--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Nov 24 16:16:56 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/330/nSyb-PI/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -969.39 -987.45
2 -969.03 -988.25
--------------------------------------
TOTAL -969.19 -987.93
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.695592 0.023976 0.425104 1.001214 0.678674 1196.33 1270.14 1.003
r(A<->C){all} 0.097825 0.001858 0.021265 0.179078 0.092203 525.29 551.58 1.000
r(A<->G){all} 0.085291 0.001196 0.025600 0.155678 0.079259 463.45 631.47 1.000
r(A<->T){all} 0.067149 0.001678 0.002127 0.144203 0.059835 482.75 543.21 1.001
r(C<->G){all} 0.013185 0.000105 0.000015 0.033233 0.010930 1011.43 1073.58 1.004
r(C<->T){all} 0.695144 0.006196 0.540112 0.835992 0.699291 428.59 582.66 1.001
r(G<->T){all} 0.041406 0.000447 0.007015 0.084773 0.038550 765.14 849.37 1.000
pi(A){all} 0.262543 0.000485 0.214116 0.300988 0.261924 1083.16 1096.83 1.001
pi(C){all} 0.248842 0.000410 0.211620 0.291137 0.247969 847.74 1069.80 1.001
pi(G){all} 0.334985 0.000544 0.292332 0.382182 0.334261 1294.93 1383.26 1.001
pi(T){all} 0.153630 0.000282 0.122186 0.188062 0.153169 1077.46 1160.27 1.002
alpha{1,2} 0.099275 0.000701 0.053755 0.156543 0.097082 1175.86 1233.26 1.000
alpha{3} 1.950980 0.541881 0.771828 3.443655 1.826272 1444.66 1448.48 1.000
pinvar{all} 0.537197 0.004690 0.396338 0.666097 0.541929 1338.10 1364.28 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -936.690939
Model 2: PositiveSelection -935.86646
Model 0: one-ratio -951.082436
Model 3: discrete -935.86646
Model 7: beta -939.110768
Model 8: beta&w>1 -935.883677
Model 0 vs 1 28.782994000000144
Model 2 vs 1 1.6489579999999933
Model 8 vs 7 6.454181999999946
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_nSyb-PI)
Pr(w>1) post mean +- SE for w
10 Q 1.000** 2.026
27 A 1.000** 2.025
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_nSyb-PI)
Pr(w>1) post mean +- SE for w
10 Q 0.915 2.574 +- 1.415
27 A 0.749 2.086 +- 1.335
>C1
MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C2
MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C3
MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C4
MGKKDKNKEPADAAPAGDAPPNAGAPTGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C5
MGKKDKNKEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C6
MGKKDKNMEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C7
MGKKDKNKEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C8
MGKKDKNKEPADAAPAGDAPPNAGAPTGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C9
MGKKDKNKEAADAAPAGDAPPTAGPPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C10
MGKKDKNKESADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C11
MGKKDKNKESADAAPAGDAPPNAGAPSGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=135
C1 MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
C2 MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
C3 MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
C4 MGKKDKNKEPADAAPAGDAPPNAGAPTGEGGDGEIVGGPHNPQQIAAQKR
C5 MGKKDKNKEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
