.557] (-3933.222) -- 0:03:14 149500 -- (-3941.286) [-3936.505] (-3936.951) (-3945.437) * (-3939.164) (-3942.683) (-3937.058) [-3935.103] -- 0:03:13 150000 -- (-3936.361) [-3938.465] (-3934.918) (-3950.805) * (-3941.757) [-3940.606] (-3937.792) (-3936.423) -- 0:03:12 Average standard deviation of split frequencies: 0.000000 150500 -- (-3934.692) (-3940.104) (-3934.123) [-3944.186] * (-3952.548) (-3938.728) [-3934.858] (-3941.874) -- 0:03:11 151000 -- (-3932.739) (-3941.229) [-3939.319] (-3944.301) * (-3949.171) [-3938.644] (-3938.254) (-3935.743) -- 0:03:11 151500 -- [-3938.384] (-3938.305) (-3942.434) (-3939.990) * [-3935.705] (-3936.297) (-3935.273) (-3948.084) -- 0:03:10 152000 -- (-3942.289) (-3942.034) [-3941.611] (-3945.951) * [-3935.422] (-3936.750) (-3936.134) (-3933.393) -- 0:03:15 152500 -- (-3937.090) [-3939.702] (-3935.946) (-3941.702) * (-3937.249) (-3941.812) [-3943.386] (-3934.870) -- 0:03:14 153000 -- (-3940.515) (-3945.202) [-3934.587] (-3936.781) * (-3937.370) (-3941.254) (-3944.539) [-3942.187] -- 0:03:13 153500 -- [-3938.347] (-3938.591) (-3937.816) (-3944.276) * (-3938.207) (-3937.106) [-3939.061] (-3942.942) -- 0:03:13 154000 -- (-3937.266) [-3933.805] (-3943.039) (-3931.516) * (-3940.515) [-3938.872] (-3941.694) (-3942.099) -- 0:03:12 154500 -- [-3937.558] (-3936.565) (-3936.757) (-3935.921) * (-3935.221) (-3935.040) (-3935.427) [-3939.988] -- 0:03:11 155000 -- (-3945.378) (-3938.622) [-3935.123] (-3939.520) * [-3943.274] (-3945.348) (-3940.222) (-3940.233) -- 0:03:10 Average standard deviation of split frequencies: 0.000000 155500 -- (-3935.650) (-3937.736) [-3933.254] (-3939.569) * (-3939.084) (-3947.022) (-3937.283) [-3939.430] -- 0:03:10 156000 -- (-3937.896) (-3937.900) [-3936.151] (-3942.950) * [-3938.107] (-3937.306) (-3939.157) (-3942.367) -- 0:03:09 156500 -- (-3937.422) (-3934.978) (-3939.206) [-3938.181] * (-3937.258) (-3937.156) (-3943.678) [-3936.766] -- 0:03:14 157000 -- (-3941.961) (-3941.141) (-3944.452) [-3930.419] * [-3937.317] (-3944.010) (-3939.441) (-3939.414) -- 0:03:13 157500 -- (-3935.497) (-3933.494) [-3939.406] (-3944.845) * [-3943.822] (-3939.343) (-3939.941) (-3938.730) -- 0:03:12 158000 -- (-3944.053) [-3938.047] (-3936.391) (-3937.341) * [-3936.763] (-3938.183) (-3948.085) (-3934.771) -- 0:03:11 158500 -- (-3938.048) [-3939.030] (-3945.211) (-3934.551) * (-3938.629) (-3939.375) (-3940.843) [-3938.868] -- 0:03:11 159000 -- (-3935.932) [-3937.081] (-3935.115) (-3943.550) * (-3938.841) (-3940.372) [-3936.726] (-3936.754) -- 0:03:10 159500 -- (-3937.432) (-3936.428) (-3939.032) [-3935.769] * (-3948.205) (-3946.391) (-3940.632) [-3937.462] -- 0:03:09 160000 -- (-3943.825) (-3936.821) [-3941.270] (-3939.859) * (-3940.618) (-3940.772) (-3938.520) [-3940.447] -- 0:03:09 Average standard deviation of split frequencies: 0.000000 160500 -- (-3944.470) (-3939.515) [-3934.989] (-3940.972) * (-3938.834) (-3939.428) [-3942.135] (-3937.123) -- 0:03:08 161000 -- (-3939.371) [-3935.550] (-3936.907) (-3938.700) * (-3936.162) (-3933.844) (-3940.835) [-3936.971] -- 0:03:12 161500 -- (-3945.111) (-3936.896) [-3934.700] (-3935.155) * [-3938.751] (-3951.512) (-3937.358) (-3939.796) -- 0:03:12 162000 -- (-3941.536) [-3937.502] (-3936.478) (-3942.226) * (-3938.958) (-3936.128) [-3940.306] (-3939.340) -- 0:03:11 162500 -- (-3944.356) [-3940.339] (-3937.970) (-3938.402) * [-3933.222] (-3934.882) (-3942.169) (-3946.616) -- 0:03:10 163000 -- [-3933.222] (-3936.945) (-3937.463) (-3947.710) * (-3937.629) (-3932.447) (-3939.559) [-3941.919] -- 0:03:09 163500 -- (-3936.998) [-3941.055] (-3943.304) (-3942.231) * (-3936.816) (-3938.332) [-3935.115] (-3938.291) -- 0:03:09 164000 -- (-3934.986) (-3940.594) (-3933.723) [-3936.584] * [-3940.478] (-3938.157) (-3940.391) (-3937.806) -- 0:03:08 164500 -- (-3937.756) [-3938.629] (-3936.997) (-3942.036) * (-3945.457) (-3939.429) [-3940.390] (-3934.799) -- 0:03:07 165000 -- (-3935.948) (-3948.397) (-3935.009) [-3939.493] * (-3942.837) (-3942.234) [-3936.572] (-3939.145) -- 0:03:07 Average standard deviation of split frequencies: 0.000000 165500 -- (-3941.267) (-3947.941) (-3933.163) [-3942.812] * (-3940.344) (-3936.284) [-3936.135] (-3936.088) -- 0:03:11 166000 -- [-3936.580] (-3934.585) (-3939.631) (-3943.825) * (-3948.279) [-3934.525] (-3938.530) (-3944.112) -- 0:03:10 166500 -- [-3933.762] (-3935.703) (-3948.045) (-3940.943) * [-3934.953] (-3938.884) (-3940.119) (-3937.915) -- 0:03:10 167000 -- [-3936.316] (-3935.606) (-3941.391) (-3944.095) * [-3939.218] (-3938.782) (-3943.248) (-3935.568) -- 0:03:09 167500 -- (-3940.346) (-3933.867) (-3948.576) [-3944.022] * (-3937.348) [-3934.315] (-3934.623) (-3940.183) -- 0:03:08 168000 -- [-3937.174] (-3942.138) (-3948.938) (-3943.002) * (-3937.657) (-3938.781) [-3932.441] (-3945.129) -- 0:03:08 168500 -- [-3932.589] (-3933.971) (-3950.911) (-3934.928) * (-3935.054) (-3938.522) [-3945.861] (-3938.875) -- 0:03:07 169000 -- (-3934.600) [-3938.330] (-3939.775) (-3938.793) * (-3936.345) [-3931.984] (-3940.167) (-3945.738) -- 0:03:06 169500 -- [-3940.734] (-3942.399) (-3938.699) (-3941.671) * (-3941.880) (-3939.764) [-3940.407] (-3939.629) -- 0:03:06 170000 -- [-3937.039] (-3938.601) (-3939.745) (-3941.429) * (-3939.877) (-3941.672) (-3935.958) [-3938.214] -- 0:03:10 Average standard deviation of split frequencies: 0.000000 170500 -- (-3936.339) (-3939.252) (-3942.459) [-3942.625] * (-3941.732) (-3940.548) (-3938.898) [-3939.407] -- 0:03:09 171000 -- (-3945.844) [-3939.566] (-3939.813) (-3941.549) * (-3949.030) [-3935.319] (-3939.588) (-3935.657) -- 0:03:09 171500 -- (-3934.922) [-3938.623] (-3941.756) (-3942.103) * (-3943.236) (-3943.279) (-3938.930) [-3936.052] -- 0:03:08 172000 -- (-3936.948) [-3938.196] (-3936.846) (-3938.420) * [-3942.739] (-3937.785) (-3944.172) (-3937.363) -- 0:03:07 172500 -- (-3939.635) [-3938.507] (-3941.209) (-3934.498) * [-3946.331] (-3932.813) (-3939.609) (-3936.546) -- 0:03:07 173000 -- (-3938.855) (-3935.277) [-3941.615] (-3932.898) * (-3934.631) (-3937.423) [-3941.033] (-3939.029) -- 0:03:06 173500 -- (-3933.197) [-3934.618] (-3939.478) (-3937.067) * (-3936.005) [-3932.364] (-3942.892) (-3938.887) -- 0:03:05 174000 -- (-3937.909) (-3934.463) [-3942.897] (-3938.344) * (-3935.446) (-3935.178) [-3940.538] (-3945.035) -- 0:03:05 174500 -- [-3937.346] (-3939.738) (-3947.753) (-3936.944) * (-3942.461) [-3938.256] (-3939.104) (-3935.061) -- 0:03:09 175000 -- (-3935.632) (-3942.169) (-3940.501) [-3934.012] * (-3941.231) (-3938.447) (-3944.334) [-3934.917] -- 0:03:08 Average standard deviation of split frequencies: 0.000000 175500 -- (-3938.771) (-3934.778) (-3939.141) [-3943.434] * (-3933.632) (-3943.053) (-3938.036) [-3939.806] -- 0:03:07 176000 -- [-3934.022] (-3939.639) (-3941.932) (-3937.946) * (-3943.000) (-3939.971) [-3936.170] (-3939.524) -- 0:03:07 176500 -- (-3939.772) [-3936.227] (-3938.856) (-3935.453) * [-3936.412] (-3937.745) (-3935.410) (-3936.735) -- 0:03:06 177000 -- (-3936.793) (-3937.120) (-3947.404) [-3933.481] * (-3937.633) (-3940.571) [-3940.145] (-3935.148) -- 0:03:05 177500 -- (-3938.642) [-3934.463] (-3940.821) (-3942.488) * (-3937.365) [-3939.521] (-3939.251) (-3939.035) -- 0:03:05 178000 -- (-3939.552) (-3936.972) [-3943.209] (-3939.090) * [-3940.101] (-3939.149) (-3942.454) (-3934.090) -- 0:03:04 178500 -- [-3939.590] (-3936.578) (-3942.881) (-3940.741) * (-3940.304) (-3942.458) (-3937.391) [-3934.264] -- 0:03:04 179000 -- (-3945.283) [-3936.916] (-3937.715) (-3939.362) * (-3944.935) (-3940.672) [-3942.294] (-3939.786) -- 0:03:08 179500 -- (-3938.820) (-3937.409) (-3938.435) [-3935.561] * (-3940.439) (-3936.526) [-3938.649] (-3940.578) -- 0:03:07 180000 -- (-3938.935) (-3933.574) [-3936.845] (-3939.611) * (-3945.119) (-3934.464) (-3944.346) [-3936.541] -- 0:03:06 Average standard deviation of split frequencies: 0.000000 180500 -- (-3939.050) [-3939.674] (-3938.926) (-3933.162) * (-3939.125) [-3937.510] (-3944.364) (-3938.928) -- 0:03:06 181000 -- [-3939.706] (-3936.957) (-3937.736) (-3945.298) * (-3937.678) (-3937.838) [-3937.178] (-3937.621) -- 0:03:05 181500 -- (-3939.992) [-3939.123] (-3934.765) (-3945.509) * (-3935.152) [-3939.457] (-3940.702) (-3934.584) -- 0:03:04 182000 -- (-3936.310) [-3935.330] (-3933.353) (-3945.735) * (-3944.746) (-3948.304) (-3946.605) [-3941.897] -- 0:03:04 182500 -- [-3938.814] (-3937.662) (-3939.456) (-3936.318) * (-3945.464) (-3935.854) (-3939.489) [-3937.170] -- 0:03:03 183000 -- (-3941.449) (-3939.881) (-3935.303) [-3943.176] * [-3941.624] (-3942.971) (-3939.603) (-3937.286) -- 0:03:03 183500 -- (-3939.305) (-3938.022) [-3935.770] (-3938.885) * [-3937.285] (-3946.020) (-3937.175) (-3939.436) -- 0:03:06 184000 -- (-3938.810) (-3935.582) [-3938.658] (-3940.967) * (-3941.110) (-3937.199) (-3938.074) [-3936.315] -- 0:03:06 184500 -- [-3940.095] (-3935.725) (-3939.736) (-3931.109) * (-3945.516) [-3937.699] (-3941.216) (-3942.341) -- 0:03:05 185000 -- (-3939.770) (-3939.856) (-3932.549) [-3937.977] * (-3949.870) [-3940.334] (-3936.185) (-3941.016) -- 0:03:05 Average standard deviation of split frequencies: 0.000000 185500 -- (-3942.466) (-3945.259) [-3938.300] (-3942.390) * (-3935.427) [-3935.552] (-3946.621) (-3943.095) -- 0:03:04 186000 -- [-3941.208] (-3934.869) (-3944.846) (-3944.189) * (-3940.358) (-3939.204) [-3943.872] (-3940.817) -- 0:03:03 186500 -- (-3939.028) (-3937.591) [-3942.606] (-3939.606) * (-3934.882) (-3939.511) [-3940.247] (-3937.620) -- 0:03:03 187000 -- (-3945.004) (-3937.869) [-3936.600] (-3940.466) * [-3937.707] (-3936.560) (-3936.678) (-3935.466) -- 0:03:02 187500 -- (-3938.477) (-3938.700) [-3940.095] (-3943.669) * (-3941.995) (-3950.109) [-3938.980] (-3944.689) -- 0:03:06 188000 -- (-3936.865) (-3949.867) (-3939.087) [-3936.902] * (-3938.181) [-3938.339] (-3936.398) (-3933.624) -- 0:03:05 188500 -- (-3935.547) (-3939.465) [-3937.467] (-3934.735) * (-3936.884) (-3941.781) (-3937.068) [-3934.165] -- 0:03:05 189000 -- (-3943.931) (-3938.243) (-3938.811) [-3934.723] * (-3937.816) (-3937.059) [-3936.143] (-3945.864) -- 0:03:04 189500 -- (-3940.145) (-3941.720) (-3934.769) [-3940.607] * (-3941.221) (-3937.923) (-3936.598) [-3937.812] -- 0:03:03 190000 -- (-3945.177) (-3938.407) [-3934.572] (-3939.985) * [-3938.332] (-3936.553) (-3943.366) (-3936.307) -- 0:03:03 Average standard deviation of split frequencies: 0.000000 190500 -- (-3937.744) (-3937.178) [-3938.038] (-3937.020) * (-3939.585) (-3934.414) [-3936.579] (-3934.891) -- 0:03:02 191000 -- (-3938.217) (-3940.641) [-3936.561] (-3934.757) * (-3936.217) (-3932.757) (-3939.546) [-3935.549] -- 0:03:02 191500 -- (-3939.311) (-3942.860) (-3942.422) [-3939.628] * (-3936.250) (-3937.022) (-3932.334) [-3935.698] -- 0:03:01 192000 -- (-3939.317) (-3946.194) (-3933.284) [-3932.911] * (-3945.812) (-3941.575) [-3930.634] (-3931.600) -- 0:03:05 192500 -- (-3941.098) (-3935.219) (-3938.237) [-3935.436] * (-3940.896) (-3936.721) [-3934.383] (-3936.960) -- 0:03:04 193000 -- [-3933.178] (-3939.864) (-3940.270) (-3936.237) * (-3944.476) (-3940.513) (-3934.853) [-3939.743] -- 0:03:03 193500 -- (-3936.515) (-3942.019) [-3938.632] (-3942.352) * (-3944.980) (-3933.906) (-3937.799) [-3938.221] -- 0:03:03 194000 -- (-3937.697) (-3943.302) (-3944.670) [-3944.196] * (-3936.944) (-3938.992) (-3939.861) [-3938.065] -- 0:03:02 194500 -- (-3938.920) (-3936.269) [-3939.976] (-3944.536) * (-3939.546) (-3932.305) [-3938.140] (-3934.713) -- 0:03:02 195000 -- (-3937.037) (-3948.553) (-3934.684) [-3941.836] * (-3938.443) (-3935.115) [-3935.315] (-3937.939) -- 0:03:01 Average standard deviation of split frequencies: 0.000000 195500 -- (-3936.543) (-3936.524) (-3935.160) [-3941.977] * (-3941.563) [-3936.439] (-3943.167) (-3940.958) -- 0:03:01 196000 -- [-3939.574] (-3940.514) (-3939.770) (-3937.535) * (-3941.367) (-3936.310) [-3941.790] (-3932.582) -- 0:03:00 196500 -- [-3938.037] (-3937.189) (-3940.388) (-3947.273) * [-3937.589] (-3941.549) (-3947.436) (-3943.209) -- 0:03:04 197000 -- [-3940.713] (-3937.657) (-3939.359) (-3941.340) * [-3935.340] (-3938.955) (-3936.742) (-3937.684) -- 0:03:03 197500 -- (-3938.635) (-3935.774) [-3937.039] (-3932.756) * (-3942.821) (-3938.367) [-3940.047] (-3940.458) -- 0:03:02 198000 -- (-3939.074) (-3935.653) [-3936.799] (-3936.603) * [-3942.472] (-3943.253) (-3930.507) (-3939.963) -- 0:03:02 198500 -- (-3935.202) [-3936.714] (-3935.593) (-3942.546) * (-3936.630) (-3938.441) [-3936.620] (-3938.457) -- 0:03:01 199000 -- (-3943.062) (-3940.943) (-3936.953) [-3939.563] * (-3942.771) (-3937.082) (-3938.165) [-3943.109] -- 0:03:01 199500 -- (-3938.683) (-3938.709) (-3940.974) [-3941.247] * [-3934.831] (-3937.449) (-3936.507) (-3944.742) -- 0:03:00 200000 -- [-3935.401] (-3937.403) (-3941.666) (-3945.165) * (-3932.014) (-3935.970) [-3936.139] (-3938.403) -- 0:03:00 Average standard deviation of split frequencies: 0.000000 200500 -- (-3940.372) (-3942.734) (-3939.348) [-3934.295] * (-3941.451) (-3941.636) [-3939.105] (-3939.578) -- 0:02:59 201000 -- (-3939.903) [-3939.049] (-3946.076) (-3937.677) * (-3937.778) (-3943.796) (-3943.854) [-3938.685] -- 0:03:02 201500 -- [-3936.034] (-3939.439) (-3937.956) (-3937.389) * (-3935.968) [-3940.686] (-3934.594) (-3939.910) -- 0:03:02 202000 -- [-3942.545] (-3943.372) (-3937.294) (-3937.954) * [-3935.584] (-3938.922) (-3934.697) (-3940.949) -- 0:03:01 202500 -- [-3938.584] (-3941.753) (-3940.614) (-3935.532) * (-3937.929) [-3938.126] (-3942.776) (-3934.139) -- 0:03:01 203000 -- (-3937.228) (-3944.915) (-3939.472) [-3936.276] * [-3940.341] (-3941.583) (-3940.874) (-3936.266) -- 0:03:00 203500 -- [-3943.747] (-3939.942) (-3937.680) (-3936.989) * [-3941.254] (-3936.436) (-3941.611) (-3937.456) -- 0:03:00 204000 -- (-3941.026) [-3934.137] (-3939.458) (-3932.313) * (-3939.966) (-3937.167) [-3933.384] (-3938.674) -- 0:02:59 204500 -- (-3941.642) [-3942.102] (-3945.982) (-3936.740) * (-3944.990) (-3944.048) (-3936.627) [-3935.287] -- 0:02:58 205000 -- (-3936.821) [-3934.939] (-3940.684) (-3941.782) * (-3938.999) [-3939.902] (-3938.119) (-3941.446) -- 0:02:58 Average standard deviation of split frequencies: 0.000000 205500 -- [-3936.240] (-3938.242) (-3938.191) (-3943.794) * (-3942.300) (-3936.649) (-3940.121) [-3937.488] -- 0:03:01 206000 -- (-3934.655) [-3944.102] (-3938.350) (-3940.784) * [-3934.984] (-3937.376) (-3942.947) (-3934.257) -- 0:03:01 206500 -- (-3939.187) [-3939.571] (-3939.081) (-3941.743) * (-3934.673) (-3938.145) [-3942.758] (-3934.625) -- 0:03:00 207000 -- (-3948.781) [-3944.586] (-3937.303) (-3940.245) * (-3936.140) (-3939.634) (-3945.122) [-3939.792] -- 0:03:00 207500 -- [-3941.091] (-3940.651) (-3938.318) (-3937.333) * [-3940.175] (-3942.430) (-3937.483) (-3936.861) -- 0:02:59 208000 -- (-3946.898) (-3937.373) (-3937.143) [-3935.033] * (-3934.894) (-3932.842) [-3940.188] (-3938.609) -- 0:02:58 208500 -- [-3950.586] (-3939.351) (-3939.251) (-3941.929) * [-3932.505] (-3937.065) (-3946.811) (-3937.193) -- 0:02:58 209000 -- (-3934.332) (-3936.929) [-3943.275] (-3936.563) * (-3935.732) (-3941.251) [-3938.354] (-3936.888) -- 0:02:57 209500 -- (-3940.342) (-3939.200) (-3941.477) [-3937.663] * (-3935.334) [-3937.098] (-3939.209) (-3941.126) -- 0:02:57 210000 -- (-3937.007) [-3937.071] (-3941.625) (-3938.858) * (-3941.666) (-3934.041) [-3937.833] (-3942.730) -- 0:03:00 Average standard deviation of split frequencies: 0.000000 210500 -- (-3945.615) (-3937.276) [-3935.369] (-3937.687) * (-3939.065) (-3940.209) [-3937.476] (-3941.099) -- 0:03:00 211000 -- [-3939.219] (-3940.534) (-3937.847) (-3939.773) * [-3939.592] (-3939.097) (-3933.078) (-3935.480) -- 0:02:59 211500 -- (-3939.733) (-3944.336) (-3941.892) [-3931.736] * [-3936.559] (-3936.778) (-3933.289) (-3942.128) -- 0:02:58 212000 -- (-3936.436) (-3943.640) [-3938.573] (-3943.721) * [-3941.142] (-3936.020) (-3938.097) (-3938.382) -- 0:02:58 212500 -- (-3947.185) (-3947.462) [-3935.941] (-3934.084) * (-3932.158) [-3933.875] (-3935.841) (-3947.991) -- 0:02:57 213000 -- (-3945.401) (-3947.536) (-3942.747) [-3934.324] * (-3939.941) (-3937.292) (-3932.275) [-3940.466] -- 0:02:57 213500 -- (-3937.727) (-3941.874) [-3948.269] (-3936.865) * (-3936.813) [-3939.722] (-3946.976) (-3935.554) -- 0:02:56 214000 -- (-3940.482) (-3942.215) (-3935.403) [-3938.324] * (-3939.433) (-3933.848) [-3938.015] (-3938.578) -- 0:02:56 214500 -- (-3939.559) [-3938.198] (-3944.488) (-3939.614) * (-3941.737) [-3943.556] (-3942.469) (-3942.071) -- 0:02:59 215000 -- (-3946.915) [-3934.084] (-3939.331) (-3942.434) * (-3942.133) (-3944.831) [-3940.331] (-3949.429) -- 0:02:58 Average standard deviation of split frequencies: 0.000000 215500 -- (-3941.105) (-3937.164) [-3938.220] (-3942.286) * [-3939.754] (-3947.021) (-3935.149) (-3945.381) -- 0:02:58 216000 -- (-3942.522) [-3934.968] (-3938.871) (-3937.920) * (-3941.814) (-3941.084) (-3936.213) [-3936.985] -- 0:02:57 216500 -- (-3939.120) (-3941.201) [-3939.719] (-3938.383) * (-3938.682) (-3940.941) (-3941.602) [-3938.235] -- 0:02:57 217000 -- (-3934.804) [-3941.002] (-3937.012) (-3937.876) * (-3934.785) [-3938.090] (-3938.036) (-3938.665) -- 0:02:56 217500 -- (-3935.489) (-3938.046) (-3930.712) [-3938.931] * [-3934.498] (-3939.094) (-3941.178) (-3938.714) -- 0:02:56 218000 -- (-3940.901) [-3936.293] (-3936.757) (-3936.218) * (-3939.559) (-3939.498) [-3945.609] (-3943.417) -- 0:02:55 218500 -- (-3940.729) (-3938.611) [-3932.024] (-3938.401) * (-3940.104) [-3935.752] (-3937.429) (-3937.954) -- 0:02:58 219000 -- (-3935.117) (-3938.741) [-3938.838] (-3936.222) * (-3935.546) (-3936.389) [-3939.361] (-3935.818) -- 0:02:58 219500 -- (-3938.186) (-3937.378) (-3937.064) [-3936.802] * [-3938.813] (-3942.575) (-3937.248) (-3938.228) -- 0:02:57 220000 -- (-3936.576) (-3943.878) [-3939.282] (-3945.830) * [-3935.179] (-3949.105) (-3936.225) (-3937.304) -- 0:02:57 Average standard deviation of split frequencies: 0.000000 220500 -- (-3938.373) [-3938.134] (-3936.135) (-3938.312) * (-3938.872) (-3941.454) (-3934.617) [-3937.367] -- 0:02:56 221000 -- (-3947.416) (-3943.499) [-3935.267] (-3939.832) * (-3941.364) (-3938.292) [-3936.684] (-3935.679) -- 0:02:56 221500 -- (-3936.905) (-3938.138) (-3935.109) [-3934.914] * (-3942.850) [-3938.345] (-3941.513) (-3945.964) -- 0:02:55 222000 -- (-3936.755) (-3944.905) (-3936.358) [-3935.935] * (-3939.306) (-3934.817) [-3935.953] (-3947.209) -- 0:02:55 222500 -- (-3937.506) [-3940.570] (-3942.593) (-3941.489) * (-3936.090) (-3935.993) [-3940.518] (-3946.144) -- 0:02:54 223000 -- (-3940.759) (-3940.642) [-3944.371] (-3937.782) * (-3943.576) (-3934.387) [-3932.513] (-3942.681) -- 0:02:57 223500 -- (-3940.184) [-3941.158] (-3936.839) (-3946.267) * [-3932.702] (-3933.000) (-3935.093) (-3945.989) -- 0:02:57 224000 -- (-3939.671) (-3935.483) (-3943.286) [-3941.848] * [-3940.801] (-3947.194) (-3940.091) (-3940.567) -- 0:02:56 224500 -- (-3942.292) [-3938.100] (-3936.954) (-3943.664) * (-3934.875) (-3937.227) (-3938.007) [-3939.061] -- 0:02:56 225000 -- (-3937.563) (-3933.043) (-3937.933) [-3935.029] * [-3939.886] (-3946.478) (-3934.041) (-3935.264) -- 0:02:55 Average standard deviation of split frequencies: 0.000000 225500 -- (-3946.628) (-3934.230) (-3943.448) [-3934.294] * (-3945.348) (-3937.477) (-3937.401) [-3937.338] -- 0:02:55 226000 -- (-3942.680) (-3934.308) [-3937.047] (-3941.869) * (-3935.382) (-3938.670) [-3937.474] (-3941.071) -- 0:02:54 226500 -- (-3942.551) [-3944.252] (-3938.724) (-3935.720) * (-3938.242) (-3948.208) [-3942.355] (-3935.587) -- 0:02:54 227000 -- (-3942.062) (-3941.325) (-3937.275) [-3935.510] * [-3937.620] (-3937.270) (-3943.401) (-3935.026) -- 0:02:53 227500 -- (-3934.831) (-3940.126) (-3936.141) [-3935.543] * (-3938.108) [-3939.486] (-3939.275) (-3938.411) -- 0:02:56 228000 -- [-3936.138] (-3934.189) (-3938.903) (-3937.320) * (-3936.628) [-3940.041] (-3937.482) (-3939.573) -- 0:02:56 228500 -- (-3934.536) (-3933.034) (-3933.702) [-3941.958] * (-3937.994) (-3937.405) [-3938.755] (-3937.776) -- 0:02:55 229000 -- (-3933.780) [-3938.435] (-3942.065) (-3938.175) * (-3942.918) (-3939.418) (-3937.846) [-3936.967] -- 0:02:55 229500 -- (-3938.302) [-3932.445] (-3936.348) (-3948.631) * [-3940.094] (-3934.165) (-3939.933) (-3940.998) -- 0:02:54 230000 -- (-3936.699) (-3936.304) [-3938.840] (-3939.871) * (-3943.207) [-3934.914] (-3934.059) (-3938.091) -- 0:02:54 Average standard deviation of split frequencies: 0.000000 230500 -- (-3937.931) (-3938.890) [-3940.380] (-3943.409) * (-3944.414) [-3932.765] (-3936.765) (-3936.801) -- 0:02:53 231000 -- (-3937.791) [-3942.469] (-3937.686) (-3943.692) * [-3936.370] (-3936.284) (-3935.518) (-3942.487) -- 0:02:53 231500 -- (-3941.539) (-3947.468) [-3934.386] (-3940.774) * (-3942.945) (-3935.861) (-3933.965) [-3935.399] -- 0:02:55 232000 -- (-3932.511) (-3939.448) (-3936.179) [-3939.806] * (-3937.791) (-3939.014) [-3935.588] (-3940.188) -- 0:02:55 232500 -- (-3945.474) (-3935.172) [-3933.329] (-3939.636) * [-3936.679] (-3945.980) (-3945.003) (-3938.935) -- 0:02:54 233000 -- [-3942.184] (-3936.979) (-3938.735) (-3944.829) * (-3943.755) (-3943.294) [-3937.126] (-3939.418) -- 0:02:54 233500 -- (-3938.052) [-3936.859] (-3942.302) (-3944.822) * (-3935.793) [-3935.790] (-3937.237) (-3936.104) -- 0:02:53 234000 -- (-3937.026) (-3945.183) (-3943.737) [-3936.894] * (-3940.589) (-3943.842) (-3947.424) [-3935.017] -- 0:02:53 234500 -- (-3944.009) (-3941.199) [-3940.257] (-3934.580) * (-3940.353) (-3938.302) [-3940.637] (-3937.204) -- 0:02:53 235000 -- [-3939.750] (-3940.702) (-3943.598) (-3943.285) * [-3934.451] (-3938.492) (-3943.057) (-3936.742) -- 0:02:52 Average standard deviation of split frequencies: 0.000000 235500 -- (-3940.284) [-3941.274] (-3937.142) (-3941.099) * (-3932.253) [-3935.424] (-3938.657) (-3935.357) -- 0:02:52 236000 -- (-3938.790) [-3936.341] (-3940.718) (-3937.808) * [-3934.408] (-3934.655) (-3936.557) (-3934.276) -- 0:02:54 236500 -- [-3932.849] (-3940.714) (-3937.234) (-3944.676) * (-3934.506) (-3941.068) (-3941.444) [-3941.466] -- 0:02:54 237000 -- (-3934.879) (-3940.425) [-3938.863] (-3937.374) * (-3934.805) (-3940.022) [-3936.460] (-3933.779) -- 0:02:53 237500 -- [-3933.343] (-3945.759) (-3940.699) (-3939.531) * [-3936.123] (-3943.242) (-3935.794) (-3941.098) -- 0:02:53 238000 -- (-3935.151) (-3941.468) (-3939.697) [-3939.282] * (-3936.675) [-3943.189] (-3935.711) (-3940.873) -- 0:02:52 238500 -- (-3940.979) [-3938.997] (-3935.100) (-3935.866) * (-3940.150) [-3936.565] (-3940.219) (-3937.615) -- 0:02:52 239000 -- (-3940.404) [-3943.680] (-3939.363) (-3938.136) * [-3937.819] (-3942.620) (-3934.665) (-3936.855) -- 0:02:51 239500 -- (-3946.035) (-3936.997) [-3939.181] (-3938.172) * [-3941.767] (-3938.704) (-3943.579) (-3943.617) -- 0:02:51 240000 -- [-3936.124] (-3935.560) (-3937.435) (-3936.478) * (-3943.001) [-3941.510] (-3942.949) (-3935.611) -- 0:02:51 Average standard deviation of split frequencies: 0.000000 240500 -- (-3936.408) [-3936.995] (-3942.708) (-3939.767) * (-3940.538) (-3933.706) (-3937.087) [-3937.122] -- 0:02:53 241000 -- (-3936.670) [-3938.690] (-3937.531) (-3938.802) * (-3936.165) [-3937.538] (-3943.268) (-3938.558) -- 0:02:53 241500 -- (-3943.660) (-3935.354) (-3940.889) [-3937.286] * (-3940.263) [-3938.400] (-3942.379) (-3941.997) -- 0:02:52 242000 -- (-3944.423) (-3942.182) [-3941.751] (-3935.652) * (-3941.204) (-3942.031) [-3938.306] (-3934.006) -- 0:02:52 242500 -- (-3944.447) (-3938.266) (-3939.374) [-3943.200] * (-3935.669) (-3949.079) [-3935.426] (-3935.059) -- 0:02:51 243000 -- (-3937.405) (-3935.550) [-3938.523] (-3941.156) * (-3935.418) (-3938.602) [-3940.570] (-3938.083) -- 0:02:51 243500 -- [-3936.237] (-3942.106) (-3936.192) (-3938.513) * (-3938.060) (-3939.211) [-3941.705] (-3939.289) -- 0:02:50 244000 -- (-3942.603) (-3939.079) [-3933.718] (-3933.487) * (-3940.651) [-3937.721] (-3935.274) (-3939.166) -- 0:02:50 244500 -- (-3938.429) (-3936.608) (-3940.255) [-3938.112] * (-3937.214) (-3937.882) [-3939.483] (-3938.156) -- 0:02:49 245000 -- [-3934.176] (-3941.708) (-3940.315) (-3940.019) * [-3935.213] (-3933.769) (-3943.932) (-3945.819) -- 0:02:52 Average standard deviation of split frequencies: 0.000000 245500 -- [-3944.225] (-3936.209) (-3941.597) (-3945.876) * [-3937.801] (-3940.900) (-3940.943) (-3949.480) -- 0:02:52 246000 -- (-3941.192) (-3938.983) (-3941.622) [-3937.613] * [-3941.171] (-3938.420) (-3934.951) (-3945.476) -- 0:02:51 246500 -- (-3937.678) (-3936.600) (-3938.065) [-3932.967] * (-3937.963) (-3938.694) [-3942.394] (-3941.260) -- 0:02:51 247000 -- (-3941.481) (-3941.695) [-3931.693] (-3942.901) * (-3944.032) (-3942.645) (-3939.939) [-3938.580] -- 0:02:50 247500 -- (-3935.848) (-3940.440) [-3934.636] (-3942.268) * [-3943.139] (-3944.024) (-3942.333) (-3949.193) -- 0:02:50 248000 -- [-3934.759] (-3941.210) (-3938.133) (-3940.243) * (-3937.570) (-3935.897) (-3934.750) [-3940.285] -- 0:02:49 248500 -- (-3938.647) (-3934.459) (-3939.550) [-3938.356] * [-3940.995] (-3941.095) (-3942.512) (-3940.935) -- 0:02:49 249000 -- [-3945.925] (-3939.021) (-3939.476) (-3943.720) * [-3935.565] (-3938.974) (-3939.136) (-3938.105) -- 0:02:48 249500 -- (-3937.310) (-3943.887) (-3936.495) [-3936.332] * (-3938.890) [-3938.893] (-3937.896) (-3938.020) -- 0:02:51 250000 -- [-3935.069] (-3934.386) (-3938.365) (-3942.568) * (-3933.480) [-3939.862] (-3938.058) (-3937.593) -- 0:02:51 Average standard deviation of split frequencies: 0.000000 250500 -- [-3934.682] (-3937.098) (-3936.069) (-3935.766) * (-3934.091) (-3943.585) (-3941.382) [-3936.271] -- 0:02:50 251000 -- (-3937.723) (-3937.493) (-3938.039) [-3940.018] * (-3935.958) [-3935.917] (-3939.807) (-3935.572) -- 0:02:50 251500 -- (-3935.194) (-3941.020) (-3939.556) [-3937.887] * [-3938.397] (-3938.838) (-3935.800) (-3936.574) -- 0:02:49 252000 -- [-3939.443] (-3944.107) (-3936.579) (-3936.963) * (-3933.610) (-3941.032) (-3934.496) [-3934.255] -- 0:02:49 252500 -- (-3944.085) [-3933.583] (-3941.875) (-3937.904) * [-3936.803] (-3947.040) (-3937.149) (-3938.169) -- 0:02:48 253000 -- [-3939.848] (-3936.771) (-3943.233) (-3941.951) * (-3942.964) (-3937.097) (-3937.872) [-3934.829] -- 0:02:48 253500 -- (-3948.066) [-3943.726] (-3942.801) (-3942.235) * (-3937.988) [-3939.712] (-3934.457) (-3938.480) -- 0:02:47 254000 -- (-3941.793) [-3938.847] (-3935.843) (-3941.833) * (-3935.274) [-3937.465] (-3939.086) (-3942.895) -- 0:02:50 254500 -- [-3939.801] (-3940.109) (-3940.052) (-3939.089) * [-3938.944] (-3938.227) (-3938.126) (-3934.252) -- 0:02:49 255000 -- (-3941.843) (-3938.572) (-3939.736) [-3933.374] * (-3938.866) [-3936.856] (-3941.048) (-3942.275) -- 0:02:49 Average standard deviation of split frequencies: 0.000000 255500 -- [-3940.892] (-3949.609) (-3944.294) (-3934.312) * (-3938.769) (-3941.120) [-3936.005] (-3934.150) -- 0:02:49 256000 -- (-3933.874) (-3945.426) (-3937.521) [-3941.390] * (-3942.700) (-3941.820) (-3938.600) [-3940.981] -- 0:02:48 256500 -- (-3934.512) (-3943.336) (-3937.863) [-3939.168] * (-3938.396) (-3939.000) (-3936.369) [-3939.305] -- 0:02:48 257000 -- (-3940.317) (-3943.979) [-3935.541] (-3939.515) * [-3938.480] (-3940.653) (-3934.651) (-3935.617) -- 0:02:47 257500 -- (-3938.610) (-3943.681) [-3937.983] (-3937.600) * (-3939.115) [-3941.588] (-3934.384) (-3939.507) -- 0:02:47 258000 -- [-3944.651] (-3932.168) (-3935.109) (-3933.592) * (-3937.303) (-3936.529) [-3939.640] (-3940.496) -- 0:02:46 258500 -- (-3937.861) (-3932.720) (-3943.757) [-3939.745] * (-3936.131) (-3942.743) (-3939.395) [-3936.021] -- 0:02:49 259000 -- (-3938.571) (-3933.115) [-3935.205] (-3941.918) * [-3942.056] (-3940.255) (-3940.445) (-3942.117) -- 0:02:48 259500 -- (-3937.310) (-3933.122) (-3940.759) [-3936.632] * (-3933.388) [-3936.057] (-3936.245) (-3939.421) -- 0:02:48 260000 -- (-3939.983) (-3936.358) (-3939.636) [-3936.887] * (-3937.875) [-3935.746] (-3941.456) (-3934.527) -- 0:02:47 Average standard deviation of split frequencies: 0.000000 260500 -- [-3938.586] (-3933.662) (-3938.046) (-3932.501) * (-3943.477) (-3940.155) [-3937.040] (-3937.629) -- 0:02:47 261000 -- (-3941.699) (-3937.480) (-3937.899) [-3937.980] * (-3934.312) (-3935.416) (-3937.025) [-3939.164] -- 0:02:47 261500 -- [-3945.613] (-3939.369) (-3936.330) (-3935.147) * (-3943.296) [-3937.827] (-3936.334) (-3936.951) -- 0:02:46 262000 -- (-3938.582) [-3933.326] (-3943.638) (-3945.856) * (-3940.218) (-3936.267) (-3940.893) [-3934.308] -- 0:02:46 262500 -- (-3940.249) (-3937.365) [-3940.308] (-3939.955) * (-3940.644) [-3934.858] (-3939.117) (-3937.491) -- 0:02:45 263000 -- (-3940.977) [-3943.742] (-3940.900) (-3937.863) * (-3937.056) (-3933.677) [-3944.001] (-3937.413) -- 0:02:48 263500 -- (-3935.065) [-3939.758] (-3940.845) (-3937.228) * (-3943.588) (-3936.398) (-3940.690) [-3933.893] -- 0:02:47 264000 -- (-3936.355) [-3937.826] (-3945.620) (-3938.412) * (-3938.237) [-3932.489] (-3946.415) (-3940.221) -- 0:02:47 264500 -- (-3934.957) (-3940.460) (-3943.955) [-3938.587] * (-3941.530) [-3936.082] (-3938.790) (-3948.653) -- 0:02:46 265000 -- [-3949.076] (-3936.303) (-3933.938) (-3938.736) * (-3935.797) (-3938.353) (-3935.602) [-3938.360] -- 0:02:46 Average standard deviation of split frequencies: 0.000000 265500 -- (-3939.711) [-3936.342] (-3937.259) (-3937.431) * (-3937.477) (-3937.481) [-3938.166] (-3948.569) -- 0:02:45 266000 -- (-3939.510) [-3936.450] (-3946.551) (-3939.084) * [-3932.650] (-3938.554) (-3938.067) (-3942.625) -- 0:02:45 266500 -- (-3939.972) [-3934.975] (-3948.729) (-3939.972) * (-3935.524) [-3939.029] (-3935.628) (-3939.625) -- 0:02:45 267000 -- (-3940.630) [-3932.951] (-3942.216) (-3941.109) * (-3942.230) (-3942.247) [-3940.702] (-3940.746) -- 0:02:44 267500 -- (-3946.268) [-3936.557] (-3944.290) (-3942.865) * (-3937.216) (-3936.272) [-3937.985] (-3945.411) -- 0:02:47 268000 -- [-3937.122] (-3936.888) (-3943.611) (-3935.857) * [-3936.817] (-3946.164) (-3935.410) (-3932.596) -- 0:02:46 268500 -- (-3940.774) [-3935.995] (-3942.486) (-3938.130) * (-3935.909) [-3940.008] (-3938.988) (-3938.122) -- 0:02:46 269000 -- (-3936.175) (-3934.631) (-3938.563) [-3939.478] * (-3934.325) (-3939.036) [-3942.167] (-3938.849) -- 0:02:45 269500 -- (-3942.824) [-3934.612] (-3937.046) (-3938.703) * (-3935.566) [-3944.018] (-3938.775) (-3935.523) -- 0:02:45 270000 -- (-3939.127) [-3938.105] (-3937.918) (-3933.181) * (-3941.540) (-3940.068) (-3936.788) [-3939.855] -- 0:02:44 Average standard deviation of split frequencies: 0.000000 270500 -- (-3935.709) (-3937.375) [-3947.011] (-3934.493) * (-3939.764) [-3938.864] (-3942.887) (-3935.929) -- 0:02:44 271000 -- (-3945.208) (-3942.930) (-3939.079) [-3933.182] * (-3939.614) [-3941.670] (-3932.475) (-3938.409) -- 0:02:44 271500 -- [-3935.823] (-3947.113) (-3936.080) (-3933.869) * (-3936.971) (-3940.286) (-3940.006) [-3938.290] -- 0:02:46 272000 -- (-3943.225) (-3942.260) (-3938.212) [-3932.932] * [-3936.396] (-3938.276) (-3941.421) (-3938.747) -- 0:02:45 272500 -- (-3939.124) (-3937.046) [-3937.872] (-3936.149) * [-3936.672] (-3943.320) (-3936.160) (-3937.407) -- 0:02:45 273000 -- [-3938.290] (-3937.401) (-3938.429) (-3934.013) * (-3939.654) [-3936.318] (-3937.546) (-3935.798) -- 0:02:45 273500 -- (-3936.435) (-3945.007) (-3934.770) [-3934.930] * (-3942.910) [-3941.825] (-3937.179) (-3938.202) -- 0:02:44 274000 -- (-3937.748) (-3937.501) [-3933.882] (-3944.020) * (-3941.301) [-3932.576] (-3942.370) (-3936.501) -- 0:02:44 274500 -- (-3935.497) [-3940.685] (-3946.183) (-3937.921) * (-3933.539) (-3937.687) [-3938.755] (-3939.615) -- 0:02:43 275000 -- (-3934.967) (-3938.818) [-3938.062] (-3945.148) * [-3945.035] (-3937.863) (-3940.042) (-3935.935) -- 0:02:43 Average standard deviation of split frequencies: 0.000000 275500 -- [-3937.916] (-3937.801) (-3939.316) (-3933.589) * (-3940.837) (-3939.067) (-3946.725) [-3937.731] -- 0:02:43 276000 -- (-3937.465) [-3941.659] (-3938.385) (-3944.416) * (-3939.765) (-3943.008) (-3947.140) [-3941.298] -- 0:02:45 276500 -- (-3944.585) (-3938.266) (-3939.298) [-3939.160] * [-3934.014] (-3940.058) (-3942.732) (-3941.945) -- 0:02:44 277000 -- (-3936.206) [-3932.559] (-3940.979) (-3935.641) * (-3934.635) (-3937.429) [-3935.299] (-3946.331) -- 0:02:44 277500 -- (-3941.021) [-3940.803] (-3938.102) (-3942.589) * (-3937.906) [-3934.286] (-3936.610) (-3940.581) -- 0:02:44 278000 -- [-3937.543] (-3948.829) (-3940.896) (-3942.365) * (-3935.401) [-3934.594] (-3941.028) (-3935.287) -- 0:02:43 278500 -- (-3943.211) (-3942.196) [-3942.616] (-3939.278) * (-3940.607) [-3938.142] (-3934.809) (-3938.018) -- 0:02:43 279000 -- (-3937.016) (-3938.073) (-3935.859) [-3936.077] * (-3935.549) (-3939.489) (-3949.117) [-3934.956] -- 0:02:42 279500 -- [-3935.200] (-3944.384) (-3938.396) (-3939.247) * [-3938.517] (-3940.241) (-3945.805) (-3941.625) -- 0:02:42 280000 -- [-3940.984] (-3941.782) (-3934.068) (-3937.594) * (-3942.036) (-3936.835) [-3942.019] (-3943.692) -- 0:02:42 Average standard deviation of split frequencies: 0.000000 280500 -- [-3934.549] (-3937.900) (-3939.688) (-3942.853) * (-3938.756) [-3938.163] (-3942.879) (-3938.812) -- 0:02:44 281000 -- (-3938.486) (-3939.081) [-3937.123] (-3940.411) * (-3940.572) (-3937.789) (-3937.847) [-3939.337] -- 0:02:43 281500 -- (-3935.875) (-3937.034) (-3938.870) [-3942.387] * (-3944.142) (-3942.197) [-3940.856] (-3935.318) -- 0:02:43 282000 -- (-3938.279) (-3934.737) [-3932.154] (-3943.725) * [-3939.298] (-3939.494) (-3939.864) (-3934.803) -- 0:02:42 282500 -- (-3935.137) (-3940.421) [-3937.984] (-3940.311) * (-3946.092) (-3946.378) (-3941.295) [-3931.989] -- 0:02:42 283000 -- (-3938.362) (-3938.140) (-3939.949) [-3932.238] * [-3932.503] (-3940.219) (-3938.745) (-3937.211) -- 0:02:42 283500 -- [-3934.194] (-3939.924) (-3938.379) (-3937.764) * (-3937.104) (-3941.250) [-3940.976] (-3936.055) -- 0:02:41 284000 -- (-3936.731) (-3942.490) (-3938.829) [-3937.319] * [-3939.143] (-3936.666) (-3937.663) (-3935.093) -- 0:02:41 284500 -- (-3938.308) (-3937.091) (-3940.199) [-3935.387] * [-3936.527] (-3934.816) (-3934.462) (-3939.707) -- 0:02:40 285000 -- (-3936.315) (-3943.007) (-3943.362) [-3937.521] * (-3939.375) (-3934.925) [-3934.383] (-3935.206) -- 0:02:43 Average standard deviation of split frequencies: 0.000000 285500 -- (-3941.970) [-3937.425] (-3939.825) (-3940.092) * [-3935.687] (-3934.731) (-3933.590) (-3942.861) -- 0:02:42 286000 -- [-3935.229] (-3939.033) (-3941.803) (-3941.639) * [-3932.010] (-3936.239) (-3937.687) (-3948.440) -- 0:02:42 286500 -- [-3932.091] (-3944.282) (-3948.411) (-3934.340) * (-3934.765) [-3941.069] (-3942.031) (-3942.063) -- 0:02:41 287000 -- [-3935.362] (-3934.838) (-3942.642) (-3940.019) * (-3940.112) [-3936.467] (-3936.571) (-3944.157) -- 0:02:41 287500 -- (-3943.690) (-3936.599) (-3945.925) [-3933.055] * (-3936.815) (-3941.345) [-3936.831] (-3933.482) -- 0:02:41 288000 -- (-3944.530) (-3937.864) [-3940.159] (-3937.463) * (-3937.554) [-3941.008] (-3935.662) (-3937.731) -- 0:02:40 288500 -- [-3936.894] (-3946.608) (-3931.820) (-3930.762) * (-3939.357) [-3936.444] (-3938.320) (-3936.435) -- 0:02:40 289000 -- (-3938.078) [-3936.075] (-3933.808) (-3939.789) * [-3935.223] (-3935.194) (-3937.673) (-3936.401) -- 0:02:39 289500 -- (-3937.910) (-3937.831) [-3931.411] (-3938.710) * (-3938.529) [-3939.566] (-3935.758) (-3934.684) -- 0:02:41 290000 -- (-3939.941) [-3934.737] (-3938.538) (-3945.564) * (-3935.041) (-3942.424) (-3935.887) [-3935.938] -- 0:02:41 Average standard deviation of split frequencies: 0.000000 290500 -- (-3930.765) [-3936.770] (-3936.992) (-3938.138) * (-3941.589) [-3938.915] (-3937.208) (-3937.620) -- 0:02:41 291000 -- (-3942.702) (-3937.374) [-3934.256] (-3933.258) * (-3937.329) [-3940.710] (-3942.844) (-3936.537) -- 0:02:40 291500 -- [-3939.743] (-3939.178) (-3937.764) (-3934.506) * (-3938.087) (-3939.774) [-3940.108] (-3940.743) -- 0:02:40 292000 -- [-3937.362] (-3943.763) (-3936.360) (-3933.933) * (-3934.150) [-3932.726] (-3934.865) (-3946.459) -- 0:02:40 292500 -- [-3935.408] (-3939.432) (-3934.419) (-3934.904) * [-3938.362] (-3938.711) (-3940.699) (-3947.315) -- 0:02:39 293000 -- [-3935.201] (-3939.347) (-3933.073) (-3938.902) * (-3948.380) [-3938.757] (-3936.001) (-3937.669) -- 0:02:39 293500 -- (-3945.504) [-3949.386] (-3940.876) (-3937.643) * (-3940.494) (-3940.284) (-3946.706) [-3938.177] -- 0:02:38 294000 -- [-3949.564] (-3946.387) (-3940.765) (-3934.664) * [-3941.787] (-3940.484) (-3939.271) (-3940.976) -- 0:02:40 294500 -- (-3938.648) (-3947.048) (-3944.988) [-3934.541] * (-3938.245) (-3942.393) [-3940.615] (-3934.893) -- 0:02:40 295000 -- [-3938.528] (-3939.149) (-3937.684) (-3937.092) * (-3941.996) (-3937.855) [-3937.508] (-3935.965) -- 0:02:40 Average standard deviation of split frequencies: 0.000000 295500 -- (-3940.780) (-3941.407) [-3935.641] (-3946.029) * (-3946.039) (-3941.622) [-3939.308] (-3939.129) -- 0:02:39 296000 -- (-3936.951) (-3938.524) (-3940.027) [-3940.952] * (-3944.258) (-3937.429) (-3940.337) [-3940.825] -- 0:02:39 296500 -- [-3939.972] (-3941.240) (-3941.942) (-3935.553) * [-3941.864] (-3934.021) (-3939.859) (-3941.545) -- 0:02:38 297000 -- (-3936.763) (-3940.304) [-3941.726] (-3941.906) * [-3939.054] (-3938.835) (-3948.204) (-3941.760) -- 0:02:38 297500 -- [-3935.286] (-3943.992) (-3939.741) (-3939.762) * [-3936.316] (-3938.250) (-3939.505) (-3937.559) -- 0:02:38 298000 -- [-3937.103] (-3940.112) (-3951.025) (-3942.756) * (-3943.493) (-3941.334) (-3940.637) [-3941.463] -- 0:02:37 298500 -- [-3936.777] (-3936.816) (-3939.273) (-3939.416) * [-3943.253] (-3943.587) (-3943.792) (-3937.838) -- 0:02:39 299000 -- (-3935.738) (-3939.666) (-3934.791) [-3940.630] * (-3939.757) [-3941.289] (-3937.224) (-3944.275) -- 0:02:39 299500 -- (-3941.065) (-3936.272) (-3936.510) [-3938.330] * (-3935.433) (-3941.907) [-3938.787] (-3935.531) -- 0:02:39 300000 -- (-3935.046) (-3938.230) (-3935.253) [-3939.435] * [-3934.138] (-3935.025) (-3937.555) (-3941.962) -- 0:02:38 Average standard deviation of split frequencies: 0.000000 300500 -- [-3932.977] (-3937.166) (-3936.280) (-3939.160) * [-3937.008] (-3936.334) (-3938.532) (-3936.042) -- 0:02:38 301000 -- (-3942.693) (-3933.338) (-3934.004) [-3935.411] * [-3940.788] (-3940.203) (-3936.622) (-3942.289) -- 0:02:37 301500 -- (-3938.115) (-3938.287) [-3936.088] (-3945.469) * (-3938.964) (-3932.644) [-3935.942] (-3939.730) -- 0:02:37 302000 -- (-3934.961) (-3933.730) (-3936.660) [-3940.663] * (-3939.178) [-3940.261] (-3936.033) (-3940.139) -- 0:02:37 302500 -- (-3935.439) [-3933.747] (-3937.751) (-3945.544) * (-3937.489) [-3938.808] (-3940.121) (-3941.074) -- 0:02:36 303000 -- (-3931.986) (-3940.114) (-3945.030) [-3944.599] * (-3943.096) (-3939.949) [-3939.464] (-3934.599) -- 0:02:38 303500 -- [-3932.167] (-3937.491) (-3941.609) (-3939.604) * (-3937.665) (-3942.606) [-3941.408] (-3935.827) -- 0:02:38 304000 -- (-3935.941) [-3940.003] (-3940.555) (-3941.754) * (-3943.820) [-3938.984] (-3937.991) (-3937.024) -- 0:02:37 304500 -- (-3940.404) (-3938.574) [-3943.615] (-3941.481) * (-3937.151) (-3936.429) [-3932.820] (-3937.698) -- 0:02:37 305000 -- [-3935.650] (-3941.880) (-3935.189) (-3936.510) * (-3935.309) [-3935.344] (-3935.043) (-3940.859) -- 0:02:37 Average standard deviation of split frequencies: 0.000000 305500 -- (-3939.848) (-3943.812) [-3937.400] (-3935.934) * [-3933.834] (-3934.561) (-3934.640) (-3943.018) -- 0:02:36 306000 -- (-3936.800) (-3937.492) [-3941.044] (-3944.490) * [-3938.790] (-3946.067) (-3939.830) (-3943.394) -- 0:02:36 306500 -- (-3940.962) [-3939.531] (-3936.765) (-3944.548) * [-3941.508] (-3939.804) (-3936.016) (-3947.978) -- 0:02:36 307000 -- (-3944.222) (-3940.888) (-3942.415) [-3936.279] * (-3943.220) (-3938.843) [-3937.828] (-3946.099) -- 0:02:35 307500 -- (-3940.342) [-3937.220] (-3937.714) (-3945.455) * (-3935.016) [-3934.177] (-3937.326) (-3947.023) -- 0:02:37 308000 -- (-3940.470) [-3935.070] (-3940.415) (-3937.098) * [-3934.249] (-3936.300) (-3936.391) (-3945.238) -- 0:02:37 308500 -- (-3934.651) (-3938.740) (-3946.753) [-3941.042] * (-3938.649) (-3945.464) [-3935.237] (-3941.973) -- 0:02:36 309000 -- (-3939.150) [-3932.530] (-3939.591) (-3937.093) * [-3941.592] (-3934.892) (-3940.746) (-3944.390) -- 0:02:36 309500 -- [-3937.440] (-3934.533) (-3939.997) (-3938.946) * (-3946.716) (-3933.264) (-3940.075) [-3936.929] -- 0:02:36 310000 -- (-3932.996) (-3938.393) (-3937.862) [-3939.286] * (-3943.705) (-3940.270) (-3935.036) [-3932.329] -- 0:02:35 Average standard deviation of split frequencies: 0.000000 310500 -- (-3937.506) (-3944.034) [-3935.578] (-3941.148) * (-3937.874) (-3934.233) (-3940.248) [-3936.423] -- 0:02:35 311000 -- (-3940.078) [-3940.143] (-3936.208) (-3937.725) * (-3945.428) (-3944.007) (-3937.884) [-3938.748] -- 0:02:37 311500 -- (-3943.940) (-3940.097) [-3941.796] (-3937.821) * (-3943.739) [-3935.114] (-3937.229) (-3937.098) -- 0:02:36 312000 -- (-3936.955) (-3937.290) [-3940.346] (-3951.865) * [-3939.210] (-3933.780) (-3941.847) (-3944.861) -- 0:02:36 312500 -- (-3942.890) (-3937.730) (-3939.736) [-3940.106] * [-3938.169] (-3935.636) (-3938.889) (-3941.109) -- 0:02:36 313000 -- (-3938.579) [-3939.990] (-3941.722) (-3940.337) * (-3937.558) (-3940.529) (-3938.935) [-3937.499] -- 0:02:35 313500 -- [-3935.571] (-3938.863) (-3937.497) (-3938.853) * (-3940.168) [-3940.655] (-3937.288) (-3939.664) -- 0:02:35 314000 -- [-3939.481] (-3942.164) (-3933.950) (-3934.255) * [-3941.540] (-3940.447) (-3938.956) (-3935.869) -- 0:02:35 314500 -- (-3939.004) (-3939.030) [-3936.506] (-3934.659) * (-3942.712) (-3942.138) [-3935.966] (-3941.268) -- 0:02:34 315000 -- (-3938.752) [-3948.390] (-3937.822) (-3935.900) * (-3938.380) (-3943.258) [-3933.598] (-3933.903) -- 0:02:36 Average standard deviation of split frequencies: 0.000000 315500 -- [-3941.645] (-3936.242) (-3941.731) (-3940.820) * (-3936.099) (-3938.235) [-3938.980] (-3934.946) -- 0:02:36 316000 -- [-3941.424] (-3944.412) (-3940.317) (-3942.881) * (-3939.029) [-3941.228] (-3938.356) (-3939.048) -- 0:02:35 316500 -- (-3933.454) (-3936.266) [-3939.167] (-3937.302) * (-3939.127) (-3940.802) [-3936.662] (-3939.746) -- 0:02:35 317000 -- (-3933.378) [-3932.917] (-3942.019) (-3935.242) * (-3937.702) [-3932.504] (-3940.153) (-3938.118) -- 0:02:35 317500 -- [-3933.803] (-3940.064) (-3940.340) (-3943.330) * (-3944.166) (-3940.401) (-3940.998) [-3941.762] -- 0:02:34 318000 -- (-3934.330) (-3945.003) (-3946.626) [-3938.068] * (-3942.052) (-3940.179) [-3937.311] (-3939.908) -- 0:02:34 318500 -- (-3937.136) [-3937.760] (-3940.546) (-3946.016) * (-3937.605) (-3951.003) [-3933.326] (-3942.844) -- 0:02:34 319000 -- (-3933.713) (-3943.260) [-3935.482] (-3940.469) * (-3937.242) (-3941.166) [-3936.538] (-3935.101) -- 0:02:33 319500 -- (-3944.995) (-3939.478) [-3938.322] (-3942.872) * (-3935.498) (-3936.355) (-3934.218) [-3936.168] -- 0:02:35 320000 -- (-3939.971) (-3933.016) [-3939.445] (-3938.476) * (-3938.162) (-3937.929) (-3943.917) [-3935.174] -- 0:02:35 Average standard deviation of split frequencies: 0.000000 320500 -- (-3937.820) (-3938.774) (-3941.678) [-3939.649] * [-3939.629] (-3947.745) (-3943.287) (-3935.014) -- 0:02:34 321000 -- (-3941.366) [-3934.516] (-3936.345) (-3938.284) * [-3937.929] (-3942.825) (-3935.555) (-3943.746) -- 0:02:34 321500 -- (-3935.193) (-3942.670) [-3938.772] (-3944.216) * (-3937.793) (-3938.898) (-3938.131) [-3937.865] -- 0:02:34 322000 -- (-3938.351) (-3941.976) (-3940.808) [-3933.889] * (-3934.349) (-3941.516) [-3939.656] (-3936.443) -- 0:02:33 322500 -- [-3937.618] (-3939.973) (-3939.798) (-3936.913) * [-3936.042] (-3939.847) (-3940.258) (-3939.762) -- 0:02:33 323000 -- (-3935.517) [-3937.104] (-3935.720) (-3940.649) * (-3935.759) (-3936.075) [-3936.295] (-3939.561) -- 0:02:33 323500 -- [-3935.354] (-3945.970) (-3937.156) (-3934.543) * (-3938.202) (-3933.639) [-3940.331] (-3941.422) -- 0:02:32 324000 -- (-3936.672) (-3938.299) (-3943.069) [-3938.541] * [-3934.928] (-3936.299) (-3939.865) (-3936.494) -- 0:02:34 324500 -- [-3934.248] (-3935.611) (-3937.256) (-3937.823) * (-3937.583) [-3938.226] (-3940.342) (-3939.905) -- 0:02:34 325000 -- (-3939.245) [-3944.453] (-3936.314) (-3938.768) * (-3940.667) (-3935.081) (-3936.780) [-3938.545] -- 0:02:33 Average standard deviation of split frequencies: 0.000000 325500 -- (-3940.059) (-3939.772) (-3934.775) [-3939.139] * [-3942.374] (-3939.613) (-3939.899) (-3934.855) -- 0:02:33 326000 -- (-3939.472) [-3943.902] (-3938.156) (-3939.987) * (-3940.565) (-3937.648) (-3938.048) [-3936.519] -- 0:02:32 326500 -- (-3946.714) [-3941.480] (-3932.060) (-3934.109) * (-3938.799) (-3935.444) [-3943.566] (-3946.624) -- 0:02:32 327000 -- (-3940.594) (-3942.851) [-3936.315] (-3934.927) * (-3939.356) [-3940.681] (-3937.631) (-3940.610) -- 0:02:32 327500 -- (-3934.504) (-3932.990) (-3939.871) [-3940.892] * (-3937.973) (-3938.860) [-3935.067] (-3937.519) -- 0:02:31 328000 -- (-3938.604) [-3944.774] (-3944.343) (-3938.623) * (-3937.565) (-3935.188) (-3932.616) [-3938.582] -- 0:02:31 328500 -- [-3938.175] (-3934.857) (-3943.608) (-3942.001) * (-3937.118) (-3943.856) (-3936.763) [-3940.455] -- 0:02:33 329000 -- [-3939.146] (-3935.521) (-3936.264) (-3940.326) * (-3935.075) (-3942.979) (-3939.522) [-3935.722] -- 0:02:32 329500 -- (-3939.249) (-3940.062) (-3937.654) [-3939.496] * (-3934.179) [-3939.871] (-3936.229) (-3934.603) -- 0:02:32 330000 -- [-3937.097] (-3937.172) (-3942.435) (-3947.702) * [-3937.067] (-3937.262) (-3938.877) (-3942.368) -- 0:02:32 Average standard deviation of split frequencies: 0.000000 330500 -- [-3937.234] (-3939.153) (-3943.644) (-3935.890) * (-3938.470) [-3935.858] (-3939.948) (-3942.330) -- 0:02:31 331000 -- (-3939.701) [-3941.128] (-3937.290) (-3939.062) * (-3939.887) [-3936.809] (-3939.332) (-3939.918) -- 0:02:31 331500 -- [-3932.772] (-3934.834) (-3938.107) (-3933.858) * (-3935.824) [-3939.294] (-3941.726) (-3939.174) -- 0:02:31 332000 -- (-3934.756) (-3942.614) [-3939.521] (-3935.674) * (-3937.704) (-3940.535) [-3939.826] (-3937.995) -- 0:02:30 332500 -- (-3933.474) (-3936.693) [-3933.764] (-3936.707) * (-3942.716) (-3938.545) (-3934.734) [-3941.406] -- 0:02:30 333000 -- [-3931.420] (-3944.429) (-3947.391) (-3936.466) * (-3940.105) (-3939.600) (-3941.459) [-3938.877] -- 0:02:32 333500 -- (-3949.430) (-3938.651) (-3943.777) [-3936.358] * (-3940.108) [-3938.886] (-3937.179) (-3938.168) -- 0:02:31 334000 -- (-3938.811) (-3937.751) (-3939.800) [-3936.146] * (-3938.021) (-3943.046) [-3941.357] (-3935.567) -- 0:02:31 334500 -- [-3938.334] (-3935.282) (-3939.150) (-3942.882) * [-3933.781] (-3939.655) (-3939.594) (-3943.071) -- 0:02:31 335000 -- (-3936.570) [-3937.429] (-3940.798) (-3938.409) * [-3936.078] (-3937.860) (-3934.605) (-3934.387) -- 0:02:30 Average standard deviation of split frequencies: 0.000000 335500 -- (-3940.864) (-3945.553) (-3935.012) [-3939.804] * (-3941.217) [-3938.636] (-3942.977) (-3933.194) -- 0:02:30 336000 -- [-3940.511] (-3942.470) (-3936.552) (-3939.845) * (-3939.307) (-3942.042) [-3943.268] (-3939.841) -- 0:02:30 336500 -- [-3936.337] (-3938.360) (-3941.614) (-3942.287) * (-3936.262) (-3946.270) (-3939.288) [-3936.063] -- 0:02:29 337000 -- [-3939.062] (-3937.811) (-3938.830) (-3935.767) * [-3934.377] (-3935.684) (-3945.975) (-3942.060) -- 0:02:29 337500 -- (-3937.131) (-3932.870) [-3938.825] (-3943.374) * (-3941.643) [-3934.496] (-3938.966) (-3942.417) -- 0:02:31 338000 -- (-3943.045) (-3943.187) [-3937.335] (-3938.926) * (-3940.697) (-3934.717) [-3938.121] (-3935.897) -- 0:02:30 338500 -- [-3945.063] (-3940.547) (-3937.962) (-3942.589) * (-3935.381) (-3935.661) [-3933.152] (-3941.002) -- 0:02:30 339000 -- (-3936.319) (-3943.602) [-3939.003] (-3939.918) * (-3940.856) (-3934.960) [-3934.124] (-3937.634) -- 0:02:30 339500 -- (-3935.228) (-3940.318) (-3937.200) [-3939.977] * (-3935.833) (-3935.749) (-3942.467) [-3932.583] -- 0:02:29 340000 -- (-3935.046) (-3933.043) [-3936.339] (-3951.115) * (-3936.417) (-3940.928) (-3937.167) [-3941.990] -- 0:02:29 Average standard deviation of split frequencies: 0.000000 340500 -- (-3935.622) (-3942.897) [-3938.539] (-3937.506) * (-3938.087) [-3941.801] (-3940.877) (-3935.710) -- 0:02:29 341000 -- [-3940.421] (-3936.688) (-3936.257) (-3946.577) * [-3933.743] (-3942.839) (-3940.184) (-3938.059) -- 0:02:28 341500 -- [-3945.057] (-3938.961) (-3938.073) (-3946.201) * (-3939.730) [-3936.463] (-3939.746) (-3941.581) -- 0:02:30 342000 -- [-3947.779] (-3940.649) (-3937.513) (-3943.556) * (-3939.980) [-3943.678] (-3935.321) (-3935.350) -- 0:02:30 342500 -- (-3946.702) [-3936.996] (-3938.927) (-3943.126) * (-3937.245) (-3943.267) [-3932.676] (-3934.071) -- 0:02:29 343000 -- (-3939.327) (-3939.987) [-3947.413] (-3939.501) * (-3939.806) (-3935.587) [-3933.880] (-3936.457) -- 