C6 MGKKDKNMEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
C7 MGKKDKNKEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
C8 MGKKDKNKEPADAAPAGDAPPNAGAPTGEGGDGEIVGGPHNPQQIAAQKR
C9 MGKKDKNKEAADAAPAGDAPPTAGPPAGEGGDGEIVGGPHNPQQIAAQKR
C10 MGKKDKNKESADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
C11 MGKKDKNKESADAAPAGDAPPNAGAPSGEGGDGEIVGGPHNPQQIAAQKR
******* * ***********.**.*:***********************
C1 LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
C2 LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
C3 LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
C4 LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
C5 LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
C6 LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
C7 LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
C8 LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
C9 LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
C10 LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
C11 LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
**************************************************
C1 GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
C2 GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
C3 GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
C4 GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
C5 GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
C6 GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
C7 GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
C8 GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
C9 GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
C10 GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
C11 GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
***********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 135 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 135 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [14850]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [14850]--->[14850]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/330/nSyb-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.565 Mb, Max= 30.945 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C2
MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C3
MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C4
MGKKDKNKEPADAAPAGDAPPNAGAPTGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C5
MGKKDKNKEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C6
MGKKDKNMEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C7
MGKKDKNKEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C8
MGKKDKNKEPADAAPAGDAPPNAGAPTGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C9
MGKKDKNKEAADAAPAGDAPPTAGPPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C10
MGKKDKNKESADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C11
MGKKDKNKESADAAPAGDAPPNAGAPSGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
FORMAT of file /tmp/tmp5507774927938560651aln Not Supported[FATAL:T-COFFEE]
>C1
MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C2
MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C3
MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C4
MGKKDKNKEPADAAPAGDAPPNAGAPTGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C5
MGKKDKNKEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C6
MGKKDKNMEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C7
MGKKDKNKEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C8
MGKKDKNKEPADAAPAGDAPPNAGAPTGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C9
MGKKDKNKEAADAAPAGDAPPTAGPPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C10
MGKKDKNKESADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C11
MGKKDKNKESADAAPAGDAPPNAGAPSGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:135 S:100 BS:135
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 98.52 C1 C4 98.52
TOP 3 0 98.52 C4 C1 98.52
BOT 0 4 99.26 C1 C5 99.26
TOP 4 0 99.26 C5 C1 99.26
BOT 0 5 98.52 C1 C6 98.52
TOP 5 0 98.52 C6 C1 98.52
BOT 0 6 99.26 C1 C7 99.26
TOP 6 0 99.26 C7 C1 99.26
BOT 0 7 98.52 C1 C8 98.52
TOP 7 0 98.52 C8 C1 98.52
BOT 0 8 97.78 C1 C9 97.78
TOP 8 0 97.78 C9 C1 97.78
BOT 0 9 99.26 C1 C10 99.26
TOP 9 0 99.26 C10 C1 99.26
BOT 0 10 98.52 C1 C11 98.52
TOP 10 0 98.52 C11 C1 98.52
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 98.52 C2 C4 98.52
TOP 3 1 98.52 C4 C2 98.52
BOT 1 4 99.26 C2 C5 99.26
TOP 4 1 99.26 C5 C2 99.26
BOT 1 5 98.52 C2 C6 98.52
TOP 5 1 98.52 C6 C2 98.52
BOT 1 6 99.26 C2 C7 99.26
TOP 6 1 99.26 C7 C2 99.26
BOT 1 7 98.52 C2 C8 98.52
TOP 7 1 98.52 C8 C2 98.52
BOT 1 8 97.78 C2 C9 97.78
TOP 8 1 97.78 C9 C2 97.78
BOT 1 9 99.26 C2 C10 99.26
TOP 9 1 99.26 C10 C2 99.26
BOT 1 10 98.52 C2 C11 98.52
TOP 10 1 98.52 C11 C2 98.52
BOT 2 3 98.52 C3 C4 98.52
TOP 3 2 98.52 C4 C3 98.52
BOT 2 4 99.26 C3 C5 99.26
TOP 4 2 99.26 C5 C3 99.26
BOT 2 5 98.52 C3 C6 98.52
TOP 5 2 98.52 C6 C3 98.52
BOT 2 6 99.26 C3 C7 99.26
TOP 6 2 99.26 C7 C3 99.26
BOT 2 7 98.52 C3 C8 98.52
TOP 7 2 98.52 C8 C3 98.52
BOT 2 8 97.78 C3 C9 97.78
TOP 8 2 97.78 C9 C3 97.78
BOT 2 9 99.26 C3 C10 99.26
TOP 9 2 99.26 C10 C3 99.26
BOT 2 10 98.52 C3 C11 98.52
TOP 10 2 98.52 C11 C3 98.52
BOT 3 4 99.26 C4 C5 99.26
TOP 4 3 99.26 C5 C4 99.26
BOT 3 5 98.52 C4 C6 98.52
TOP 5 3 98.52 C6 C4 98.52
BOT 3 6 99.26 C4 C7 99.26
TOP 6 3 99.26 C7 C4 99.26
BOT 3 7 100.00 C4 C8 100.00
TOP 7 3 100.00 C8 C4 100.00
BOT 3 8 97.04 C4 C9 97.04
TOP 8 3 97.04 C9 C4 97.04
BOT 3 9 98.52 C4 C10 98.52
TOP 9 3 98.52 C10 C4 98.52
BOT 3 10 98.52 C4 C11 98.52
TOP 10 3 98.52 C11 C4 98.52
BOT 4 5 99.26 C5 C6 99.26
TOP 5 4 99.26 C6 C5 99.26
BOT 4 6 100.00 C5 C7 100.00
TOP 6 4 100.00 C7 C5 100.00
BOT 4 7 99.26 C5 C8 99.26
TOP 7 4 99.26 C8 C5 99.26
BOT 4 8 97.78 C5 C9 97.78
TOP 8 4 97.78 C9 C5 97.78
BOT 4 9 99.26 C5 C10 99.26
TOP 9 4 99.26 C10 C5 99.26
BOT 4 10 98.52 C5 C11 98.52
TOP 10 4 98.52 C11 C5 98.52
BOT 5 6 99.26 C6 C7 99.26
TOP 6 5 99.26 C7 C6 99.26
BOT 5 7 98.52 C6 C8 98.52
TOP 7 5 98.52 C8 C6 98.52
BOT 5 8 97.04 C6 C9 97.04
TOP 8 5 97.04 C9 C6 97.04
BOT 5 9 98.52 C6 C10 98.52
TOP 9 5 98.52 C10 C6 98.52
BOT 5 10 97.78 C6 C11 97.78
TOP 10 5 97.78 C11 C6 97.78
BOT 6 7 99.26 C7 C8 99.26
TOP 7 6 99.26 C8 C7 99.26
BOT 6 8 97.78 C7 C9 97.78
TOP 8 6 97.78 C9 C7 97.78
BOT 6 9 99.26 C7 C10 99.26