0:02:29 343500 -- (-3940.102) (-3938.706) (-3935.268) [-3939.033] * (-3936.398) [-3937.294] (-3938.726) (-3939.113) -- 0:02:29 344000 -- (-3938.095) [-3940.811] (-3937.387) (-3938.051) * (-3938.072) (-3934.911) (-3940.299) [-3937.340] -- 0:02:28 344500 -- (-3932.839) (-3938.575) (-3938.861) [-3943.137] * [-3936.656] (-3935.002) (-3938.844) (-3937.078) -- 0:02:28 345000 -- (-3939.365) (-3942.372) (-3939.462) [-3933.452] * [-3937.905] (-3937.634) (-3940.104) (-3944.451) -- 0:02:28 Average standard deviation of split frequencies: 0.000000 345500 -- [-3937.884] (-3938.695) (-3940.172) (-3932.246) * (-3935.859) [-3934.630] (-3940.287) (-3934.490) -- 0:02:27 346000 -- [-3937.329] (-3938.253) (-3936.658) (-3938.050) * (-3933.332) (-3941.524) [-3939.891] (-3936.504) -- 0:02:29 346500 -- (-3949.263) (-3940.120) (-3938.168) [-3940.389] * (-3935.343) (-3944.882) (-3940.249) [-3935.770] -- 0:02:28 347000 -- (-3940.493) [-3936.427] (-3936.640) (-3939.980) * (-3939.017) (-3937.828) [-3942.777] (-3943.594) -- 0:02:28 347500 -- (-3939.510) (-3939.720) [-3937.084] (-3938.492) * (-3938.396) (-3943.516) [-3938.836] (-3937.296) -- 0:02:28 348000 -- (-3944.167) [-3933.777] (-3937.469) (-3946.923) * [-3937.373] (-3936.660) (-3943.005) (-3939.450) -- 0:02:28 348500 -- (-3941.153) (-3937.214) [-3949.197] (-3933.399) * (-3936.226) (-3941.346) (-3937.110) [-3935.245] -- 0:02:27 349000 -- (-3935.074) (-3941.184) (-3949.187) [-3935.864] * (-3939.584) (-3942.544) [-3935.742] (-3932.113) -- 0:02:27 349500 -- (-3934.280) (-3941.732) [-3937.400] (-3936.258) * (-3941.469) (-3937.186) [-3937.266] (-3934.909) -- 0:02:27 350000 -- [-3933.764] (-3941.171) (-3944.649) (-3936.026) * (-3938.503) (-3948.292) [-3936.721] (-3933.691) -- 0:02:26 Average standard deviation of split frequencies: 0.000000 350500 -- (-3940.931) [-3941.644] (-3940.418) (-3935.759) * (-3940.814) (-3941.789) (-3943.414) [-3936.692] -- 0:02:28 351000 -- (-3937.972) (-3935.810) [-3944.790] (-3940.638) * [-3935.408] (-3933.394) (-3941.480) (-3939.147) -- 0:02:27 351500 -- (-3934.533) (-3935.029) [-3940.828] (-3942.571) * (-3939.074) (-3944.392) [-3943.066] (-3941.159) -- 0:02:27 352000 -- (-3935.959) (-3938.690) (-3934.935) [-3938.252] * (-3943.139) (-3941.753) [-3941.681] (-3945.662) -- 0:02:27 352500 -- [-3938.228] (-3939.593) (-3935.835) (-3933.468) * [-3938.581] (-3934.898) (-3940.315) (-3939.785) -- 0:02:26 353000 -- (-3936.107) [-3935.076] (-3936.502) (-3937.391) * [-3935.032] (-3935.693) (-3937.816) (-3941.574) -- 0:02:26 353500 -- (-3937.021) (-3934.763) (-3936.232) [-3930.651] * (-3936.147) [-3941.303] (-3933.922) (-3939.379) -- 0:02:26 354000 -- (-3939.988) [-3937.458] (-3939.639) (-3938.160) * (-3940.104) (-3936.850) (-3931.262) [-3939.627] -- 0:02:25 354500 -- [-3944.816] (-3940.978) (-3945.922) (-3938.384) * (-3938.965) [-3937.153] (-3938.167) (-3936.731) -- 0:02:25 355000 -- [-3934.058] (-3942.117) (-3933.169) (-3936.448) * (-3933.031) [-3935.657] (-3939.606) (-3936.048) -- 0:02:27 Average standard deviation of split frequencies: 0.000000 355500 -- (-3935.218) (-3937.462) (-3936.562) [-3942.045] * [-3935.933] (-3947.315) (-3937.236) (-3941.086) -- 0:02:26 356000 -- [-3941.294] (-3943.997) (-3946.155) (-3937.694) * [-3935.208] (-3941.498) (-3934.508) (-3939.070) -- 0:02:26 356500 -- [-3935.570] (-3937.485) (-3944.524) (-3938.570) * (-3938.269) [-3943.230] (-3940.136) (-3942.559) -- 0:02:26 357000 -- (-3939.831) [-3934.760] (-3945.567) (-3938.438) * (-3941.476) (-3943.727) [-3935.040] (-3939.489) -- 0:02:25 357500 -- [-3941.142] (-3932.929) (-3940.824) (-3936.144) * (-3942.455) (-3942.716) (-3940.093) [-3931.717] -- 0:02:25 358000 -- (-3940.598) (-3942.379) [-3933.804] (-3938.947) * (-3938.033) [-3938.494] (-3936.106) (-3934.448) -- 0:02:25 358500 -- [-3937.601] (-3940.599) (-3933.438) (-3936.108) * [-3938.553] (-3939.565) (-3936.366) (-3937.375) -- 0:02:24 359000 -- (-3937.818) (-3946.059) [-3932.273] (-3939.571) * (-3940.423) [-3933.729] (-3932.959) (-3937.172) -- 0:02:24 359500 -- (-3938.833) (-3943.020) (-3941.454) [-3935.909] * [-3946.857] (-3944.786) (-3931.983) (-3940.492) -- 0:02:26 360000 -- (-3942.524) (-3931.527) [-3935.087] (-3934.758) * [-3937.690] (-3939.931) (-3938.301) (-3938.303) -- 0:02:25 Average standard deviation of split frequencies: 0.000000 360500 -- (-3939.395) [-3940.669] (-3937.745) (-3939.108) * (-3941.414) [-3936.566] (-3940.843) (-3942.861) -- 0:02:25 361000 -- [-3935.533] (-3937.808) (-3940.124) (-3938.140) * (-3944.849) [-3937.822] (-3936.995) (-3943.335) -- 0:02:25 361500 -- (-3945.096) (-3938.741) (-3935.664) [-3938.393] * (-3941.059) (-3935.677) [-3938.415] (-3938.881) -- 0:02:24 362000 -- (-3939.322) [-3936.760] (-3939.789) (-3939.821) * [-3935.246] (-3936.289) (-3935.922) (-3938.877) -- 0:02:24 362500 -- (-3946.909) [-3932.574] (-3941.333) (-3935.415) * (-3934.180) (-3934.499) [-3942.695] (-3936.476) -- 0:02:24 363000 -- (-3935.496) (-3939.503) [-3940.649] (-3941.604) * (-3934.034) (-3936.947) (-3932.818) [-3940.992] -- 0:02:23 363500 -- (-3939.150) (-3936.567) [-3942.327] (-3944.543) * (-3932.814) [-3943.520] (-3943.056) (-3933.417) -- 0:02:23 364000 -- (-3942.737) (-3938.746) (-3948.928) [-3943.263] * [-3939.466] (-3938.059) (-3935.617) (-3938.442) -- 0:02:25 364500 -- (-3932.783) (-3939.308) [-3937.282] (-3944.945) * (-3935.998) (-3936.783) (-3945.176) [-3936.884] -- 0:02:24 365000 -- [-3938.142] (-3935.689) (-3942.538) (-3941.524) * [-3944.509] (-3944.141) (-3945.206) (-3937.708) -- 0:02:24 Average standard deviation of split frequencies: 0.000000 365500 -- (-3942.381) (-3939.943) (-3936.831) [-3939.147] * (-3937.473) [-3935.418] (-3934.477) (-3938.521) -- 0:02:24 366000 -- [-3941.581] (-3939.605) (-3940.485) (-3941.111) * (-3937.751) (-3934.079) (-3934.863) [-3940.996] -- 0:02:23 366500 -- (-3934.521) (-3932.428) (-3937.085) [-3943.611] * [-3940.519] (-3936.560) (-3938.707) (-3939.184) -- 0:02:23 367000 -- [-3939.509] (-3935.967) (-3935.464) (-3935.506) * (-3940.879) [-3937.705] (-3935.874) (-3937.104) -- 0:02:23 367500 -- (-3939.189) [-3934.253] (-3946.909) (-3936.982) * (-3942.720) (-3938.872) [-3937.480] (-3934.388) -- 0:02:22 368000 -- [-3935.566] (-3940.782) (-3937.178) (-3935.946) * (-3947.132) (-3937.095) (-3938.197) [-3937.876] -- 0:02:24 368500 -- (-3934.171) (-3936.938) (-3939.522) [-3935.797] * (-3938.191) [-3938.047] (-3936.424) (-3934.284) -- 0:02:23 369000 -- (-3934.903) (-3941.746) [-3942.163] (-3937.575) * (-3937.184) (-3935.174) [-3937.694] (-3943.112) -- 0:02:23 369500 -- (-3937.576) [-3938.549] (-3943.949) (-3939.325) * (-3940.984) (-3941.166) [-3933.858] (-3941.843) -- 0:02:23 370000 -- (-3939.954) [-3937.212] (-3938.336) (-3937.699) * (-3936.033) (-3943.156) (-3940.604) [-3938.163] -- 0:02:23 Average standard deviation of split frequencies: 0.000000 370500 -- [-3939.719] (-3933.266) (-3943.701) (-3939.820) * (-3939.945) [-3936.847] (-3939.261) (-3942.040) -- 0:02:22 371000 -- (-3938.634) [-3937.674] (-3940.864) (-3938.084) * (-3935.999) (-3938.671) [-3935.383] (-3938.159) -- 0:02:22 371500 -- (-3938.211) (-3931.523) (-3934.992) [-3937.658] * (-3937.698) [-3939.239] (-3935.623) (-3935.247) -- 0:02:22 372000 -- [-3941.218] (-3937.835) (-3939.070) (-3941.487) * [-3936.212] (-3945.502) (-3935.504) (-3934.605) -- 0:02:21 372500 -- (-3936.253) [-3938.398] (-3934.611) (-3937.628) * (-3936.673) (-3944.054) [-3937.991] (-3937.144) -- 0:02:23 373000 -- (-3942.952) (-3938.842) [-3932.887] (-3940.264) * (-3943.699) (-3941.417) [-3936.769] (-3940.238) -- 0:02:22 373500 -- (-3946.380) [-3935.067] (-3944.658) (-3932.420) * (-3938.417) (-3936.809) (-3934.861) [-3933.539] -- 0:02:22 374000 -- [-3937.165] (-3937.756) (-3935.369) (-3943.925) * (-3939.514) (-3940.911) [-3933.821] (-3940.622) -- 0:02:22 374500 -- (-3940.256) (-3936.183) (-3941.338) [-3935.206] * (-3936.245) (-3939.779) (-3942.480) [-3941.232] -- 0:02:21 375000 -- [-3934.947] (-3939.449) (-3944.097) (-3935.831) * (-3934.469) [-3938.709] (-3936.963) (-3937.901) -- 0:02:21 Average standard deviation of split frequencies: 0.000000 375500 -- (-3947.182) [-3941.507] (-3935.056) (-3937.872) * (-3944.433) [-3940.171] (-3940.153) (-3937.946) -- 0:02:21 376000 -- (-3940.154) [-3942.925] (-3942.899) (-3938.144) * (-3940.240) (-3935.608) [-3937.594] (-3941.793) -- 0:02:21 376500 -- [-3938.913] (-3940.469) (-3937.473) (-3942.522) * (-3935.031) (-3942.925) (-3936.213) [-3936.334] -- 0:02:20 377000 -- (-3937.835) (-3937.277) [-3936.960] (-3947.492) * (-3940.524) (-3935.269) (-3938.140) [-3936.189] -- 0:02:22 377500 -- (-3939.971) (-3937.302) [-3936.868] (-3947.703) * (-3939.151) (-3944.710) [-3936.545] (-3934.161) -- 0:02:21 378000 -- (-3940.586) (-3937.650) [-3938.157] (-3945.226) * (-3938.055) (-3939.340) (-3941.129) [-3939.922] -- 0:02:21 378500 -- (-3939.465) (-3936.557) [-3934.968] (-3939.766) * (-3939.951) (-3937.444) (-3935.340) [-3934.307] -- 0:02:21 379000 -- (-3932.652) (-3937.508) [-3937.357] (-3951.771) * [-3941.725] (-3935.137) (-3936.091) (-3938.826) -- 0:02:20 379500 -- (-3939.046) (-3943.147) [-3937.165] (-3938.333) * (-3942.721) (-3933.056) [-3940.612] (-3933.656) -- 0:02:20 380000 -- (-3939.184) [-3943.385] (-3945.693) (-3939.922) * (-3943.125) (-3934.803) (-3944.323) [-3943.566] -- 0:02:20 Average standard deviation of split frequencies: 0.000000 380500 -- (-3937.625) [-3937.155] (-3934.878) (-3937.269) * (-3940.577) [-3937.551] (-3934.172) (-3940.938) -- 0:02:20 381000 -- (-3942.756) (-3936.559) [-3939.379] (-3941.637) * (-3945.440) (-3941.439) (-3937.032) [-3938.445] -- 0:02:19 381500 -- (-3941.531) (-3938.991) [-3937.271] (-3937.508) * (-3942.723) (-3938.971) [-3938.438] (-3941.176) -- 0:02:21 382000 -- [-3939.471] (-3941.054) (-3947.730) (-3940.551) * (-3947.470) [-3934.768] (-3940.627) (-3939.703) -- 0:02:20 382500 -- (-3934.748) (-3938.614) (-3936.452) [-3937.187] * (-3937.325) [-3942.373] (-3938.646) (-3936.646) -- 0:02:20 383000 -- (-3939.252) (-3936.419) [-3941.969] (-3934.897) * [-3936.618] (-3937.124) (-3934.322) (-3938.472) -- 0:02:20 383500 -- (-3941.727) [-3937.703] (-3942.164) (-3939.974) * (-3940.742) (-3933.409) (-3936.996) [-3936.495] -- 0:02:19 384000 -- (-3942.497) (-3936.492) [-3942.063] (-3940.087) * (-3938.121) [-3940.257] (-3937.837) (-3937.812) -- 0:02:19 384500 -- (-3936.578) [-3937.939] (-3941.257) (-3936.517) * [-3936.482] (-3940.880) (-3936.962) (-3941.184) -- 0:02:19 385000 -- [-3936.543] (-3940.797) (-3937.160) (-3942.701) * [-3931.785] (-3939.792) (-3939.618) (-3939.912) -- 0:02:18 Average standard deviation of split frequencies: 0.000000 385500 -- (-3938.691) (-3939.803) (-3942.018) [-3937.995] * [-3936.300] (-3938.931) (-3940.854) (-3936.982) -- 0:02:18 386000 -- [-3942.728] (-3938.895) (-3935.724) (-3940.853) * [-3933.997] (-3937.621) (-3934.551) (-3933.716) -- 0:02:19 386500 -- (-3938.625) (-3938.062) (-3940.670) [-3945.203] * [-3936.211] (-3945.432) (-3941.125) (-3934.261) -- 0:02:19 387000 -- (-3939.320) (-3937.665) (-3946.360) [-3935.595] * (-3935.367) (-3938.671) (-3938.093) [-3934.724] -- 0:02:19 387500 -- (-3937.728) (-3941.591) [-3942.828] (-3931.900) * (-3941.010) [-3936.283] (-3939.303) (-3940.014) -- 0:02:19 388000 -- (-3939.192) (-3935.644) (-3939.677) [-3935.268] * [-3937.168] (-3936.142) (-3939.374) (-3939.355) -- 0:02:18 388500 -- [-3935.914] (-3938.900) (-3938.352) (-3936.420) * (-3945.676) (-3941.071) [-3939.645] (-3940.515) -- 0:02:18 389000 -- (-3941.197) (-3941.170) [-3936.445] (-3937.864) * (-3936.823) [-3936.853] (-3934.546) (-3942.946) -- 0:02:18 389500 -- (-3942.822) [-3934.292] (-3936.689) (-3934.847) * [-3938.118] (-3938.683) (-3943.091) (-3941.811) -- 0:02:17 390000 -- (-3938.775) (-3934.351) [-3937.098] (-3934.847) * (-3934.705) [-3941.853] (-3935.712) (-3947.627) -- 0:02:17 Average standard deviation of split frequencies: 0.000000 390500 -- (-3935.684) (-3935.146) (-3935.854) [-3942.843] * [-3937.359] (-3936.297) (-3935.217) (-3940.794) -- 0:02:18 391000 -- (-3945.232) [-3933.358] (-3937.875) (-3939.303) * [-3934.923] (-3939.451) (-3941.480) (-3945.639) -- 0:02:18 391500 -- (-3940.723) [-3935.979] (-3937.722) (-3943.151) * (-3939.528) (-3932.507) (-3937.857) [-3938.131] -- 0:02:18 392000 -- (-3939.297) (-3942.547) [-3937.220] (-3941.935) * (-3935.903) (-3935.709) (-3940.406) [-3938.187] -- 0:02:18 392500 -- (-3938.854) (-3942.282) (-3957.414) [-3939.207] * (-3936.691) (-3936.354) (-3942.890) [-3937.090] -- 0:02:17 393000 -- (-3936.441) [-3939.958] (-3941.952) (-3944.124) * [-3936.017] (-3936.667) (-3938.066) (-3939.542) -- 0:02:17 393500 -- (-3939.989) (-3938.872) (-3936.756) [-3938.138] * (-3945.963) [-3932.897] (-3933.158) (-3940.789) -- 0:02:17 394000 -- (-3938.327) [-3937.266] (-3939.286) (-3944.485) * (-3945.794) (-3938.834) (-3936.458) [-3942.084] -- 0:02:16 394500 -- (-3940.276) (-3939.735) [-3941.962] (-3935.682) * (-3941.981) (-3944.827) (-3938.183) [-3939.039] -- 0:02:16 395000 -- (-3948.856) [-3937.481] (-3940.671) (-3937.033) * (-3943.700) (-3943.241) (-3939.594) [-3940.626] -- 0:02:17 Average standard deviation of split frequencies: 0.000000 395500 -- [-3940.037] (-3936.701) (-3935.541) (-3939.308) * [-3935.417] (-3931.926) (-3939.459) (-3947.371) -- 0:02:17 396000 -- (-3938.300) [-3939.104] (-3945.294) (-3936.448) * [-3934.860] (-3940.592) (-3941.354) (-3942.065) -- 0:02:17 396500 -- (-3941.948) (-3943.595) [-3939.382] (-3937.759) * (-3935.742) (-3939.729) [-3936.270] (-3936.152) -- 0:02:16 397000 -- (-3945.922) [-3942.553] (-3938.006) (-3936.312) * (-3945.230) (-3945.685) [-3936.610] (-3941.798) -- 0:02:16 397500 -- (-3938.772) (-3937.131) [-3947.999] (-3937.201) * [-3941.811] (-3945.280) (-3941.368) (-3938.537) -- 0:02:16 398000 -- (-3938.733) (-3939.257) (-3940.877) [-3937.226] * (-3939.665) [-3940.197] (-3938.675) (-3940.901) -- 0:02:16 398500 -- (-3941.765) (-3934.525) [-3937.931] (-3940.085) * (-3939.791) (-3942.193) (-3937.695) [-3934.786] -- 0:02:15 399000 -- [-3940.650] (-3939.409) (-3934.762) (-3937.751) * [-3939.003] (-3937.272) (-3941.742) (-3930.783) -- 0:02:17 399500 -- (-3934.204) (-3946.829) (-3936.276) [-3938.145] * (-3938.666) (-3937.586) (-3936.898) [-3932.928] -- 0:02:16 400000 -- (-3939.977) (-3940.062) [-3937.845] (-3938.335) * (-3944.404) (-3939.202) [-3940.830] (-3936.235) -- 0:02:16 Average standard deviation of split frequencies: 0.000000 400500 -- (-3932.281) (-3935.829) (-3942.818) [-3936.962] * (-3936.618) (-3937.677) (-3941.740) [-3937.076] -- 0:02:16 401000 -- (-3941.500) (-3941.298) [-3943.611] (-3940.564) * [-3939.628] (-3942.847) (-3937.518) (-3940.769) -- 0:02:15 401500 -- (-3944.513) [-3943.844] (-3939.396) (-3931.697) * [-3936.495] (-3936.980) (-3935.514) (-3940.056) -- 0:02:15 402000 -- (-3939.108) [-3939.414] (-3940.849) (-3936.976) * (-3937.257) [-3937.140] (-3941.901) (-3939.523) -- 0:02:15 402500 -- [-3940.209] (-3938.065) (-3937.175) (-3935.177) * (-3936.613) [-3938.542] (-3944.552) (-3935.658) -- 0:02:15 403000 -- (-3936.691) (-3938.538) (-3934.095) [-3934.437] * (-3935.949) (-3937.950) (-3946.546) [-3938.451] -- 0:02:14 403500 -- (-3936.261) (-3938.323) (-3939.021) [-3935.380] * (-3937.042) (-3936.865) (-3944.375) [-3940.942] -- 0:02:16 404000 -- (-3937.410) [-3943.869] (-3939.213) (-3938.924) * [-3939.593] (-3934.534) (-3942.308) (-3941.941) -- 0:02:15 404500 -- (-3945.354) [-3937.703] (-3938.910) (-3942.993) * (-3941.727) (-3935.057) (-3945.542) [-3936.942] -- 0:02:15 405000 -- [-3933.727] (-3939.739) (-3936.599) (-3935.527) * (-3944.805) (-3933.329) (-3938.959) [-3939.663] -- 0:02:15 Average standard deviation of split frequencies: 0.000000 405500 -- (-3935.767) (-3942.114) [-3938.017] (-3937.875) * [-3947.098] (-3934.121) (-3940.676) (-3937.811) -- 0:02:14 406000 -- (-3939.195) (-3936.367) [-3936.341] (-3935.192) * [-3937.493] (-3936.195) (-3934.850) (-3939.499) -- 0:02:14 406500 -- [-3946.622] (-3946.200) (-3937.203) (-3936.025) * (-3937.138) (-3938.068) (-3938.171) [-3946.028] -- 0:02:14 407000 -- [-3936.167] (-3937.972) (-3937.663) (-3932.978) * (-3938.639) [-3941.959] (-3941.565) (-3946.682) -- 0:02:14 407500 -- [-3936.503] (-3942.531) (-3938.045) (-3936.064) * (-3937.246) [-3937.326] (-3935.796) (-3941.609) -- 0:02:13 408000 -- [-3935.559] (-3940.142) (-3938.441) (-3935.953) * (-3938.171) (-3942.232) (-3941.489) [-3937.274] -- 0:02:14 408500 -- (-3937.621) (-3938.389) (-3938.129) [-3938.299] * (-3939.658) (-3934.890) (-3943.465) [-3932.910] -- 0:02:14 409000 -- (-3937.511) [-3938.083] (-3935.980) (-3935.377) * (-3932.349) (-3941.095) (-3937.850) [-3939.288] -- 0:02:14 409500 -- (-3932.758) [-3942.255] (-3938.735) (-3943.467) * (-3937.907) (-3934.078) (-3938.163) [-3933.374] -- 0:02:14 410000 -- [-3940.231] (-3935.890) (-3940.637) (-3938.544) * (-3937.752) (-3936.399) [-3936.013] (-3937.664) -- 0:02:13 Average standard deviation of split frequencies: 0.000000 410500 -- [-3940.809] (-3938.098) (-3936.578) (-3934.854) * (-3936.487) [-3934.775] (-3938.349) (-3945.064) -- 0:02:13 411000 -- [-3939.666] (-3940.301) (-3945.118) (-3934.571) * (-3939.607) [-3936.796] (-3936.831) (-3946.117) -- 0:02:13 411500 -- (-3937.580) (-3944.070) (-3944.998) [-3934.161] * (-3937.246) (-3935.272) [-3946.335] (-3933.964) -- 0:02:13 412000 -- (-3935.851) (-3934.747) (-3944.352) [-3941.103] * (-3934.529) [-3933.741] (-3941.193) (-3936.316) -- 0:02:12 412500 -- (-3937.681) (-3941.258) [-3936.333] (-3939.223) * (-3938.830) (-3942.385) (-3935.971) [-3931.963] -- 0:02:13 413000 -- [-3938.421] (-3938.153) (-3948.613) (-3940.395) * [-3940.092] (-3941.539) (-3939.128) (-3939.176) -- 0:02:13 413500 -- [-3939.951] (-3940.543) (-3939.476) (-3941.556) * (-3933.858) (-3940.978) (-3936.394) [-3932.820] -- 0:02:13 414000 -- (-3934.874) [-3935.064] (-3942.509) (-3942.652) * [-3937.128] (-3941.075) (-3943.539) (-3938.828) -- 0:02:13 414500 -- (-3943.528) (-3935.468) [-3937.834] (-3935.368) * (-3933.881) (-3936.197) (-3938.866) [-3937.339] -- 0:02:12 415000 -- (-3936.679) (-3935.882) [-3939.065] (-3938.671) * (-3933.161) [-3935.494] (-3937.951) (-3941.794) -- 0:02:12 Average standard deviation of split frequencies: 0.000000 415500 -- (-3932.990) (-3937.606) (-3939.438) [-3935.800] * [-3941.679] (-3936.269) (-3937.101) (-3935.953) -- 0:02:12 416000 -- (-3942.939) (-3937.096) [-3933.244] (-3936.251) * [-3944.941] (-3943.084) (-3936.562) (-3936.042) -- 0:02:11 416500 -- (-3941.315) (-3939.043) (-3942.632) [-3934.105] * (-3941.831) (-3947.573) [-3941.424] (-3933.178) -- 0:02:11 417000 -- [-3941.877] (-3937.339) (-3933.546) (-3941.003) * [-3936.988] (-3938.496) (-3940.350) (-3944.546) -- 0:02:12 417500 -- (-3944.920) (-3934.901) (-3935.837) [-3942.929] * (-3937.828) (-3939.014) [-3940.777] (-3938.570) -- 0:02:12 418000 -- (-3937.086) (-3939.014) [-3938.565] (-3943.456) * (-3948.156) (-3935.194) (-3939.206) [-3935.178] -- 0:02:12 418500 -- (-3936.102) (-3941.147) (-3937.108) [-3933.136] * [-3935.207] (-3937.229) (-3933.952) (-3936.285) -- 0:02:12 419000 -- [-3933.930] (-3936.017) (-3937.718) (-3936.944) * (-3934.642) (-3940.362) [-3944.905] (-3939.678) -- 0:02:11 419500 -- (-3941.700) (-3941.521) [-3932.114] (-3934.686) * (-3940.686) (-3940.537) [-3937.200] (-3941.092) -- 0:02:11 420000 -- (-3935.121) (-3938.734) [-3936.939] (-3934.126) * (-3934.922) (-3936.142) (-3937.967) [-3938.193] -- 0:02:11 Average standard deviation of split frequencies: 0.000000 420500 -- (-3943.932) [-3944.240] (-3942.715) (-3947.945) * (-3934.225) (-3935.734) (-3938.745) [-3936.109] -- 0:02:10 421000 -- [-3940.113] (-3938.921) (-3941.167) (-3938.924) * [-3938.163] (-3937.852) (-3945.948) (-3938.617) -- 0:02:12 421500 -- (-3935.651) (-3943.540) [-3937.404] (-3936.907) * (-3941.637) (-3938.164) (-3942.160) [-3937.490] -- 0:02:11 422000 -- (-3936.657) (-3936.646) [-3939.126] (-3944.615) * [-3940.959] (-3937.377) (-3948.741) (-3942.251) -- 0:02:11 422500 -- (-3938.509) [-3934.450] (-3936.837) (-3942.023) * [-3936.277] (-3936.486) (-3945.862) (-3939.502) -- 0:02:11 423000 -- (-3933.562) (-3938.306) (-3932.550) [-3937.197] * (-3942.845) (-3938.542) (-3941.481) [-3935.475] -- 0:02:10 423500 -- (-3938.203) (-3939.260) [-3937.535] (-3937.104) * (-3936.701) [-3936.921] (-3938.966) (-3938.950) -- 0:02:10 424000 -- (-3934.378) (-3943.798) (-3939.198) [-3937.255] * (-3937.140) (-3939.366) [-3935.511] (-3935.383) -- 0:02:10 424500 -- (-3945.746) (-3940.690) [-3936.909] (-3938.874) * [-3944.624] (-3939.971) (-3939.256) (-3942.630) -- 0:02:10 425000 -- (-3938.280) (-3933.929) [-3936.835] (-3940.133) * [-3937.534] (-3940.642) (-3939.264) (-3935.637) -- 0:02:09 Average standard deviation of split frequencies: 0.000000 425500 -- (-3938.825) (-3940.929) [-3936.126] (-3936.816) * (-3939.187) (-3943.226) (-3938.390) [-3938.477] -- 0:02:10 426000 -- (-3940.507) (-3937.614) [-3934.391] (-3942.751) * (-3940.524) [-3937.040] (-3940.957) (-3939.439) -- 0:02:10 426500 -- [-3939.870] (-3937.974) (-3937.765) (-3933.421) * (-3939.065) [-3940.983] (-3940.688) (-3940.534) -- 0:02:10 427000 -- [-3934.194] (-3931.760) (-3936.753) (-3940.241) * (-3943.772) (-3940.465) (-3937.948) [-3939.917] -- 0:02:10 427500 -- [-3932.735] (-3937.111) (-3938.586) (-3933.993) * (-3939.238) (-3942.644) [-3937.503] (-3951.491) -- 0:02:09 428000 -- [-3936.767] (-3933.629) (-3948.598) (-3938.595) * (-3933.691) [-3938.849] (-3939.170) (-3942.126) -- 0:02:09 428500 -- (-3952.296) (-3934.606) [-3935.397] (-3939.382) * [-3937.441] (-3938.046) (-3944.916) (-3939.644) -- 0:02:09 429000 -- (-3945.451) [-3936.812] (-3941.999) (-3936.917) * (-3945.256) (-3945.164) (-3945.184) [-3940.507] -- 0:02:09 429500 -- (-3937.124) (-3938.967) (-3940.681) [-3938.903] * (-3942.322) [-3937.077] (-3934.765) (-3938.940) -- 0:02:08 430000 -- (-3935.813) [-3935.392] (-3944.155) (-3937.897) * [-3942.673] (-3938.897) (-3935.860) (-3938.473) -- 0:02:09 Average standard deviation of split frequencies: 0.000000 430500 -- (-3943.274) (-3933.606) (-3939.081) [-3939.200] * (-3943.153) (-3933.754) (-3938.989) [-3940.056] -- 0:02:09 431000 -- (-3933.365) (-3943.277) (-3939.173) [-3939.675] * (-3942.272) (-3933.256) (-3934.286) [-3938.251] -- 0:02:09 431500 -- [-3934.937] (-3938.355) (-3942.845) (-3940.520) * [-3937.966] (-3938.496) (-3937.822) (-3935.208) -- 0:02:09 432000 -- [-3937.137] (-3940.198) (-3937.783) (-3941.199) * (-3939.816) [-3935.729] (-3934.809) (-3938.215) -- 0:02:08 432500 -- (-3941.661) [-3936.685] (-3935.990) (-3945.124) * (-3941.268) (-3941.879) [-3935.671] (-3935.678) -- 0:02:08 433000 -- [-3937.032] (-3936.753) (-3939.198) (-3942.065) * [-3936.771] (-3939.068) (-3934.090) (-3939.895) -- 0:02:08 433500 -- (-3937.877) (-3939.025) [-3940.128] (-3941.688) * (-3937.003) (-3944.630) (-3934.947) [-3935.143] -- 0:02:08 434000 -- [-3940.897] (-3940.107) (-3944.018) (-3938.627) * (-3940.085) [-3939.300] (-3938.445) (-3935.097) -- 0:02:07 434500 -- (-3936.024) (-3939.339) [-3937.943] (-3939.870) * [-3939.666] (-3941.784) (-3936.878) (-3933.538) -- 0:02:08 435000 -- [-3934.167] (-3938.304) (-3941.554) (-3939.942) * (-3934.944) (-3942.669) [-3937.546] (-3941.071) -- 0:02:08 Average standard deviation of split frequencies: 0.000000 435500 -- (-3932.598) (-3945.961) [-3934.397] (-3943.472) * (-3942.874) [-3939.536] (-3939.668) (-3937.044) -- 0:02:08 436000 -- (-3946.689) (-3938.518) (-3944.204) [-3938.246] * [-3941.024] (-3949.633) (-3942.008) (-3940.656) -- 0:02:08 436500 -- (-3942.523) (-3936.760) [-3935.302] (-3933.142) * [-3934.785] (-3940.350) (-3943.729) (-3939.508) -- 0:02:07 437000 -- (-3938.232) (-3943.556) [-3937.785] (-3935.526) * (-3944.003) [-3938.027] (-3935.171) (-3941.186) -- 0:02:07 437500 -- [-3939.124] (-3935.033) (-3937.233) (-3936.641) * (-3940.619) [-3937.519] (-3939.589) (-3934.267) -- 0:02:07 438000 -- [-3940.465] (-3948.089) (-3935.622) (-3936.454) * (-3942.236) (-3943.309) [-3936.401] (-3940.230) -- 0:02:07 438500 -- (-3937.757) (-3937.633) [-3942.962] (-3938.690) * (-3936.689) (-3939.918) [-3936.587] (-3935.466) -- 0:02:06 439000 -- (-3941.276) (-3943.985) (-3936.588) [-3935.509] * (-3935.805) [-3935.954] (-3939.792) (-3942.785) -- 0:02:07 439500 -- [-3936.653] (-3935.387) (-3942.369) (-3937.734) * (-3940.964) [-3935.856] (-3933.482) (-3937.076) -- 0:02:07 440000 -- [-3941.390] (-3937.152) (-3936.361) (-3938.039) * (-3938.855) (-3943.445) [-3933.864] (-3934.150) -- 0:02:07 Average standard deviation of split frequencies: 0.000000 440500 -- (-3943.840) (-3937.099) [-3939.915] (-3938.745) * (-3943.887) (-3940.278) (-3938.890) [-3937.693] -- 0:02:07 441000 -- (-3934.796) (-3937.150) [-3936.498] (-3939.538) * [-3939.075] (-3941.285) (-3939.643) (-3938.275) -- 0:02:06 441500 -- (-3936.249) (-3937.169) [-3935.821] (-3937.402) * (-3934.775) [-3932.758] (-3939.022) (-3943.445) -- 0:02:06 442000 -- (-3936.070) (-3940.165) [-3935.806] (-3937.654) * (-3946.077) [-3932.236] (-3941.968) (-3938.108) -- 0:02:06 442500 -- [-3939.183] (-3939.715) (-3938.951) (-3940.742) * [-3932.681] (-3937.485) (-3941.598) (-3937.415) -- 0:02:05 443000 -- (-3950.658) (-3940.864) [-3933.954] (-3936.795) * (-3935.303) (-3938.206) (-3939.667) [-3936.432] -- 0:02:06 443500 -- (-3938.337) [-3941.664] (-3938.053) (-3946.688) * (-3939.833) (-3940.552) (-3940.211) [-3933.425] -- 0:02:06 444000 -- [-3938.842] (-3938.928) (-3936.938) (-3944.089) * (-3943.720) [-3940.292] (-3944.973) (-3939.413) -- 0:02:06 444500 -- (-3936.182) (-3935.854) [-3937.255] (-3941.044) * (-3940.756) (-3939.234) [-3936.268] (-3943.213) -- 0:02:06 445000 -- [-3943.530] (-3937.569) (-3935.717) (-3938.896) * (-3934.212) [-3934.596] (-3935.221) (-3934.785) -- 0:02:05 Average standard deviation of split frequencies: 0.000000 445500 -- [-3934.650] (-3940.480) (-3936.320) (-3937.432) * (-3933.425) (-3946.820) (-3937.909) [-3939.779] -- 0:02:05 446000 -- [-3933.873] (-3942.807) (-3944.538) (-3947.026) * (-3936.024) (-3937.751) [-3936.331] (-3937.486) -- 0:02:05 446500 -- (-3939.415) (-3941.688) [-3937.012] (-3935.485) * (-3942.557) (-3938.106) [-3940.838] (-3937.959) -- 0:02:05 447000 -- (-3940.940) (-3951.772) [-3932.409] (-3938.073) * (-3939.765) (-3942.022) [-3936.299] (-3939.471) -- 0:02:04 447500 -- [-3940.249] (-3937.428) (-3947.951) (-3934.154) * [-3936.538] (-3941.485) (-3941.225) (-3943.791) -- 0:02:05 448000 -- [-3937.983] (-3941.877) (-3937.842) (-3933.132) * (-3937.749) (-3942.121) [-3937.630] (-3936.668) -- 0:02:05 448500 -- (-3935.669) (-3941.668) [-3937.171] (-3933.735) * (-3945.096) (-3942.904) [-3935.363] (-3935.763) -- 0:02:05 449000 -- (-3940.084) [-3937.326] (-3936.317) (-3939.052) * (-3937.860) (-3938.705) [-3940.604] (-3941.385) -- 0:02:05 449500 -- [-3938.962] (-3936.587) (-3936.479) (-3934.808) * (-3939.212) (-3938.747) [-3936.772] (-3935.019) -- 0:02:04 450000 -- (-3943.375) [-3933.665] (-3942.297) (-3937.149) * (-3940.064) [-3936.028] (-3937.665) (-3938.218) -- 0:02:04 Average standard deviation of split frequencies: 0.000000 450500 -- (-3938.835) (-3932.056) [-3939.703] (-3946.967) * [-3937.245] (-3933.480) (-3937.120) (-3938.063) -- 0:02:04 451000 -- [-3941.137] (-3936.819) (-3938.684) (-3945.901) * [-3935.130] (-3943.755) (-3942.198) (-3939.423) -- 0:02:04 451500 -- (-3936.697) (-3937.786) (-3940.724) [-3941.690] * (-3932.979) (-3937.959) (-3939.162) [-3933.171] -- 0:02:03 452000 -- (-3937.430) (-3936.104) (-3941.041) [-3935.095] * (-3943.169) (-3938.703) (-3939.844) [-3937.947] -- 0:02:04 452500 -- (-3935.252) (-3939.970) [-3934.128] (-3939.520) * [-3936.124] (-3944.258) (-3937.108) (-3941.638) -- 0:02:04 453000 -- (-3933.166) (-3937.373) (-3935.082) [-3937.698] * (-3937.482) (-3939.328) (-3934.470) [-3932.541] -- 0:02:04 453500 -- [-3936.672] (-3942.707) (-3940.749) (-3941.006) * (-3935.643) (-3935.974) (-3936.501) [-3936.644] -- 0:02:04 454000 -- (-3933.648) [-3935.669] (-3938.500) (-3936.913) * (-3939.742) (-3937.156) (-3937.524) [-3937.752] -- 0:02:03 454500 -- (-3932.614) (-3943.090) [-3941.431] (-3933.278) * (-3936.996) (-3945.487) [-3940.442] (-3940.392) -- 0:02:03 455000 -- (-3939.569) [-3941.188] (-3942.028) (-3940.574) * [-3938.347] (-3936.836) (-3944.888) (-3938.490) -- 0:02:03 Average standard deviation of split frequencies: 0.000000 455500 -- [-3937.638] (-3936.740) (-3943.113) (-3938.861) * (-3938.288) [-3935.850] (-3941.290) (-3933.616) -- 0:02:03 456000 -- (-3945.316) (-3938.991) (-3940.779) [-3935.641] * (-3941.466) [-3939.647] (-3949.766) (-3938.266) -- 0:02:02 456500 -- (-3941.852) (-3939.242) [-3935.262] (-3938.171) * [-3940.419] (-3937.999) (-3942.503) (-3938.389) -- 0:02:03 457000 -- (-3939.881) (-3933.475) (-3943.057) [-3939.898] * (-3940.660) [-3937.839] (-3936.998) (-3937.490) -- 0:02:03 457500 -- (-3938.038) [-3934.463] (-3938.564) (-3934.831) * (-3946.693) (-3940.809) (-3938.265) [-3936.576] -- 0:02:03 458000 -- (-3939.726) (-3934.871) [-3933.841] (-3935.223) * [-3935.210] (-3936.286) (-3937.252) (-3942.361) -- 0:02:03 458500 -- (-3947.069) (-3940.183) [-3936.645] (-3939.467) * (-3945.375) (-3940.866) (-3939.953) [-3936.558] -- 0:02:02 459000 -- (-3939.624) (-3938.713) (-3940.984) [-3940.559] * [-3938.148] (-3937.164) (-3941.123) (-3937.200) -- 0:02:02 459500 -- (-3937.084) (-3940.415) [-3936.457] (-3943.290) * [-3936.511] (-3939.097) (-3942.874) (-3937.066) -- 0:02:02 460000 -- (-3939.414) (-3935.064) (-3939.273) [-3940.028] * (-3936.613) (-3940.727) (-3941.405) [-3936.639] -- 0:02:02 Average standard deviation of split frequencies: 0.000000 460500 -- (-3942.799) [-3939.696] (-3940.992) (-3934.982) * [-3932.173] (-3941.354) (-3937.939) (-3938.527) -- 0:02:01 461000 -- (-3942.632) (-3944.158) (-3934.337) [-3939.800] * [-3937.210] (-3942.963) (-3941.728) (-3940.453) -- 0:02:02 461500 -- (-3936.870) [-3939.892] (-3938.662) (-3936.865) * (-3937.143) (-3939.969) [-3939.169] (-3940.666) -- 0:02:02 462000 -- (-3941.792) (-3934.925) (-3936.256) [-3937.921] * (-3935.397) (-3941.676) [-3937.532] (-3937.261) -- 0:02:02 462500 -- (-3939.373) (-3941.481) [-3939.846] (-3936.895) * (-3939.798) (-3935.892) [-3947.388] (-3939.886) -- 0:02:02 463000 -- [-3940.472] (-3934.725) (-3940.707) (-3941.977) * (-3932.276) (-3942.855) [-3937.004] (-3935.855) -- 0:02:01 463500 -- (-3939.430) (-3936.558) (-3940.842) [-3942.254] * [-3937.312] (-3942.419) (-3938.240) (-3935.270) -- 0:02:01 464000 -- (-3934.816) [-3935.314] (-3944.788) (-3934.869) * (-3938.756) (-3935.753) (-3941.388) [-3935.532] -- 0:02:01 464500 -- [-3934.970] (-3935.501) (-3944.226) (-3943.062) * (-3937.700) (-3934.924) [-3938.360] (-3936.426) -- 0:02:01 465000 -- [-3937.923] (-3936.644) (-3938.791) (-3934.561) * (-3940.862) (-3934.373) (-3935.691) [-3938.066] -- 0:02:01 Average standard deviation of split frequencies: 0.000000 465500 -- (-3940.001) [-3938.633] (-3935.395) (-3935.045) * (-3940.255) (-3936.892) (-3943.348) [-3942.197] -- 0:02:01 466000 -- (-3934.493) [-3938.046] (-3936.686) (-3937.545) * (-3938.213) (-3937.849) (-3936.462) [-3936.122] -- 0:02:01 466500 -- (-3941.799) [-3939.958] (-3935.040) (-3940.220) * (-3942.673) (-3936.299) (-3934.844) [-3936.747] -- 0:02:01 467000 -- (-3939.231) [-3937.883] (-3937.408) (-3940.266) * (-3940.344) (-3934.571) [-3939.048] (-3932.792) -- 0:02:00 467500 -- (-3934.698) [-3944.287] (-3940.161) (-3949.268) * (-3943.859) (-3943.808) (-3940.833) [-3935.664] -- 0:02:00 468000 -- [-3943.839] (-3944.902) (-3935.711) (-3942.107) * [-3938.997] (-3939.474) (-3939.495) (-3936.270) -- 0:02:00 468500 -- [-3946.249] (-3939.746) (-3941.567) (-3939.283) * [-3937.673] (-3934.492) (-3940.125) (-3940.270) -- 0:02:00 469000 -- (-3938.740) [-3934.870] (-3941.607) (-3938.396) * [-3935.251] (-3942.178) (-3937.950) (-3941.492) -- 0:02:00 469500 -- [-3944.506] (-3941.165) (-3935.134) (-3943.482) * (-3942.775) (-3936.607) [-3937.567] (-3941.715) -- 0:02:00 470000 -- [-3944.212] (-3941.201) (-3937.930) (-3947.715) * [-3932.495] (-3931.925) (-3937.502) (-3942.022) -- 0:02:00 Average standard deviation of split frequencies: 0.000000 470500 -- (-3945.045) (-3940.515) (-3932.196) [-3936.352] * (-3940.320) (-3935.229) [-3936.944] (-3938.972) -- 0:02:00 471000 -- (-3938.870) [-3942.018] (-3937.926) (-3943.308) * (-3937.783) (-3935.744) [-3939.771] (-3940.556) -- 0:02:00 471500 -- (-3936.598) [-3936.272] (-3943.810) (-3942.969) * (-3934.677) (-3935.404) (-3934.349) [-3941.071] -- 0:01:59 472000 -- (-3940.810) (-3941.941) (-3933.850) [-3936.521] * (-3939.751) (-3941.162) (-3939.102) [-3938.054] -- 0:01:59 472500 -- (-3938.155) (-3941.935) [-3934.573] (-3940.776) * (-3940.317) (-3934.582) [-3936.055] (-3940.081) -- 0:01:59 473000 -- (-3940.467) (-3940.692) [-3937.419] (-3939.036) * (-3944.133) (-3940.810) [-3936.792] (-3938.127) -- 0:01:59 473500 -- [-3937.364] (-3934.098) (-3941.747) (-3938.786) * (-3935.318) [-3938.674] (-3936.303) (-3947.044) -- 0:01:58 474000 -- (-3937.572) (-3942.692) (-3948.030) [-3934.338] * (-3935.231) [-3935.583] (-3938.684) (-3946.759) -- 0:01:59 474500 -- (-3937.893) [-3942.918] (-3942.213) (-3942.220) * (-3941.370) [-3938.311] (-3934.289) (-3947.579) -- 0:01:59 475000 -- (-3940.631) [-3934.836] (-3936.007) (-3940.525) * (-3940.435) (-3933.949) (-3937.888) [-3944.040] -- 0:01:59 Average standard deviation of split frequencies: 0.000000 475500 -- (-3940.523) (-3941.898) [-3936.843] (-3936.023) * (-3939.917) (-3937.295) (-3939.347) [-3933.269] -- 0:01:59 476000 -- (-3938.696) [-3935.124] (-3939.325) (-3933.839) * [-3940.900] (-3944.528) (-3936.823) (-3940.967) -- 0:01:58 476500 -- [-3940.189] (-3937.185) (-3936.111) (-3937.758) * (-3937.792) (-3934.471) (-3935.125) [-3937.223] -- 0:01:58 477000 -- (-3940.050) [-3936.094] (-3941.500) (-3942.702) * (-3936.138) [-3935.093] (-3935.813) (-3934.315) -- 0:01:58 477500 -- (-3939.773) (-3939.456) [-3943.154] (-3939.127) * [-3933.222] (-3942.511) (-3936.854) (-3941.179) -- 0:01:58 478000 -- (-3941.232) (-3940.746) (-3942.633) [-3939.555] * (-3941.390) (-3936.851) (-3934.122) [-3938.225] -- 0:01:57 478500 -- [-3940.720] (-3935.048) (-3936.734) (-3950.873) * (-3939.914) [-3937.077] (-3941.869) (-3935.947) -- 0:01:58 479000 -- (-3944.343) (-3940.065) [-3940.478] (-3939.666) * (-3938.906) (-3938.574) (-3937.079) [-3937.356] -- 0:01:58 479500 -- (-3937.181) (-3939.634) (-3937.270) [-3937.734] * [-3943.855] (-3942.226) (-3937.507) (-3938.812) -- 0:01:58 480000 -- [-3942.490] (-3936.815) (-3940.757) (-3936.608) * (-3942.688) [-3939.126] (-3939.925) (-3943.983) -- 0:01:58 Average standard deviation of split frequencies: 0.000000 480500 -- (-3940.006) (-3934.641) (-3936.858) [-3937.069] * (-3936.349) (-3938.026) [-3935.899] (-3937.374) -- 0:01:57 481000 -- (-3943.856) (-3943.278) (-3936.982) [-3934.451] * (-3937.707) [-3938.086] (-3939.036) (-3943.325) -- 0:01:57 481500 -- (-3937.583) [-3935.967] (-3944.811) (-3932.864) * (-3942.593) (-3939.261) (-3940.955) [-3938.628] -- 0:01:57 482000 -- (-3937.724) (-3941.816) [-3939.543] (-3936.352) * (-3936.671) [-3939.808] (-3937.435) (-3940.941) -- 0:01:57 482500 -- (-3934.030) (-3933.023) [-3940.519] (-3939.123) * (-3935.108) (-3945.202) [-3937.389] (-3941.597) -- 0:01:56 483000 -- (-3935.996) [-3934.054] (-3936.141) (-3938.975) * (-3943.587) (-3937.117) [-3936.836] (-3941.150) -- 0:01:57 483500 -- (-3939.317) (-3936.537) (-3938.636) [-3938.462] * (-3938.415) (-3951.796) (-3936.224) [-3935.840] -- 0:01:57 484000 -- [-3937.978] (-3936.981) (-3936.931) (-3937.521) * (-3938.548) [-3939.006] (-3934.632) (-3940.465) -- 0:01:57 484500 -- (-3936.911) [-3941.104] (-3946.790) (-3939.340) * [-3936.476] (-3940.138) (-3940.708) (-3945.045) -- 0:01:57 485000 -- (-3935.389) (-3944.381) (-3937.803) [-3939.326] * (-3934.932) [-3941.784] (-3935.175) (-3937.333) -- 0:01:56 Average standard deviation of split frequencies: 0.000000 485500 -- [-3934.254] (-3938.418) (-3947.454) (-3942.103) * [-3947.228] (-3937.042) (-3935.170) (-3932.949) -- 0:01:56 486000 -- [-3936.876] (-3943.725) (-3942.694) (-3940.528) * (-3945.667) (-3950.276) (-3942.930) [-3937.956] -- 0:01:56 486500 -- (-3935.643) [-3936.376] (-3939.214) (-3940.662) * (-3936.501) (-3949.615) (-3937.350) [-3938.385] -- 0:01:56 487000 -- (-3936.007) (-3940.353) (-3942.352) [-3941.581] * (-3938.884) (-3938.365) (-3940.857) [-3942.064] -- 0:01:55 487500 -- [-3937.452] (-3937.325) (-3937.956) (-3936.805) * [-3940.032] (-3936.413) (-3931.306) (-3941.947) -- 0:01:56 488000 -- (-3944.483) (-3936.300) [-3938.711] (-3937.666) * (-3933.784) (-3943.814) (-3935.594) [-3937.564] -- 0:01:56 488500 -- (-3941.514) (-3941.316) [-3940.694] (-3943.416) * [-3935.071] (-3938.266) (-3935.001) (-3938.305) -- 0:01:56 489000 -- [-3936.493] (-3942.745) (-3942.083) (-3944.574) * (-3933.861) (-3948.278) (-3937.049) [-3938.043] -- 0:01:55 489500 -- [-3943.759] (-3936.862) (-3935.664) (-3938.745) * [-3939.411] (-3940.376) (-3938.840) (-3939.688) -- 0:01:55 490000 -- (-3938.267) (-3934.650) (-3937.796) [-3937.716] * [-3940.221] (-3935.405) (-3935.463) (-3940.184) -- 0:01:55 Average standard deviation of split frequencies: 0.000000 490500 -- (-3937.603) (-3932.226) [-3941.062] (-3936.705) * (-3943.594) (-3941.460) [-3942.717] (-3939.643) -- 0:01:55 491000 -- (-3937.814) [-3930.844] (-3939.875) (-3932.860) * (-3950.587) (-3939.870) (-3938.329) [-3933.680] -- 0:01:55 491500 -- [-3938.911] (-3940.617) (-3940.935) (-3933.615) * [-3938.507] (-3935.679) (-3943.244) (-3938.473) -- 0:01:55 492000 -- (-3934.194) [-3939.430] (-3940.806) (-3934.643) * (-3938.959) (-3939.838) (-3948.617) [-3938.773] -- 0:01:55 492500 -- [-3939.320] (-3938.935) (-3939.368) (-3936.426) * (-3938.128) [-3936.618] (-3934.622) (-3939.584) -- 0:01:55 493000 -- (-3933.426) (-3939.719) [-3937.320] (-3938.471) * [-3935.232] (-3935.342) (-3941.226) (-3932.566) -- 0:01:55 493500 -- (-3935.854) [-3934.997] (-3942.578) (-3943.832) * (-3938.152) (-3940.714) (-3937.620) [-3936.282] -- 0:01:54 494000 -- (-3937.451) (-3937.207) (-3938.925) [-3940.682] * (-3936.310) [-3937.165] (-3945.383) (-3946.201) -- 0:01:54 494500 -- [-3937.048] (-3940.138) (-3938.527) (-3939.587) * (-3938.930) (-3934.465) (-3936.046) [-3943.043] -- 0:01:54 495000 -- [-3933.854] (-3944.074) (-3939.885) (-3937.471) * (-3936.686) [-3939.865] (-3935.860) (-3931.740) -- 0:01:54 Average standard deviation of split frequencies: 0.000000 495500 -- (-3942.439) [-3936.024] (-3943.336) (-3936.760) * [-3933.580] (-3942.739) (-3936.504) (-3936.541) -- 0:01:54 496000 -- [-3933.090] (-3940.926) (-3936.606) (-3939.271) * (-3936.313) [-3937.490] (-3938.352) (-3934.789) -- 0:01:54 496500 -- (-3935.036) [-3946.279] (-3939.703) (-3943.785) * [-3942.105] (-3946.099) (-3947.099) (-3934.381) -- 0:01:54 497000 -- [-3939.398] (-3939.397) (-3943.447) (-3939.312) * [-3932.839] (-3940.572) (-3942.683) (-3943.766) -- 0:01:54 497500 -- (-3941.639) (-3938.073) [-3933.716] (-3935.026) * (-3939.562) (-3939.440) (-3945.775) [-3936.238] -- 0:01:54 498000 -- (-3933.876) (-3937.131) [-3938.278] (-3938.254) * (-3946.150) (-3940.471) (-3940.089) [-3938.018] -- 0:01:53 498500 -- [-3939.932] (-3935.536) (-3938.984) (-3938.915) * (-3938.812) (-3936.872) (-3941.823) [-3942.781] -- 0:01:53 499000 -- [-3934.659] (-3942.468) (-3943.232) (-3939.389) * [-3940.060] (-3947.640) (-3942.403) (-3938.022) -- 0:01:53 499500 -- [-3932.218] (-3943.241) (-3938.206) (-3940.620) * [-3935.698] (-3945.191) (-3940.146) (-3941.094) -- 0:01:53 500000 -- (-3934.483) (-3940.041) (-3934.345) [-3935.357] * [-3937.120] (-3938.699) (-3939.516) (-3934.442) -- 0:01:53 Average standard deviation of split frequencies: 0.000000 500500 -- (-3935.788) (-3939.846) (-3943.434) [-3936.376] * (-3941.087) (-3942.324) (-3936.379) [-3937.687] -- 0:01:53 501000 -- (-3939.974) (-3940.834) [-3940.304] (-3941.247) * (-3936.874) [-3936.270] (-3935.207) (-3935.779) -- 0:01:53 501500 -- (-3936.033) [-3937.243] (-3942.242) (-3936.776) * (-3936.906) (-3939.168) [-3936.459] (-3949.572) -- 0:01:53 502000 -- (-3948.033) [-3940.039] (-3948.552) (-3938.381) * (-3942.879) (-3937.710) (-3937.496) [-3939.590] -- 0:01:53 502500 -- (-3940.141) (-3940.642) (-3940.382) [-3938.405] * (-3943.314) [-3939.244] (-3934.884) (-3935.920) -- 0:01:52 503000 -- [-3936.047] (-3942.707) (-3942.597) (-3933.236) * (-3933.868) (-3936.498) (-3939.772) [-3934.963] -- 0:01:52 503500 -- (-3941.073) (-3941.254) [-3940.177] (-3940.027) * (-3936.295) [-3940.045] (-3943.284) (-3937.137) -- 0:01:52 504000 -- [-3936.515] (-3937.989) (-3941.200) (-3937.140) * (-3944.961) (-3935.433) [-3934.342] (-3945.006) -- 0:01:52 504500 -- (-3932.952) (-3934.630) (-3938.227) [-3934.688] * [-3937.788] (-3936.136) (-3945.477) (-3934.165) -- 0:01:51 505000 -- (-3941.341) (-3940.777) (-3933.603) [-3941.044] * [-3939.744] (-3939.254) (-3947.666) (-3935.578) -- 0:01:52 Average standard deviation of split frequencies: 0.000000 505500 -- (-3935.716) (-3935.051) (-3934.635) [-3941.311] * (-3932.404) (-3934.039) (-3943.171) [-3937.011] -- 0:01:52 506000 -- (-3939.135) (-3938.278) [-3937.130] (-3943.707) * (-3938.030) [-3937.124] (-3941.821) (-3935.261) -- 0:01:52 506500 -- (-3938.089) (-3936.905) [-3938.182] (-3937.812) * (-3942.215) [-3937.706] (-3939.988) (-3936.193) -- 0:01:52 507000 -- [-3937.880] (-3936.314) (-3941.100) (-3942.790) * [-3936.118] (-3946.656) (-3937.994) (-3936.990) -- 0:01:51 507500 -- (-3935.702) [-3943.309] (-3936.363) (-3939.947) * [-3939.489] (-3936.307) (-3936.488) (-3948.570) -- 0:01:51 508000 -- [-3943.597] (-3934.068) (-3940.952) (-3942.516) * [-3940.896] (-3947.781) (-3941.404) (-3936.179) -- 0:01:51 508500 -- (-3938.769) [-3943.216] (-3940.200) (-3950.624) * (-3943.443) (-3934.816) (-3940.021) [-3932.857] -- 0:01:51 509000 -- [-3938.094] (-3942.535) (-3941.030) (-3936.366) * [-3935.413] (-3938.336) (-3935.967) (-3940.055) -- 0:01:50 509500 -- (-3935.888) [-3936.664] (-3933.512) (-3937.972) * (-3942.687) (-3937.504) (-3939.140) [-3939.566] -- 0:01:51 510000 -- (-3942.323) (-3937.284) (-3935.973) [-3933.280] * (-3954.581) (-3936.163) (-3938.895) [-3937.511] -- 0:01:51 Average standard deviation of split frequencies: 0.000000 510500 -- (-3938.271) [-3935.358] (-3937.189) (-3942.657) * (-3941.112) (-3938.570) (-3939.689) [-3933.538] -- 0:01:51 511000 -- [-3937.164] (-3939.641) (-3939.832) (-3940.907) * (-3938.338) (-3942.572) [-3937.724] (-3940.845) -- 0:01:51 511500 -- (-3948.794) (-3941.260) (-3937.831) [-3940.343] * (-3936.154) [-3941.013] (-3934.860) (-3933.740) -- 0:01:50 512000 -- [-3943.092] (-3938.510) (-3944.605) (-3941.962) * (-3935.264) (-3940.004) (-3942.677) [-3933.855] -- 0:01:50 512500 -- (-3940.022) (-3937.856) [-3935.402] (-3940.388) * (-3937.778) (-3938.854) (-3935.463) [-3932.814] -- 0:01:50 513000 -- (-3942.709) (-3938.492) (-3939.097) [-3947.593] * [-3934.104] (-3933.118) (-3939.516) (-3939.528) -- 0:01:50 513500 -- (-3939.533) [-3944.728] (-3936.242) (-3942.133) * (-3941.323) (-3938.900) (-3939.923) [-3936.181] -- 0:01:49 514000 -- [-3932.980] (-3942.993) (-3938.677) (-3947.825) * (-3938.746) [-3934.012] (-3938.815) (-3939.471) -- 0:01:50 514500 -- (-3941.791) [-3943.061] (-3937.577) (-3946.502) * (-3936.375) [-3934.203] (-3946.013) (-3946.188) -- 0:01:50 515000 -- (-3937.765) [-3936.612] (-3943.017) (-3942.844) * [-3938.332] (-3938.001) (-3936.775) (-3939.976) -- 0:01:50 Average standard deviation of split frequencies: 0.000000 515500 -- (-3943.196) (-3937.720) [-3940.618] (-3937.874) * [-3939.094] (-3935.537) (-3938.594) (-3944.637) -- 0:01:49 516000 -- (-3939.114) [-3937.514] (-3942.026) (-3937.019) * [-3937.272] (-3939.332) (-3939.480) (-3942.596) -- 0:01:49 516500 -- (-3941.155) (-3941.763) (-3938.078) [-3941.801] * (-3942.529) [-3939.390] (-3935.617) (-3940.167) -- 0:01:49 517000 -- [-3936.586] (-3936.069) (-3942.266) (-3939.904) * (-3944.743) [-3933.454] (-3935.146) (-3942.440) -- 0:01:49 517500 -- (-3933.309) (-3939.993) (-3942.933) [-3944.293] * (-3938.752) (-3936.929) (-3935.351) [-3934.235] -- 0:01:49 518000 -- (-3937.115) (-3940.824) (-3940.045) [-3939.183] * [-3936.578] (-3936.555) (-3937.440) (-3943.104) -- 0:01:49 518500 -- (-3935.419) (-3939.881) [-3936.067] (-3940.082) * (-3938.015) (-3940.501) [-3938.787] (-3935.649) -- 0:01:49 519000 -- (-3941.538) (-3939.469) [-3937.476] (-3939.072) * [-3936.191] (-3935.361) (-3940.139) (-3938.682) -- 0:01:49 519500 -- (-3941.923) [-3937.181] (-3936.520) (-3934.867) * [-3937.838] (-3939.073) (-3944.060) (-3939.483) -- 0:01:49 520000 -- (-3941.686) (-3935.456) [-3934.568] (-3935.824) * (-3935.309) (-3939.930) [-3941.799] (-3939.165) -- 0:01:48 Average standard deviation of split frequencies: 0.000000 520500 -- (-3946.987) (-3944.328) (-3936.451) [-3937.034] * [-3946.273] (-3950.866) (-3941.315) (-3940.925) -- 0:01:48 521000 -- (-3942.867) (-3939.617) (-3940.962) [-3937.617] * (-3937.572) (-3949.170) [-3933.262] (-3941.757) -- 0:01:48 521500 -- (-3937.740) [-3937.885] (-3940.283) (-3941.652) * (-3937.308) (-3938.854) (-3941.424) [-3941.351] -- 0:01:48 522000 -- (-3944.651) [-3932.930] (-3941.797) (-3939.976) * [-3937.594] (-3939.055) (-3944.404) (-3941.196) -- 0:01:48 522500 -- (-3942.593) (-3938.893) [-3939.714] (-3947.906) * (-3935.568) (-3941.410) (-3943.241) [-3933.998] -- 0:01:48 523000 -- (-3940.455) [-3937.596] (-3939.018) (-3939.831) * (-3938.740) [-3932.734] (-3937.636) (-3938.244) -- 0:01:48 523500 -- (-3937.567) [-3933.623] (-3936.222) (-3941.374) * [-3937.695] (-3940.283) (-3937.654) (-3935.912) -- 0:01:48 524000 -- [-3937.647] (-3936.587) (-3937.860) (-3940.449) * (-3938.468) (-3944.092) [-3942.951] (-3935.643) -- 0:01:48 524500 -- (-3936.445) (-3936.087) [-3934.706] (-3952.380) * (-3936.784) (-3938.744) (-3938.546) [-3936.689] -- 0:01:47 525000 -- (-3952.596) (-3938.361) (-3941.911) [-3939.997] * (-3942.886) (-3937.063) (-3935.775) [-3938.274] -- 0:01:47 Average standard deviation of split frequencies: 0.000000 525500 -- (-3935.785) (-3947.180) (-3939.069) [-3941.684] * [-3937.748] (-3942.608) (-3941.080) (-3935.198) -- 0:01:47 526000 -- (-3940.140) (-3941.111) (-3932.962) [-3939.994] * [-3936.668] (-3943.106) (-3939.715) (-3937.029) -- 0:01:47 526500 -- (-3938.899) [-3934.544] (-3938.311) (-3936.688) * (-3947.076) (-3942.599) (-3937.399) [-3941.006] -- 0:01:47 527000 -- [-3936.729] (-3941.979) (-3940.567) (-3941.146) * (-3937.356) (-3936.284) [-3933.958] (-3939.759) -- 0:01:47 527500 -- [-3939.202] (-3938.130) (-3941.758) (-3940.605) * (-3944.363) (-3949.345) [-3936.911] (-3936.975) -- 0:01:47 528000 -- (-3933.591) (-3936.968) [-3939.607] (-3944.831) * (-3950.178) [-3936.011] (-3939.066) (-3935.192) -- 0:01:47 528500 -- (-3941.085) (-3941.523) (-3939.714) [-3939.461] * (-3940.476) (-3935.240) (-3941.547) [-3937.648] -- 0:01:47 529000 -- (-3939.255) [-3938.716] (-3941.472) (-3938.506) * (-3942.900) [-3934.473] (-3938.161) (-3934.557) -- 0:01:46 529500 -- (-3939.193) (-3939.967) [-3935.509] (-3940.115) * (-3940.250) (-3939.459) (-3941.876) [-3933.624] -- 0:01:46 530000 -- (-3944.645) (-3945.762) (-3942.076) [-3938.987] * (-3950.885) [-3934.152] (-3940.534) (-3937.919) -- 0:01:46 Average standard deviation of split frequencies: 0.000000 530500 -- (-3939.605) (-3951.530) (-3937.720) [-3938.167] * (-3941.808) [-3937.887] (-3941.136) (-3947.783) -- 0:01:46 531000 -- (-3937.336) (-3938.712) [-3940.851] (-3936.568) * (-3935.869) (-3942.031) [-3943.318] (-3946.632) -- 0:01:45 531500 -- (-3935.559) (-3942.860) (-3937.531) [-3939.856] * (-3937.375) [-3937.562] (-3939.359) (-3941.821) -- 0:01:46 532000 -- [-3937.917] (-3939.859) (-3936.917) (-3939.196) * [-3938.905] (-3946.704) (-3945.716) (-3938.376) -- 0:01:46 532500 -- [-3941.260] (-3941.600) (-3938.201) (-3938.315) * (-3943.721) (-3934.115) (-3943.145) [-3936.951] -- 0:01:46 533000 -- (-3937.172) (-3939.751) [-3934.345] (-3937.004) * (-3938.411) [-3939.277] (-3947.868) (-3937.143) -- 0:01:46 533500 -- (-3937.890) (-3935.760) [-3937.771] (-3940.431) * (-3940.066) [-3936.572] (-3944.152) (-3934.044) -- 0:01:45 534000 -- (-3939.120) [-3937.287] (-3941.865) (-3937.522) * (-3945.478) (-3938.930) [-3939.347] (-3937.570) -- 0:01:45 534500 -- (-3937.097) [-3937.511] (-3937.896) (-3937.266) * (-3939.698) (-3939.099) (-3936.500) [-3937.815] -- 0:01:45 535000 -- [-3934.847] (-3936.374) (-3937.105) (-3939.936) * (-3935.950) (-3936.928) (-3944.068) [-3942.268] -- 0:01:45 Average standard deviation of split frequencies: 0.000000 535500 -- (-3935.323) (-3939.837) (-3938.659) [-3939.526] * (-3936.046) (-3937.007) (-3936.325) [-3939.213] -- 0:01:44 536000 -- (-3936.812) (-3938.730) [-3934.253] (-3943.016) * (-3941.573) [-3938.081] (-3941.864) (-3942.309) -- 0:01:45 536500 -- (-3938.013) [-3939.518] (-3937.761) (-3944.736) * (-3938.189) (-3936.182) [-3941.160] (-3942.750) -- 0:01:45 537000 -- [-3937.109] (-3939.611) (-3941.018) (-3943.972) * (-3938.582) (-3937.160) [-3936.988] (-3940.354) -- 