TOP 9 6 99.26 C10 C7 99.26
BOT 6 10 98.52 C7 C11 98.52
TOP 10 6 98.52 C11 C7 98.52
BOT 7 8 97.04 C8 C9 97.04
TOP 8 7 97.04 C9 C8 97.04
BOT 7 9 98.52 C8 C10 98.52
TOP 9 7 98.52 C10 C8 98.52
BOT 7 10 98.52 C8 C11 98.52
TOP 10 7 98.52 C11 C8 98.52
BOT 8 9 97.78 C9 C10 97.78
TOP 9 8 97.78 C10 C9 97.78
BOT 8 10 97.04 C9 C11 97.04
TOP 10 8 97.04 C11 C9 97.04
BOT 9 10 99.26 C10 C11 99.26
TOP 10 9 99.26 C11 C10 99.26
AVG 0 C1 * 98.96
AVG 1 C2 * 98.96
AVG 2 C3 * 98.96
AVG 3 C4 * 98.67
AVG 4 C5 * 99.11
AVG 5 C6 * 98.44
AVG 6 C7 * 99.11
AVG 7 C8 * 98.67
AVG 8 C9 * 97.48
AVG 9 C10 * 98.89
AVG 10 C11 * 98.37
TOT TOT * 98.69
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGGAAAGAAAGACAAGAACAAGGAACAGGCGGACGCTGCACCAGCTGG
C2 ATGGGCAAGAAAGACAAGAACAAGGAACAGGCGGACGCTGCACCAGCTGG
C3 ATGGGCAAGAAAGACAAGAACAAGGAACAGGCGGACGCTGCACCAGCTGG
C4 ATGGGCAAGAAAGACAAGAACAAGGAACCGGCGGACGCTGCACCAGCTGG
C5 ATGGGCAAGAAAGACAAGAACAAGGAACCGGCGGACGCTGCACCAGCTGG
C6 ATGGGCAAGAAAGACAAAAACATGGAACCGGCGGACGCTGCACCAGCTGG
C7 ATGGGCAAGAAAGACAAGAACAAGGAACCGGCGGACGCTGCACCAGCTGG
C8 ATGGGCAAGAAAGACAAGAACAAGGAACCGGCGGACGCTGCACCAGCTGG
C9 ATGGGCAAGAAAGACAAGAACAAGGAAGCGGCGGACGCTGCACCAGCTGG
C10 ATGGGCAAGAAAGACAAGAACAAGGAATCGGCGGACGCTGCACCAGCTGG
C11 ATGGGCAAGAAAGACAAGAACAAGGAATCGGCGGACGCTGCACCAGCTGG
*****.***********.****:**** .*********************
C1 CGATGCACCACCCAATGCCGGAGCCCCGGCCGGAGAGGGCGGCGATGGCG
C2 CGATGCACCACCCAATGCCGGAGCCCCGGCCGGAGAGGGCGGCGATGGTG
C3 CGATGCACCACCCAATGCCGGAGCTCCGGCCGGAGAGGGCGGCGATGGCG
C4 CGATGCACCACCAAACGCCGGAGCCCCGACCGGAGAGGGCGGCGATGGCG
C5 CGATGCACCACCAAACGCCGGAGCCCCGGCCGGAGAGGGCGGCGATGGCG
C6 CGATGCACCACCAAATGCCGGAGCTCCGGCCGGAGAGGGCGGCGATGGCG
C7 TGATGCACCACCAAATGCCGGAGCTCCGGCCGGAGAGGGCGGCGATGGCG
C8 CGATGCACCACCAAATGCCGGAGCTCCGACCGGAGAGGGCGGCGATGGCG
C9 AGATGCACCACCAACTGCCGGCCCTCCGGCCGGAGAGGGCGGCGATGGCG
C10 CGATGCACCACCAAATGCCGGAGCTCCGGCCGGAGAGGGCGGTGATGGCG
C11 CGATGCACCACCAAACGCCGGAGCTCCGTCCGGAGAGGGCGGCGATGGCG
***********.*. *****. * *** ************* ***** *
C1 AGATTGTGGGCGGACCACACAATCCGCAGCAGATCGCGGCACAGAAGCGT
C2 AGATTGTGGGCGGACCACACAATCCGCAGCAGATTGCGGCACAGAAGCGT
C3 AGATTGTGGGCGGACCACACAATCCGCAGCAGATTGCGGCACAGAAGCGT
C4 AGATTGTGGGCGGACCACACAATCCGCAGCAGATTGCGGCACAGAAGCGT
C5 AGATTGTGGGCGGACCACACAACCCGCAGCAGATTGCGGCACAGAAGCGT
C6 AGATTGTGGGCGGACCACACAATCCGCAGCAGATTGCGGCACAGAAGCGT
C7 AGATTGTGGGCGGACCACACAATCCGCAGCAGATTGCGGCACAGAAGCGT
C8 AGATTGTGGGCGGACCACACAACCCGCAGCAGATTGCCGCACAGAAGCGT
C9 AGATTGTGGGCGGACCACACAACCCGCAGCAGATTGCGGCACAAAAACGT
C10 AGATTGTGGGCGGACCGCACAATCCGCAGCAGATTGCGGCACAGAAGCGT
C11 AGATTGTGGGCGGACCACACAATCCGCAGCAGATTGCGGCACAGAAGCGT
****************.***** *********** ** *****.**.***
C1 CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
C2 CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
C3 CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
C4 CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
C5 CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
C6 CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
C7 CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
C8 CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
C9 CTGCAGCAAACTCAGGCGCAGGTCGATGAGGTCGTAGACATCATGCGCAC
C10 CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
C11 CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
********.** ***********************.**************
C1 GAACGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTGGACG
C2 GAACGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTGGACG
C3 GAACGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTGGACG
C4 GAACGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTGGACG
C5 GAACGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTGGACG
C6 GAATGTGGAGAAGGTGCTGGAGCGTGACAGCAAGTTGTCGGAGCTGGACG
C7 GAATGTGGAGAAGGTGCTGGAGCGTGACAGCAAGCTGTCGGAGCTGGACG
C8 GAATGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTGGACG
C9 GAATGTGGAAAAGGTGCTGGAGCGTGACAGCAAGCTGTCGGAGCTGGACG
C10 GAACGTGGAGAAGGTGCTGGAACGCGACAGCAAGCTGTCGGAGCTGGACG
C11 GAACGTGGAGAAGGTGCTGGAGCGCGACAGTAAGCTGTCGGAGCTGGACG
*** *****.***********.** ***** *** ***************
C1 ACCGTGCCGATGCCTTGCAGCAGGGTGCCTCGCAGTTTGAGCAGCAGGCG
C2 ACCGTGCCGATGCCTTGCAGCAGGGTGCCTCGCAGTTCGAGCAGCAGGCG
C3 ACCGTGCCGATGCCTTGCAGCAGGGTGCCTCGCAGTTCGAGCAGCAGGCG
C4 ACCGTGCCGATGCACTGCAGCAGGGCGCCTCGCAGTTCGAGCAGCAGGCG
C5 ACCGCGCCGATGCCTTGCAGCAGGGCGCCTCGCAGTTCGAGCAGCAGGCG
C6 ATCGTGCCGATGCCTTACAGCAGGGTGCCTCGCAGTTTGAGCAACAGGCG
C7 ATCGTGCCGATGCCTTGCAGCAGGGTGCCTCGCAGTTTGAGCAGCAGGCG
C8 ATCGTGCCGATGCATTGCAGCAGGGTGCCTCGCAGTTTGAGCAGCAAGCG
C9 ATCGTGCAGATGCCTTGCAGCAGGGCGCCTCGCAGTTTGAGCAGCAGGCG
C10 ATCGTGCTGATGCCTTGCAGCAGGGCGCCTCGCAGTTTGAGCAGCAAGCG
C11 ATCGCGCTGATGCCTTGCAGCAGGGCGCCTCGCAGTTTGAGCAGCAGGCG
* ** ** *****. *.******** *********** *****.**.***
C1 GGCAAGCTCAAGAGGAAATTCTGGCTTCAGAACTTAAAGATGATGATCAT
C2 GGCAAGCTCAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT
C3 GGCAAACTCAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT
C4 GGCAAGCTCAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT
C5 GGCAAGCTCAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT
C6 GGCAAGCTTAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT
C7 GGCAAGCTTAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT
C8 GGCAAGCTTAAGAGGAAATTCTGGCTGCAGAACTTGAAGATGATGATTAT
C9 GGCAAGTTAAAGAGGAAATTCTGGCTCCAGAACTTAAAGATGATGATCAT
C10 GGCAAGCTTAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT
C11 GGAAAGCTAAAGAGGAAATTCTGGCTGCAGAACTTGAAGATGATGATCAT
**.**. * ***************** ********.*********** **
C1 CATGGGCGTGATTGGCCTGGTTGTCGTGGGCATTATTGCAAAGAAAGACG
C2 CATGGGCGTGATTGGCCTTGTTGTCGTGGGCATTATTGCAAAGAAAGACG
C3 CATGGGCGTGATTGGCCTTGTTGTCGTGGGCATTATTGCAAAGAAAGACG
C4 CATGGGCGTGATTGGTCTGGTTGTCGTGGGCATTATTGCAAAGAAAGACG
C5 CATGGGCGTGATTGGTCTGGTAGTCGTGGGCATTATTGCAAAGAAAGACG
C6 CATGGGCGTGATTGGCCTGGTTGTCGTGGGCATTATTGCAAAGAAAGACG
C7 CATGGGCGTGATTGGCCTGGTTGTCGTGGGCATTATTGCAAAGAAAGACG
C8 CATGGGCGTGATTGGCCTGGTTGTCGTGGGCATCATTGCAAAGAAAGACG
C9 CATGGGCGTGATTGGCCTGGTTGTCGTGGGCATTATCGCAAAGAAAGACG
C10 CATGGGCGTTATTGGCCTGGTTGTCGTTGGCATCATTGCAAAGAAAGACG
C11 CATGGGCGTGATTGGCCTGGTTGTCGTGGGCATTATTGCAAAGAAAGACG
********* ***** ** **:***** ***** ** *************
C1 AAGAA
C2 AAGAA
C3 AAGAA
C4 AAGAA
C5 AAGAA
C6 AAGAA
C7 AAGAA
C8 AAGAA
C9 AAGAA
C10 AAGAA
C11 AAGAA
*****
>C1