0:01:45 537500 -- (-3946.030) (-3946.189) [-3937.555] (-3940.138) * (-3944.532) [-3936.536] (-3938.409) (-3943.657) -- 0:01:44 538000 -- (-3945.530) (-3936.430) (-3940.962) [-3938.700] * (-3944.307) (-3936.807) [-3935.102] (-3936.393) -- 0:01:44 538500 -- (-3947.143) (-3939.434) [-3944.054] (-3947.442) * (-3934.456) (-3946.284) [-3934.582] (-3940.864) -- 0:01:44 539000 -- (-3946.888) [-3936.089] (-3938.636) (-3939.481) * [-3940.882] (-3940.715) (-3944.184) (-3941.909) -- 0:01:44 539500 -- (-3942.523) (-3934.826) (-3939.816) [-3941.329] * (-3937.078) (-3934.738) (-3938.181) [-3942.078] -- 0:01:44 540000 -- (-3943.788) (-3939.329) [-3943.410] (-3935.830) * (-3939.461) (-3938.023) (-3936.860) [-3936.692] -- 0:01:44 Average standard deviation of split frequencies: 0.000000 540500 -- [-3939.052] (-3938.536) (-3941.002) (-3942.553) * (-3941.633) [-3935.520] (-3933.930) (-3939.669) -- 0:01:44 541000 -- (-3938.706) (-3940.876) [-3937.275] (-3939.313) * (-3949.947) (-3941.509) (-3934.565) [-3933.045] -- 0:01:44 541500 -- (-3944.746) [-3941.860] (-3933.216) (-3935.823) * (-3944.411) [-3934.673] (-3939.123) (-3948.941) -- 0:01:44 542000 -- (-3949.120) (-3938.887) [-3938.000] (-3941.233) * [-3939.318] (-3939.865) (-3937.625) (-3944.331) -- 0:01:43 542500 -- [-3931.980] (-3932.568) (-3942.564) (-3938.646) * (-3937.493) (-3936.685) (-3941.423) [-3939.165] -- 0:01:43 543000 -- [-3933.001] (-3941.231) (-3938.538) (-3937.508) * (-3937.186) (-3934.537) [-3943.970] (-3934.171) -- 0:01:43 543500 -- (-3934.217) (-3935.548) (-3948.178) [-3935.828] * (-3941.946) [-3936.407] (-3935.109) (-3933.758) -- 0:01:43 544000 -- (-3943.126) (-3934.819) (-3939.460) [-3937.256] * (-3937.583) [-3940.281] (-3937.394) (-3937.274) -- 0:01:43 544500 -- [-3935.723] (-3934.024) (-3939.234) (-3943.027) * (-3937.270) [-3946.023] (-3939.997) (-3945.506) -- 0:01:43 545000 -- (-3935.589) [-3940.602] (-3937.828) (-3938.637) * (-3944.128) (-3936.963) (-3936.495) [-3939.862] -- 0:01:43 Average standard deviation of split frequencies: 0.000000 545500 -- (-3935.631) (-3940.531) (-3936.557) [-3935.816] * (-3939.599) [-3942.325] (-3937.666) (-3938.441) -- 0:01:43 546000 -- (-3937.202) [-3946.427] (-3937.114) (-3940.754) * (-3934.887) (-3937.730) [-3934.196] (-3937.853) -- 0:01:43 546500 -- (-3939.970) (-3938.557) (-3941.959) [-3937.572] * (-3939.589) (-3942.624) [-3935.052] (-3936.224) -- 0:01:42 547000 -- [-3937.778] (-3938.859) (-3938.075) (-3947.032) * (-3936.458) (-3944.666) [-3937.613] (-3942.071) -- 0:01:42 547500 -- (-3944.190) [-3938.830] (-3934.446) (-3938.925) * (-3937.390) (-3946.927) (-3938.151) [-3937.161] -- 0:01:42 548000 -- (-3938.547) (-3937.602) (-3938.670) [-3940.463] * [-3938.014] (-3940.094) (-3950.291) (-3936.377) -- 0:01:42 548500 -- [-3941.483] (-3939.517) (-3935.998) (-3939.404) * [-3935.755] (-3940.697) (-3937.153) (-3938.075) -- 0:01:42 549000 -- (-3934.863) (-3939.898) [-3937.802] (-3939.012) * (-3936.148) [-3935.445] (-3938.929) (-3944.544) -- 0:01:42 549500 -- (-3938.178) (-3941.294) (-3936.485) [-3934.833] * (-3931.781) (-3936.866) [-3937.549] (-3939.926) -- 0:01:42 550000 -- (-3938.584) (-3937.122) (-3942.368) [-3933.626] * (-3936.825) (-3940.230) (-3938.293) [-3937.491] -- 0:01:42 Average standard deviation of split frequencies: 0.000000 550500 -- (-3935.846) (-3942.001) [-3932.128] (-3937.701) * (-3937.598) (-3936.527) [-3933.246] (-3943.265) -- 0:01:42 551000 -- [-3941.473] (-3940.409) (-3933.600) (-3932.644) * [-3937.316] (-3948.660) (-3932.651) (-3939.453) -- 0:01:41 551500 -- (-3936.142) (-3949.421) (-3941.208) [-3935.149] * (-3938.394) [-3948.415] (-3941.006) (-3943.177) -- 0:01:41 552000 -- (-3942.322) (-3937.363) [-3947.303] (-3938.303) * (-3936.500) (-3946.426) (-3938.150) [-3937.937] -- 0:01:41 552500 -- (-3937.640) (-3949.124) (-3935.240) [-3941.749] * [-3936.995] (-3942.857) (-3941.354) (-3934.632) -- 0:01:41 553000 -- (-3937.374) (-3938.821) [-3937.792] (-3937.168) * (-3941.918) (-3939.924) (-3933.610) [-3933.594] -- 0:01:41 553500 -- [-3935.853] (-3951.028) (-3936.612) (-3941.904) * (-3940.797) (-3935.632) [-3938.556] (-3935.640) -- 0:01:41 554000 -- (-3937.964) [-3939.281] (-3937.014) (-3943.660) * (-3943.151) (-3948.047) [-3943.495] (-3936.152) -- 0:01:41 554500 -- [-3935.909] (-3936.756) (-3936.767) (-3945.464) * [-3940.746] (-3944.302) (-3939.607) (-3941.608) -- 0:01:41 555000 -- (-3932.646) [-3934.258] (-3940.795) (-3938.085) * [-3934.870] (-3941.961) (-3939.344) (-3934.357) -- 0:01:41 Average standard deviation of split frequencies: 0.000000 555500 -- (-3939.320) (-3938.517) [-3938.195] (-3934.837) * (-3940.352) (-3941.238) [-3940.312] (-3942.561) -- 0:01:40 556000 -- (-3941.831) [-3944.365] (-3942.849) (-3937.963) * (-3944.503) [-3941.086] (-3941.866) (-3943.304) -- 0:01:40 556500 -- (-3940.900) [-3941.210] (-3939.820) (-3937.503) * (-3942.234) [-3945.613] (-3942.444) (-3936.916) -- 0:01:40 557000 -- [-3937.474] (-3938.055) (-3940.903) (-3940.530) * (-3948.818) (-3937.024) (-3935.600) [-3938.382] -- 0:01:40 557500 -- (-3937.162) (-3937.647) (-3938.118) [-3937.528] * (-3942.454) [-3942.713] (-3940.493) (-3938.117) -- 0:01:40 558000 -- (-3936.342) (-3938.300) (-3939.147) [-3935.406] * (-3936.139) [-3937.611] (-3938.564) (-3940.990) -- 0:01:40 558500 -- (-3937.318) [-3943.265] (-3940.654) (-3935.009) * [-3937.298] (-3938.108) (-3945.077) (-3936.267) -- 0:01:40 559000 -- (-3938.216) (-3951.239) (-3933.977) [-3937.824] * (-3941.572) (-3939.094) [-3934.603] (-3941.095) -- 0:01:40 559500 -- (-3939.891) (-3938.247) (-3933.334) [-3933.978] * (-3942.545) (-3947.466) (-3937.389) [-3935.801] -- 0:01:39 560000 -- (-3938.899) [-3945.138] (-3937.001) (-3944.265) * [-3940.117] (-3940.080) (-3939.647) (-3938.737) -- 0:01:39 Average standard deviation of split frequencies: 0.000000 560500 -- (-3940.443) (-3942.498) (-3939.244) [-3939.893] * (-3944.015) [-3936.490] (-3932.680) (-3938.086) -- 0:01:39 561000 -- [-3938.391] (-3943.953) (-3944.916) (-3942.639) * (-3945.277) (-3933.779) (-3934.816) [-3936.692] -- 0:01:39 561500 -- (-3937.393) (-3940.361) (-3933.037) [-3939.850] * [-3943.405] (-3938.206) (-3939.074) (-3934.979) -- 0:01:39 562000 -- (-3935.587) (-3934.018) [-3936.800] (-3939.303) * [-3937.186] (-3940.311) (-3948.712) (-3936.624) -- 0:01:39 562500 -- (-3938.922) (-3936.571) (-3935.382) [-3936.168] * (-3943.450) (-3944.619) (-3933.706) [-3937.301] -- 0:01:39 563000 -- (-3933.073) (-3937.154) [-3937.449] (-3935.178) * (-3942.660) (-3942.085) (-3942.556) [-3936.023] -- 0:01:39 563500 -- (-3937.134) (-3935.051) [-3932.709] (-3937.453) * [-3942.486] (-3938.534) (-3936.361) (-3939.719) -- 0:01:39 564000 -- (-3945.526) [-3942.335] (-3937.178) (-3938.287) * (-3945.965) (-3938.946) [-3939.892] (-3936.102) -- 0:01:38 564500 -- (-3935.346) (-3947.942) [-3937.607] (-3945.267) * (-3941.757) (-3939.931) (-3937.700) [-3940.266] -- 0:01:38 565000 -- (-3937.646) [-3938.483] (-3937.329) (-3938.246) * (-3943.705) (-3939.030) (-3939.270) [-3935.866] -- 0:01:38 Average standard deviation of split frequencies: 0.000000 565500 -- (-3935.997) (-3940.305) (-3936.339) [-3943.473] * (-3944.902) (-3938.986) [-3937.442] (-3941.568) -- 0:01:38 566000 -- [-3934.176] (-3943.889) (-3940.101) (-3942.914) * (-3937.953) (-3937.714) [-3937.507] (-3940.136) -- 0:01:38 566500 -- (-3941.601) [-3935.756] (-3936.783) (-3933.818) * (-3936.609) [-3942.716] (-3942.743) (-3937.765) -- 0:01:38 567000 -- [-3934.047] (-3941.861) (-3943.898) (-3939.795) * (-3935.915) [-3936.512] (-3935.513) (-3939.223) -- 0:01:38 567500 -- (-3934.740) (-3939.239) (-3933.897) [-3938.394] * (-3940.166) [-3941.767] (-3935.046) (-3935.954) -- 0:01:38 568000 -- [-3934.800] (-3933.856) (-3937.923) (-3944.706) * [-3940.348] (-3944.802) (-3942.571) (-3940.672) -- 0:01:38 568500 -- (-3936.011) [-3940.124] (-3936.344) (-3941.349) * (-3938.498) (-3936.440) [-3944.946] (-3943.934) -- 0:01:37 569000 -- (-3942.312) (-3941.754) (-3938.641) [-3939.438] * (-3936.198) [-3934.882] (-3937.292) (-3937.491) -- 0:01:37 569500 -- (-3940.016) [-3939.335] (-3937.234) (-3939.025) * (-3939.452) (-3939.218) (-3936.166) [-3938.328] -- 0:01:37 570000 -- (-3943.128) (-3936.966) (-3935.036) [-3946.068] * (-3940.569) (-3939.691) [-3939.646] (-3938.153) -- 0:01:37 Average standard deviation of split frequencies: 0.000000 570500 -- [-3937.928] (-3948.789) (-3941.213) (-3941.696) * (-3940.362) (-3942.367) (-3943.672) [-3940.279] -- 0:01:37 571000 -- (-3937.007) (-3939.244) [-3936.268] (-3937.636) * (-3936.750) (-3938.178) [-3936.256] (-3944.749) -- 0:01:37 571500 -- (-3941.471) [-3943.067] (-3937.025) (-3939.464) * (-3935.953) (-3935.629) [-3934.459] (-3941.459) -- 0:01:37 572000 -- (-3934.706) (-3940.082) (-3939.274) [-3939.575] * [-3943.743] (-3940.031) (-3937.391) (-3945.044) -- 0:01:37 572500 -- [-3935.584] (-3940.615) (-3937.096) (-3936.370) * (-3940.395) [-3943.113] (-3937.596) (-3932.659) -- 0:01:37 573000 -- (-3938.898) (-3951.066) [-3933.815] (-3939.804) * (-3945.801) (-3940.186) [-3939.079] (-3942.687) -- 0:01:36 573500 -- (-3938.744) (-3937.904) [-3935.268] (-3942.731) * (-3947.472) (-3942.227) (-3937.813) [-3942.800] -- 0:01:36 574000 -- (-3935.006) (-3942.084) [-3945.440] (-3934.471) * (-3937.445) (-3935.308) (-3936.763) [-3943.878] -- 0:01:36 574500 -- (-3937.819) [-3940.677] (-3937.326) (-3936.634) * [-3944.674] (-3935.869) (-3938.116) (-3947.867) -- 0:01:36 575000 -- (-3937.433) (-3946.534) [-3938.725] (-3933.808) * [-3933.365] (-3935.979) (-3935.396) (-3944.788) -- 0:01:36 Average standard deviation of split frequencies: 0.000000 575500 -- (-3944.323) (-3945.536) [-3942.782] (-3933.412) * (-3944.772) (-3938.241) [-3942.615] (-3939.370) -- 0:01:36 576000 -- (-3939.311) (-3941.354) (-3939.244) [-3938.708] * (-3944.427) [-3940.414] (-3942.614) (-3936.874) -- 0:01:36 576500 -- (-3937.798) (-3940.920) [-3934.822] (-3938.221) * (-3946.868) (-3933.853) (-3939.387) [-3940.374] -- 0:01:36 577000 -- [-3936.053] (-3937.071) (-3934.828) (-3939.294) * (-3948.635) (-3938.691) [-3932.086] (-3943.082) -- 0:01:36 577500 -- (-3935.402) (-3939.581) [-3939.768] (-3939.496) * (-3950.070) (-3936.600) (-3942.358) [-3946.877] -- 0:01:35 578000 -- (-3935.367) (-3932.779) (-3935.058) [-3936.877] * (-3936.908) [-3939.421] (-3936.200) (-3942.986) -- 0:01:35 578500 -- (-3934.380) [-3937.161] (-3939.840) (-3935.058) * (-3933.797) (-3940.345) (-3938.196) [-3935.064] -- 0:01:35 579000 -- [-3935.801] (-3937.165) (-3945.411) (-3936.336) * [-3932.050] (-3935.876) (-3935.376) (-3941.769) -- 0:01:35 579500 -- [-3936.915] (-3941.271) (-3940.816) (-3944.118) * [-3933.487] (-3941.794) (-3934.893) (-3942.049) -- 0:01:35 580000 -- (-3940.099) [-3939.475] (-3945.851) (-3941.020) * [-3934.848] (-3950.764) (-3934.918) (-3940.355) -- 0:01:35 Average standard deviation of split frequencies: 0.000000 580500 -- (-3937.932) (-3947.066) [-3942.665] (-3942.503) * [-3939.177] (-3941.413) (-3938.326) (-3942.070) -- 0:01:35 581000 -- (-3937.488) [-3932.302] (-3939.942) (-3948.375) * [-3937.982] (-3941.164) (-3938.073) (-3939.961) -- 0:01:35 581500 -- (-3936.620) (-3941.132) (-3937.576) [-3933.587] * [-3937.941] (-3941.443) (-3943.176) (-3937.907) -- 0:01:34 582000 -- (-3936.792) [-3937.186] (-3935.595) (-3935.200) * (-3943.184) [-3938.826] (-3938.371) (-3934.053) -- 0:01:34 582500 -- [-3935.959] (-3937.501) (-3936.466) (-3942.685) * [-3944.268] (-3938.522) (-3939.918) (-3941.767) -- 0:01:34 583000 -- (-3937.484) [-3936.461] (-3934.050) (-3951.528) * [-3939.410] (-3938.835) (-3940.184) (-3941.554) -- 0:01:34 583500 -- (-3937.589) (-3945.685) (-3934.114) [-3939.305] * [-3939.716] (-3936.835) (-3939.171) (-3936.928) -- 0:01:34 584000 -- (-3936.875) [-3944.749] (-3934.965) (-3939.811) * (-3941.525) (-3936.322) [-3938.625] (-3933.447) -- 0:01:34 584500 -- (-3938.517) (-3937.011) [-3935.145] (-3934.991) * (-3947.739) (-3947.211) (-3942.844) [-3939.007] -- 0:01:34 585000 -- (-3940.971) [-3944.455] (-3939.825) (-3935.276) * (-3940.415) (-3936.077) [-3933.577] (-3938.446) -- 0:01:34 Average standard deviation of split frequencies: 0.000000 585500 -- (-3943.465) (-3938.791) [-3939.966] (-3942.195) * [-3938.643] (-3942.583) (-3938.557) (-3934.556) -- 0:01:34 586000 -- (-3933.642) (-3938.255) [-3934.668] (-3937.913) * (-3939.201) [-3937.182] (-3938.684) (-3937.273) -- 0:01:33 586500 -- [-3935.861] (-3933.671) (-3940.419) (-3934.313) * (-3939.920) [-3938.753] (-3939.314) (-3936.528) -- 0:01:33 587000 -- (-3943.448) (-3944.287) [-3943.590] (-3933.643) * (-3934.569) [-3940.184] (-3935.674) (-3936.735) -- 0:01:33 587500 -- (-3941.744) (-3933.647) [-3937.757] (-3942.174) * (-3939.823) (-3943.228) (-3936.431) [-3941.297] -- 0:01:33 588000 -- [-3937.143] (-3939.893) (-3942.279) (-3942.126) * [-3939.577] (-3939.300) (-3942.412) (-3940.321) -- 0:01:33 588500 -- (-3935.183) (-3932.403) (-3938.303) [-3935.666] * (-3936.600) (-3941.366) [-3941.732] (-3939.912) -- 0:01:33 589000 -- (-3939.388) (-3936.475) (-3937.111) [-3935.248] * [-3938.376] (-3935.620) (-3941.408) (-3937.109) -- 0:01:33 589500 -- [-3935.255] (-3943.644) (-3941.241) (-3940.564) * (-3936.170) [-3938.653] (-3936.505) (-3936.401) -- 0:01:33 590000 -- (-3938.270) [-3938.456] (-3942.147) (-3944.472) * (-3941.231) [-3936.726] (-3934.612) (-3936.225) -- 0:01:33 Average standard deviation of split frequencies: 0.000000 590500 -- [-3937.968] (-3935.170) (-3940.389) (-3936.166) * (-3939.909) [-3933.839] (-3935.790) (-3935.412) -- 0:01:32 591000 -- (-3936.782) [-3936.433] (-3945.453) (-3937.013) * (-3937.152) (-3938.859) [-3934.761] (-3943.119) -- 0:01:32 591500 -- (-3937.789) [-3936.048] (-3941.266) (-3939.073) * [-3940.527] (-3937.499) (-3935.047) (-3948.856) -- 0:01:32 592000 -- [-3939.581] (-3934.250) (-3940.780) (-3940.837) * (-3937.010) (-3938.235) (-3945.167) [-3936.942] -- 0:01:32 592500 -- (-3941.362) [-3933.730] (-3946.564) (-3936.212) * (-3940.639) (-3933.090) [-3936.285] (-3933.965) -- 0:01:32 593000 -- (-3936.186) (-3935.258) (-3939.855) [-3942.401] * (-3940.526) (-3939.170) (-3933.361) [-3935.302] -- 0:01:32 593500 -- [-3943.056] (-3943.253) (-3934.659) (-3933.376) * (-3935.898) (-3934.748) [-3938.303] (-3934.294) -- 0:01:32 594000 -- (-3937.799) [-3938.660] (-3941.794) (-3941.955) * (-3935.141) (-3940.007) (-3941.705) [-3934.044] -- 0:01:32 594500 -- [-3941.525] (-3934.054) (-3945.320) (-3938.763) * (-3938.109) [-3940.108] (-3936.362) (-3943.717) -- 0:01:32 595000 -- (-3943.467) (-3936.504) [-3939.389] (-3934.444) * (-3935.511) (-3941.382) (-3936.292) [-3939.242] -- 0:01:31 Average standard deviation of split frequencies: 0.000000 595500 -- [-3940.657] (-3941.700) (-3947.689) (-3938.899) * (-3933.315) [-3942.918] (-3940.509) (-3935.691) -- 0:01:31 596000 -- (-3939.763) (-3938.193) [-3935.639] (-3940.780) * (-3940.072) (-3936.322) [-3934.787] (-3934.335) -- 0:01:31 596500 -- (-3935.292) (-3940.165) [-3934.327] (-3938.292) * (-3931.865) [-3932.019] (-3945.518) (-3932.877) -- 0:01:31 597000 -- (-3935.982) (-3933.597) [-3937.188] (-3948.085) * (-3938.702) (-3936.498) (-3935.858) [-3933.020] -- 0:01:31 597500 -- (-3945.284) [-3938.173] (-3933.435) (-3936.479) * (-3934.300) [-3934.710] (-3934.555) (-3936.121) -- 0:01:31 598000 -- [-3942.046] (-3937.628) (-3934.489) (-3941.854) * (-3940.251) [-3932.951] (-3937.901) (-3936.908) -- 0:01:31 598500 -- (-3937.061) (-3941.740) (-3942.314) [-3935.835] * (-3944.930) (-3939.236) (-3944.485) [-3942.215] -- 0:01:31 599000 -- (-3943.485) (-3948.601) (-3933.262) [-3940.732] * (-3940.434) (-3938.605) (-3939.393) [-3936.494] -- 0:01:31 599500 -- (-3933.273) (-3946.511) (-3937.943) [-3938.253] * (-3935.433) [-3940.796] (-3939.727) (-3942.445) -- 0:01:30 600000 -- (-3940.717) (-3944.537) (-3939.234) [-3933.068] * (-3939.615) (-3934.652) (-3939.744) [-3934.726] -- 0:01:30 Average standard deviation of split frequencies: 0.000000 600500 -- (-3943.262) [-3937.903] (-3936.406) (-3937.780) * (-3945.245) [-3936.949] (-3941.453) (-3944.185) -- 0:01:30 601000 -- (-3938.228) (-3941.882) [-3933.841] (-3936.153) * (-3941.005) (-3940.345) [-3936.823] (-3945.572) -- 0:01:30 601500 -- [-3933.668] (-3941.311) (-3938.692) (-3940.312) * (-3940.550) (-3938.741) [-3937.849] (-3936.704) -- 0:01:30 602000 -- (-3936.366) [-3943.799] (-3939.580) (-3942.507) * (-3938.818) (-3936.975) (-3939.347) [-3936.201] -- 0:01:30 602500 -- (-3942.069) [-3935.688] (-3948.758) (-3938.884) * (-3932.414) (-3935.146) [-3939.111] (-3940.136) -- 0:01:30 603000 -- (-3937.946) [-3936.241] (-3942.239) (-3935.410) * (-3930.730) [-3935.536] (-3941.559) (-3941.433) -- 0:01:30 603500 -- (-3939.054) (-3938.595) [-3938.411] (-3947.262) * [-3935.320] (-3938.727) (-3938.623) (-3943.353) -- 0:01:30 604000 -- (-3938.788) (-3939.359) (-3947.364) [-3936.841] * [-3938.037] (-3943.875) (-3940.156) (-3934.710) -- 0:01:29 604500 -- [-3935.518] (-3937.460) (-3938.713) (-3933.189) * (-3937.737) (-3942.385) (-3936.125) [-3932.044] -- 0:01:29 605000 -- (-3938.772) (-3936.377) [-3934.863] (-3942.702) * (-3941.146) (-3934.113) [-3937.299] (-3937.854) -- 0:01:29 Average standard deviation of split frequencies: 0.000000 605500 -- [-3933.030] (-3939.866) (-3937.269) (-3945.499) * [-3932.169] (-3944.800) (-3944.411) (-3951.463) -- 0:01:29 606000 -- (-3935.353) (-3941.153) [-3944.578] (-3933.929) * (-3939.972) [-3937.384] (-3940.392) (-3935.790) -- 0:01:29 606500 -- [-3940.883] (-3938.672) (-3939.107) (-3932.298) * (-3944.549) (-3938.888) (-3938.388) [-3942.897] -- 0:01:29 607000 -- (-3941.510) [-3939.057] (-3940.015) (-3938.299) * (-3935.546) (-3940.489) (-3947.268) [-3938.725] -- 0:01:29 607500 -- (-3940.898) (-3941.669) (-3937.612) [-3944.274] * (-3938.168) [-3937.712] (-3934.812) (-3935.690) -- 0:01:29 608000 -- (-3934.903) [-3947.975] (-3933.890) (-3934.410) * [-3940.255] (-3945.365) (-3939.045) (-3940.792) -- 0:01:28 608500 -- (-3933.888) (-3937.100) (-3936.079) [-3933.021] * [-3938.083] (-3943.031) (-3939.213) (-3940.429) -- 0:01:28 609000 -- (-3941.677) (-3936.769) (-3936.624) [-3937.604] * (-3933.578) (-3935.981) (-3932.598) [-3938.630] -- 0:01:28 609500 -- (-3935.417) (-3948.832) (-3936.840) [-3936.878] * (-3933.523) [-3940.328] (-3939.326) (-3942.109) -- 0:01:28 610000 -- (-3938.227) (-3947.237) (-3939.545) [-3931.188] * (-3941.159) (-3935.844) (-3940.256) [-3935.748] -- 0:01:28 Average standard deviation of split frequencies: 0.000000 610500 -- (-3936.228) (-3937.461) (-3943.662) [-3932.114] * (-3942.294) (-3941.348) (-3944.499) [-3939.469] -- 0:01:28 611000 -- (-3942.413) (-3940.197) [-3940.361] (-3933.639) * (-3938.278) (-3942.191) (-3934.209) [-3935.643] -- 0:01:28 611500 -- [-3938.346] (-3938.682) (-3939.778) (-3935.493) * (-3938.564) (-3934.106) [-3933.501] (-3937.679) -- 0:01:28 612000 -- (-3937.161) (-3940.484) [-3941.969] (-3941.399) * (-3934.823) (-3937.142) [-3932.423] (-3940.261) -- 0:01:28 612500 -- (-3936.958) [-3944.431] (-3940.411) (-3939.735) * (-3939.546) (-3940.754) [-3936.915] (-3937.628) -- 0:01:27 613000 -- [-3938.466] (-3938.835) (-3941.382) (-3938.033) * [-3938.990] (-3939.559) (-3939.301) (-3937.891) -- 0:01:27 613500 -- (-3938.398) (-3935.990) (-3936.691) [-3936.109] * [-3938.760] (-3939.311) (-3937.506) (-3940.900) -- 0:01:27 614000 -- (-3936.391) (-3934.020) (-3938.875) [-3935.493] * (-3939.847) (-3936.430) (-3938.717) [-3936.790] -- 0:01:27 614500 -- (-3935.431) (-3946.022) (-3938.599) [-3932.897] * (-3942.187) [-3938.637] (-3943.083) (-3933.244) -- 0:01:27 615000 -- (-3947.296) (-3946.043) [-3936.805] (-3940.537) * (-3937.074) (-3949.915) [-3943.101] (-3941.070) -- 0:01:27 Average standard deviation of split frequencies: 0.000000 615500 -- (-3939.713) (-3941.369) (-3941.876) [-3935.019] * (-3941.326) (-3943.711) [-3934.072] (-3942.005) -- 0:01:27 616000 -- [-3936.195] (-3937.686) (-3940.119) (-3938.674) * (-3948.513) [-3938.657] (-3943.545) (-3943.386) -- 0:01:27 616500 -- (-3940.887) [-3933.409] (-3943.674) (-3942.703) * (-3936.917) (-3939.241) [-3940.063] (-3940.134) -- 0:01:27 617000 -- (-3944.612) (-3937.434) [-3942.104] (-3938.265) * (-3937.665) (-3939.217) [-3938.114] (-3938.822) -- 0:01:26 617500 -- (-3940.080) (-3946.547) [-3934.095] (-3941.465) * [-3941.504] (-3938.069) (-3936.029) (-3939.123) -- 0:01:26 618000 -- (-3939.780) (-3939.469) [-3933.738] (-3941.216) * [-3942.137] (-3937.578) (-3939.745) (-3940.563) -- 0:01:26 618500 -- (-3939.213) (-3933.312) (-3935.278) [-3945.061] * (-3940.452) (-3934.169) (-3937.696) [-3942.879] -- 0:01:26 619000 -- (-3945.726) (-3934.493) (-3941.970) [-3937.678] * (-3937.999) [-3940.460] (-3937.427) (-3937.993) -- 0:01:26 619500 -- (-3944.558) (-3935.964) (-3934.706) [-3935.840] * [-3943.307] (-3939.119) (-3942.589) (-3933.139) -- 0:01:26 620000 -- (-3938.782) (-3941.649) [-3937.263] (-3938.426) * (-3939.302) (-3941.311) (-3941.734) [-3935.302] -- 0:01:26 Average standard deviation of split frequencies: 0.000000 620500 -- (-3942.801) (-3939.536) [-3935.516] (-3934.577) * (-3941.230) [-3941.141] (-3941.011) (-3938.136) -- 0:01:26 621000 -- (-3935.392) (-3936.199) [-3936.332] (-3936.076) * [-3940.606] (-3938.709) (-3936.940) (-3939.312) -- 0:01:26 621500 -- [-3942.143] (-3935.767) (-3939.855) (-3937.530) * (-3940.545) [-3934.590] (-3939.331) (-3935.753) -- 0:01:25 622000 -- (-3946.324) (-3941.125) (-3939.309) [-3940.734] * (-3944.445) (-3935.857) (-3948.741) [-3936.767] -- 0:01:25 622500 -- (-3936.307) (-3938.761) [-3937.605] (-3937.882) * (-3942.975) (-3938.410) (-3942.041) [-3931.769] -- 0:01:25 623000 -- (-3936.855) (-3935.224) (-3937.270) [-3939.262] * (-3942.177) [-3939.542] (-3932.702) (-3940.808) -- 0:01:25 623500 -- (-3942.357) [-3940.035] (-3935.448) (-3938.147) * [-3935.777] (-3949.775) (-3936.362) (-3939.631) -- 0:01:25 624000 -- (-3943.362) [-3934.949] (-3940.657) (-3932.707) * (-3944.601) (-3941.125) (-3935.705) [-3939.625] -- 0:01:25 624500 -- (-3940.069) [-3933.616] (-3938.907) (-3939.199) * (-3943.111) (-3938.669) [-3940.744] (-3934.452) -- 0:01:25 625000 -- [-3940.992] (-3935.009) (-3933.927) (-3941.283) * (-3941.876) (-3940.200) [-3931.808] (-3945.423) -- 0:01:25 Average standard deviation of split frequencies: 0.000000 625500 -- (-3939.594) (-3938.835) [-3946.382] (-3932.964) * (-3943.588) (-3937.218) (-3942.601) [-3939.138] -- 0:01:25 626000 -- (-3941.635) (-3940.003) [-3933.635] (-3941.917) * (-3944.226) [-3942.037] (-3938.980) (-3933.356) -- 0:01:24 626500 -- (-3941.029) (-3939.389) [-3938.620] (-3931.737) * [-3935.151] (-3943.238) (-3937.513) (-3944.443) -- 0:01:24 627000 -- [-3936.389] (-3939.075) (-3943.376) (-3939.922) * (-3935.325) [-3941.065] (-3941.837) (-3942.328) -- 0:01:24 627500 -- (-3941.647) (-3934.056) (-3934.488) [-3942.115] * (-3938.703) [-3935.097] (-3940.438) (-3943.452) -- 0:01:24 628000 -- (-3936.328) [-3937.044] (-3931.251) (-3939.579) * (-3941.251) (-3940.052) [-3937.596] (-3944.553) -- 0:01:24 628500 -- [-3940.119] (-3934.066) (-3948.826) (-3942.913) * [-3937.983] (-3933.233) (-3932.941) (-3945.692) -- 0:01:24 629000 -- (-3937.253) [-3936.808] (-3936.172) (-3934.767) * [-3932.938] (-3939.964) (-3938.369) (-3942.820) -- 0:01:24 629500 -- (-3935.785) (-3938.115) [-3931.711] (-3933.754) * (-3941.112) (-3936.336) (-3946.157) [-3938.823] -- 0:01:24 630000 -- (-3940.454) [-3935.580] (-3936.465) (-3943.044) * (-3936.997) [-3934.956] (-3946.744) (-3935.948) -- 0:01:23 Average standard deviation of split frequencies: 0.000000 630500 -- [-3935.325] (-3934.268) (-3941.963) (-3940.935) * (-3940.492) [-3939.031] (-3945.898) (-3934.637) -- 0:01:23 631000 -- (-3938.268) (-3936.024) (-3932.957) [-3941.268] * (-3944.774) (-3941.507) [-3941.402] (-3942.453) -- 0:01:23 631500 -- (-3941.796) (-3934.844) (-3940.593) [-3940.968] * (-3936.683) (-3940.724) (-3937.861) [-3938.101] -- 0:01:23 632000 -- (-3937.705) (-3936.142) [-3941.053] (-3935.865) * [-3936.859] (-3936.580) (-3942.563) (-3938.505) -- 0:01:23 632500 -- (-3936.316) (-3933.659) [-3939.852] (-3934.632) * (-3937.422) [-3945.875] (-3938.235) (-3940.175) -- 0:01:23 633000 -- (-3934.652) (-3939.870) (-3938.228) [-3943.731] * (-3937.895) (-3937.765) [-3939.023] (-3950.355) -- 0:01:23 633500 -- (-3934.610) [-3934.266] (-3940.604) (-3935.743) * (-3934.854) (-3944.610) [-3936.925] (-3947.777) -- 0:01:23 634000 -- (-3935.220) (-3932.757) [-3942.230] (-3936.763) * [-3936.392] (-3941.976) (-3936.108) (-3943.027) -- 0:01:23 634500 -- (-3939.024) [-3940.444] (-3940.163) (-3935.503) * (-3939.305) [-3940.590] (-3935.026) (-3934.038) -- 0:01:22 635000 -- (-3943.126) [-3938.022] (-3933.575) (-3938.082) * [-3939.822] (-3937.149) (-3939.989) (-3940.273) -- 0:01:22 Average standard deviation of split frequencies: 0.000000 635500 -- (-3932.636) (-3940.999) (-3938.865) [-3933.091] * [-3935.937] (-3941.440) (-3941.608) (-3936.155) -- 0:01:22 636000 -- (-3932.460) [-3941.795] (-3935.019) (-3935.283) * [-3939.423] (-3941.343) (-3937.998) (-3935.747) -- 0:01:22 636500 -- [-3933.356] (-3935.589) (-3941.255) (-3940.878) * (-3938.805) (-3944.630) (-3944.858) [-3939.004] -- 0:01:22 637000 -- (-3945.732) (-3936.614) (-3940.467) [-3937.512] * [-3936.485] (-3931.646) (-3941.116) (-3953.140) -- 0:01:22 637500 -- [-3934.121] (-3937.184) (-3937.376) (-3936.517) * [-3936.643] (-3940.416) (-3939.963) (-3953.469) -- 0:01:22 638000 -- (-3934.509) (-3940.676) (-3937.482) [-3932.255] * (-3936.839) (-3939.158) (-3942.763) [-3939.221] -- 0:01:22 638500 -- [-3935.066] (-3935.014) (-3947.116) (-3932.889) * (-3940.228) [-3935.717] (-3937.977) (-3937.588) -- 0:01:22 639000 -- [-3933.872] (-3938.197) (-3938.795) (-3936.048) * (-3949.669) [-3937.452] (-3940.660) (-3935.801) -- 0:01:21 639500 -- [-3935.409] (-3943.181) (-3938.077) (-3934.349) * (-3940.380) (-3935.498) (-3940.244) [-3937.642] -- 0:01:21 640000 -- (-3942.171) [-3943.946] (-3946.367) (-3943.268) * (-3942.871) [-3938.151] (-3937.737) (-3945.271) -- 0:01:21 Average standard deviation of split frequencies: 0.000000 640500 -- (-3937.673) (-3940.157) (-3942.998) [-3940.571] * [-3935.910] (-3938.342) (-3938.054) (-3943.772) -- 0:01:21 641000 -- (-3940.965) [-3937.936] (-3938.096) (-3938.789) * (-3935.388) (-3936.121) [-3936.240] (-3939.386) -- 0:01:21 641500 -- (-3937.169) (-3939.430) [-3937.783] (-3947.875) * [-3945.047] (-3937.003) (-3932.570) (-3941.802) -- 0:01:21 642000 -- [-3940.516] (-3941.584) (-3935.668) (-3943.242) * [-3937.312] (-3937.035) (-3941.764) (-3934.446) -- 0:01:21 642500 -- (-3936.403) (-3941.752) [-3934.835] (-3939.111) * (-3943.150) (-3936.732) (-3938.872) [-3937.835] -- 0:01:21 643000 -- (-3937.241) (-3938.384) (-3936.795) [-3937.683] * (-3937.154) (-3934.497) [-3938.753] (-3934.240) -- 0:01:21 643500 -- (-3949.018) (-3937.847) (-3939.836) [-3940.277] * [-3939.086] (-3938.050) (-3940.776) (-3937.505) -- 0:01:20 644000 -- (-3940.984) [-3937.890] (-3942.309) (-3935.993) * [-3938.771] (-3940.553) (-3936.883) (-3936.790) -- 0:01:20 644500 -- (-3944.915) (-3938.927) [-3943.513] (-3938.901) * (-3940.285) [-3938.113] (-3940.338) (-3947.647) -- 0:01:20 645000 -- [-3940.888] (-3941.080) (-3934.192) (-3939.054) * [-3935.015] (-3933.434) (-3936.206) (-3942.052) -- 0:01:20 Average standard deviation of split frequencies: 0.000000 645500 -- [-3932.971] (-3939.361) (-3938.297) (-3935.568) * (-3933.497) [-3937.063] (-3944.043) (-3944.805) -- 0:01:20 646000 -- (-3942.431) (-3934.088) [-3939.801] (-3934.599) * (-3943.932) [-3934.246] (-3938.817) (-3937.323) -- 0:01:20 646500 -- (-3946.485) (-3933.682) [-3939.150] (-3939.735) * (-3937.785) (-3936.977) [-3935.774] (-3941.631) -- 0:01:20 647000 -- (-3938.962) [-3935.794] (-3947.744) (-3940.431) * (-3943.124) (-3945.390) (-3944.444) [-3934.346] -- 0:01:20 647500 -- [-3936.256] (-3939.393) (-3938.142) (-3938.626) * (-3937.764) (-3944.698) (-3941.440) [-3935.392] -- 0:01:20 648000 -- [-3936.780] (-3936.047) (-3937.029) (-3936.126) * (-3935.065) (-3938.522) (-3938.355) [-3938.385] -- 0:01:19 648500 -- (-3943.199) [-3933.448] (-3947.627) (-3935.714) * (-3938.803) [-3936.276] (-3942.964) (-3940.953) -- 0:01:19 649000 -- [-3943.296] (-3943.670) (-3937.312) (-3945.311) * (-3944.067) [-3937.494] (-3938.559) (-3937.807) -- 0:01:19 649500 -- (-3939.453) (-3943.992) (-3934.318) [-3939.298] * (-3939.173) (-3937.674) (-3942.507) [-3937.752] -- 0:01:19 650000 -- [-3939.658] (-3945.477) (-3937.690) (-3939.389) * (-3944.093) (-3944.132) [-3939.447] (-3945.052) -- 0:01:19 Average standard deviation of split frequencies: 0.000000 650500 -- [-3934.586] (-3940.619) (-3939.800) (-3940.823) * (-3948.733) (-3938.990) [-3940.006] (-3941.147) -- 0:01:19 651000 -- [-3939.126] (-3935.080) (-3944.178) (-3932.905) * (-3934.472) (-3939.888) (-3939.527) [-3932.357] -- 0:01:19 651500 -- (-3943.280) (-3936.727) [-3935.324] (-3937.810) * (-3941.960) [-3937.148] (-3942.487) (-3933.890) -- 0:01:19 652000 -- (-3940.428) (-3932.227) [-3935.283] (-3932.539) * (-3947.574) (-3941.249) [-3936.777] (-3939.798) -- 0:01:18 652500 -- [-3936.244] (-3934.485) (-3939.403) (-3937.991) * [-3941.782] (-3935.155) (-3934.887) (-3944.765) -- 0:01:18 653000 -- (-3936.126) (-3946.327) [-3937.538] (-3939.260) * (-3938.946) (-3939.999) (-3937.862) [-3938.161] -- 0:01:18 653500 -- (-3935.753) [-3941.380] (-3941.852) (-3943.685) * (-3936.752) (-3941.157) (-3939.650) [-3935.816] -- 0:01:18 654000 -- (-3935.210) (-3937.693) [-3934.996] (-3934.773) * [-3937.260] (-3936.785) (-3938.379) (-3945.457) -- 0:01:18 654500 -- (-3933.825) (-3934.978) (-3937.666) [-3943.311] * (-3945.561) (-3937.958) (-3935.875) [-3935.126] -- 0:01:18 655000 -- (-3939.947) [-3935.976] (-3934.285) (-3937.841) * (-3942.272) [-3940.205] (-3936.977) (-3935.779) -- 0:01:18 Average standard deviation of split frequencies: 0.000000 655500 -- [-3941.334] (-3942.111) (-3937.550) (-3941.672) * (-3945.630) (-3947.241) [-3937.576] (-3937.861) -- 0:01:18 656000 -- (-3936.781) (-3945.018) (-3941.532) [-3945.080] * (-3941.064) (-3938.609) (-3938.235) [-3938.845] -- 0:01:18 656500 -- [-3936.472] (-3943.265) (-3936.562) (-3937.638) * (-3942.039) (-3937.070) [-3937.330] (-3941.504) -- 0:01:17 657000 -- [-3940.609] (-3940.131) (-3938.654) (-3937.869) * [-3937.732] (-3935.305) (-3945.994) (-3940.431) -- 0:01:17 657500 -- [-3935.653] (-3945.152) (-3931.903) (-3941.941) * (-3941.184) (-3940.524) (-3937.166) [-3938.871] -- 0:01:17 658000 -- (-3938.840) [-3945.886] (-3940.776) (-3941.195) * (-3941.260) (-3940.687) (-3938.547) [-3937.322] -- 0:01:17 658500 -- (-3937.039) (-3940.672) [-3938.021] (-3944.943) * (-3940.005) (-3938.335) (-3934.519) [-3933.867] -- 0:01:17 659000 -- (-3937.806) [-3938.911] (-3932.864) (-3947.399) * [-3934.454] (-3937.291) (-3944.211) (-3937.880) -- 0:01:17 659500 -- (-3938.418) (-3938.694) [-3939.604] (-3942.064) * (-3940.662) (-3936.517) [-3937.909] (-3938.934) -- 0:01:17 660000 -- (-3936.631) (-3949.006) (-3937.744) [-3943.876] * [-3933.585] (-3942.065) (-3948.050) (-3940.602) -- 0:01:17 Average standard deviation of split frequencies: 0.000000 660500 -- (-3937.492) [-3936.426] (-3933.562) (-3938.408) * (-3945.028) (-3941.079) [-3933.477] (-3939.626) -- 0:01:17 661000 -- (-3940.956) [-3940.232] (-3937.835) (-3941.189) * (-3944.273) (-3937.629) [-3938.511] (-3944.143) -- 0:01:16 661500 -- (-3941.307) [-3939.158] (-3941.365) (-3944.716) * [-3939.702] (-3937.986) (-3938.677) (-3944.132) -- 0:01:16 662000 -- (-3932.979) (-3937.363) (-3935.995) [-3938.686] * (-3941.577) (-3938.622) [-3939.239] (-3942.320) -- 0:01:16 662500 -- (-3940.327) [-3938.606] (-3938.088) (-3935.706) * [-3936.912] (-3938.831) (-3938.448) (-3944.645) -- 0:01:16 663000 -- [-3935.083] (-3935.566) (-3938.510) (-3939.289) * [-3934.647] (-3939.912) (-3938.227) (-3938.115) -- 0:01:16 663500 -- (-3945.196) (-3943.783) [-3939.574] (-3939.472) * (-3936.807) (-3935.032) [-3940.349] (-3933.379) -- 0:01:16 664000 -- (-3938.101) (-3938.066) [-3937.135] (-3942.135) * [-3947.022] (-3938.270) (-3936.966) (-3938.603) -- 0:01:16 664500 -- (-3940.816) [-3938.455] (-3939.468) (-3938.586) * (-3938.166) [-3939.307] (-3938.771) (-3935.460) -- 0:01:16 665000 -- (-3942.401) [-3934.542] (-3936.321) (-3934.587) * [-3936.773] (-3944.486) (-3944.297) (-3938.577) -- 0:01:16 Average standard deviation of split frequencies: 0.000000 665500 -- (-3941.427) [-3936.468] (-3942.366) (-3939.149) * [-3941.009] (-3937.933) (-3938.483) (-3935.267) -- 0:01:15 666000 -- (-3935.689) (-3946.279) (-3946.879) [-3938.320] * (-3942.832) (-3938.983) [-3935.427] (-3938.349) -- 0:01:15 666500 -- [-3937.756] (-3933.786) (-3940.696)