ATGGGAAAGAAAGACAAGAACAAGGAACAGGCGGACGCTGCACCAGCTGG
CGATGCACCACCCAATGCCGGAGCCCCGGCCGGAGAGGGCGGCGATGGCG
AGATTGTGGGCGGACCACACAATCCGCAGCAGATCGCGGCACAGAAGCGT
CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
GAACGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTGGACG
ACCGTGCCGATGCCTTGCAGCAGGGTGCCTCGCAGTTTGAGCAGCAGGCG
GGCAAGCTCAAGAGGAAATTCTGGCTTCAGAACTTAAAGATGATGATCAT
CATGGGCGTGATTGGCCTGGTTGTCGTGGGCATTATTGCAAAGAAAGACG
AAGAA
>C2
ATGGGCAAGAAAGACAAGAACAAGGAACAGGCGGACGCTGCACCAGCTGG
CGATGCACCACCCAATGCCGGAGCCCCGGCCGGAGAGGGCGGCGATGGTG
AGATTGTGGGCGGACCACACAATCCGCAGCAGATTGCGGCACAGAAGCGT
CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
GAACGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTGGACG
ACCGTGCCGATGCCTTGCAGCAGGGTGCCTCGCAGTTCGAGCAGCAGGCG
GGCAAGCTCAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT
CATGGGCGTGATTGGCCTTGTTGTCGTGGGCATTATTGCAAAGAAAGACG
AAGAA
>C3
ATGGGCAAGAAAGACAAGAACAAGGAACAGGCGGACGCTGCACCAGCTGG
CGATGCACCACCCAATGCCGGAGCTCCGGCCGGAGAGGGCGGCGATGGCG
AGATTGTGGGCGGACCACACAATCCGCAGCAGATTGCGGCACAGAAGCGT
CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
GAACGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTGGACG
ACCGTGCCGATGCCTTGCAGCAGGGTGCCTCGCAGTTCGAGCAGCAGGCG
GGCAAACTCAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT
CATGGGCGTGATTGGCCTTGTTGTCGTGGGCATTATTGCAAAGAAAGACG
AAGAA
>C4
ATGGGCAAGAAAGACAAGAACAAGGAACCGGCGGACGCTGCACCAGCTGG
CGATGCACCACCAAACGCCGGAGCCCCGACCGGAGAGGGCGGCGATGGCG
AGATTGTGGGCGGACCACACAATCCGCAGCAGATTGCGGCACAGAAGCGT
CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
GAACGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTGGACG
ACCGTGCCGATGCACTGCAGCAGGGCGCCTCGCAGTTCGAGCAGCAGGCG
GGCAAGCTCAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT
CATGGGCGTGATTGGTCTGGTTGTCGTGGGCATTATTGCAAAGAAAGACG
AAGAA
>C5
ATGGGCAAGAAAGACAAGAACAAGGAACCGGCGGACGCTGCACCAGCTGG
CGATGCACCACCAAACGCCGGAGCCCCGGCCGGAGAGGGCGGCGATGGCG
AGATTGTGGGCGGACCACACAACCCGCAGCAGATTGCGGCACAGAAGCGT
CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
GAACGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTGGACG
ACCGCGCCGATGCCTTGCAGCAGGGCGCCTCGCAGTTCGAGCAGCAGGCG
GGCAAGCTCAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT
CATGGGCGTGATTGGTCTGGTAGTCGTGGGCATTATTGCAAAGAAAGACG
AAGAA
>C6
ATGGGCAAGAAAGACAAAAACATGGAACCGGCGGACGCTGCACCAGCTGG
CGATGCACCACCAAATGCCGGAGCTCCGGCCGGAGAGGGCGGCGATGGCG
AGATTGTGGGCGGACCACACAATCCGCAGCAGATTGCGGCACAGAAGCGT
CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
GAATGTGGAGAAGGTGCTGGAGCGTGACAGCAAGTTGTCGGAGCTGGACG
ATCGTGCCGATGCCTTACAGCAGGGTGCCTCGCAGTTTGAGCAACAGGCG
GGCAAGCTTAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT
CATGGGCGTGATTGGCCTGGTTGTCGTGGGCATTATTGCAAAGAAAGACG
AAGAA
>C7
ATGGGCAAGAAAGACAAGAACAAGGAACCGGCGGACGCTGCACCAGCTGG
TGATGCACCACCAAATGCCGGAGCTCCGGCCGGAGAGGGCGGCGATGGCG
AGATTGTGGGCGGACCACACAATCCGCAGCAGATTGCGGCACAGAAGCGT
CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
GAATGTGGAGAAGGTGCTGGAGCGTGACAGCAAGCTGTCGGAGCTGGACG
ATCGTGCCGATGCCTTGCAGCAGGGTGCCTCGCAGTTTGAGCAGCAGGCG
GGCAAGCTTAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT
CATGGGCGTGATTGGCCTGGTTGTCGTGGGCATTATTGCAAAGAAAGACG
AAGAA
>C8
ATGGGCAAGAAAGACAAGAACAAGGAACCGGCGGACGCTGCACCAGCTGG
CGATGCACCACCAAATGCCGGAGCTCCGACCGGAGAGGGCGGCGATGGCG
AGATTGTGGGCGGACCACACAACCCGCAGCAGATTGCCGCACAGAAGCGT
CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
GAATGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTGGACG
ATCGTGCCGATGCATTGCAGCAGGGTGCCTCGCAGTTTGAGCAGCAAGCG
GGCAAGCTTAAGAGGAAATTCTGGCTGCAGAACTTGAAGATGATGATTAT
CATGGGCGTGATTGGCCTGGTTGTCGTGGGCATCATTGCAAAGAAAGACG
AAGAA
>C9
ATGGGCAAGAAAGACAAGAACAAGGAAGCGGCGGACGCTGCACCAGCTGG
AGATGCACCACCAACTGCCGGCCCTCCGGCCGGAGAGGGCGGCGATGGCG
AGATTGTGGGCGGACCACACAACCCGCAGCAGATTGCGGCACAAAAACGT
CTGCAGCAAACTCAGGCGCAGGTCGATGAGGTCGTAGACATCATGCGCAC
GAATGTGGAAAAGGTGCTGGAGCGTGACAGCAAGCTGTCGGAGCTGGACG
ATCGTGCAGATGCCTTGCAGCAGGGCGCCTCGCAGTTTGAGCAGCAGGCG
GGCAAGTTAAAGAGGAAATTCTGGCTCCAGAACTTAAAGATGATGATCAT
CATGGGCGTGATTGGCCTGGTTGTCGTGGGCATTATCGCAAAGAAAGACG
AAGAA
>C10
ATGGGCAAGAAAGACAAGAACAAGGAATCGGCGGACGCTGCACCAGCTGG
CGATGCACCACCAAATGCCGGAGCTCCGGCCGGAGAGGGCGGTGATGGCG
AGATTGTGGGCGGACCGCACAATCCGCAGCAGATTGCGGCACAGAAGCGT
CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
GAACGTGGAGAAGGTGCTGGAACGCGACAGCAAGCTGTCGGAGCTGGACG
ATCGTGCTGATGCCTTGCAGCAGGGCGCCTCGCAGTTTGAGCAGCAAGCG
GGCAAGCTTAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT
CATGGGCGTTATTGGCCTGGTTGTCGTTGGCATCATTGCAAAGAAAGACG
AAGAA
>C11
ATGGGCAAGAAAGACAAGAACAAGGAATCGGCGGACGCTGCACCAGCTGG
CGATGCACCACCAAACGCCGGAGCTCCGTCCGGAGAGGGCGGCGATGGCG
AGATTGTGGGCGGACCACACAATCCGCAGCAGATTGCGGCACAGAAGCGT
CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC
GAACGTGGAGAAGGTGCTGGAGCGCGACAGTAAGCTGTCGGAGCTGGACG
ATCGCGCTGATGCCTTGCAGCAGGGCGCCTCGCAGTTTGAGCAGCAGGCG
GGAAAGCTAAAGAGGAAATTCTGGCTGCAGAACTTGAAGATGATGATCAT
CATGGGCGTGATTGGCCTGGTTGTCGTGGGCATTATTGCAAAGAAAGACG
AAGAA
>C1
MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C2
MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C3
MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C4
MGKKDKNKEPADAAPAGDAPPNAGAPTGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C5
MGKKDKNKEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C6
MGKKDKNMEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C7
MGKKDKNKEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C8
MGKKDKNKEPADAAPAGDAPPNAGAPTGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C9
MGKKDKNKEAADAAPAGDAPPTAGPPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C10
MGKKDKNKESADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
>C11
MGKKDKNKESADAAPAGDAPPNAGAPSGEGGDGEIVGGPHNPQQIAAQKR
LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 11 taxa and 405 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480003708
Setting output file names to "/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1920080047
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0169864148
Seed = 1177872836
Swapseed = 1480003708
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 10 unique site patterns
Division 2 has 7 unique site patterns
Division 3 has 42 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1579.228421 -- -24.640631
Chain 2 -- -1574.713605 -- -24.640631
Chain 3 -- -1587.980393 -- -24.640631
Chain 4 -- -1557.190388 -- -24.640631
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1585.260381 -- -24.640631
Chain 2 -- -1565.522205 -- -24.640631
Chain 3 -- -1584.164396 -- -24.640631
Chain 4 -- -1590.562798 -- -24.640631
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1579.228] (-1574.714) (-1587.980) (-1557.190) * [-1585.260] (-1565.522) (-1584.164) (-1590.563)
500 -- [-1026.918] (-1035.347) (-1030.020) (-1031.094) * (-1030.612) [-1026.991] (-1046.285) (-1032.904) -- 0:00:00
1000 -- (-1024.338) (-1027.134) [-1017.218] (-1021.310) * (-1015.902) [-1001.254] (-1019.406) (-1021.182) -- 0:00:00
1500 -- (-1002.317) (-998.736) (-995.514) [-1005.380] * [-997.266] (-998.821) (-1011.106) (-1014.834) -- 0:00:00
2000 -- (-1002.341) [-999.429] (-989.099) (-998.052) * [-991.358] (-1001.916) (-1017.740) (-993.082) -- 0:00:00
2500 -- (-1005.903) [-994.332] (-990.659) (-984.938) * (-995.405) (-979.502) (-1001.555) [-985.868] -- 0:00:00
3000 -- [-991.965] (-986.083) (-986.857) (-971.900) * (-984.804) (-984.203) (-989.854) [-977.685] -- 0:05:32
3500 -- [-986.988] (-981.489) (-988.505) (-977.364) * [-981.977] (-997.144) (-987.485) (-973.718) -- 0:04:44
4000 -- [-987.501] (-976.790) (-983.043) (-980.094) * (-1003.104) (-977.984) [-985.055] (-985.321) -- 0:04:09
4500 -- (-971.409) [-985.541] (-989.388) (-994.875) * (-991.083) (-987.144) [-980.211] (-985.549) -- 0:03:41
5000 -- (-983.196) (-977.970) (-974.509) [-976.126] * (-983.816) (-979.064) (-993.390) [-982.799] -- 0:03:19
Average standard deviation of split frequencies: 0.069838
5500 -- (-991.542) (-981.904) (-974.733) [-974.344] * (-976.573) (-982.533) (-991.204) [-980.813] -- 0:03:00
6000 -- [-979.664] (-984.764) (-980.471) (-973.066) * (-977.734) (-976.289) [-978.964] (-973.964) -- 0:02:45
6500 -- (-967.047) [-970.083] (-979.828) (-975.553) * [-973.310] (-979.439) (-996.291) (-978.047) -- 0:02:32
7000 -- (-981.362) [-977.859] (-977.610) (-965.088) * (-976.428) (-982.043) (-979.687) [-969.116] -- 0:04:43
7500 -- (-984.166) [-988.252] (-984.036) (-966.475) * (-982.754) (-976.505) [-971.708] (-987.114) -- 0:04:24
8000 -- (-978.108) [-971.160] (-978.240) (-976.110) * (-980.012) [-974.316] (-978.766) (-982.816) -- 0:04:08
8500 -- (-991.857) [-971.799] (-990.870) (-978.559) * (-987.749) (-972.825) (-986.883) [-968.060] -- 0:03:53
9000 -- [-978.086] (-973.605) (-986.914) (-985.761) * (-976.597) [-980.889] (-988.908) (-972.929) -- 0:03:40
9500 -- (-970.405) (-981.325) (-977.983) [-970.687] * (-984.975) (-979.872) [-974.763] (-986.785) -- 0:03:28
10000 -- (-974.592) (-988.722) (-987.928) [-973.936] * [-974.597] (-974.185) (-992.506) (-992.148) -- 0:03:18
Average standard deviation of split frequencies: 0.058926
10500 -- (-984.815) (-974.435) [-977.023] (-1002.573) * (-975.070) (-976.896) (-975.278) [-980.598] -- 0:03:08
11000 -- [-974.912] (-977.631) (-976.759) (-993.666) * (-980.577) [-986.586] (-984.978) (-977.873) -- 0:04:29
11500 -- (-978.935) [-976.895] (-979.754) (-985.063) * (-974.234) (-987.945) [-978.223] (-980.179) -- 0:04:17
12000 -- (-979.489) (-994.254) [-981.039] (-976.966) * (-980.594) (-974.993) [-965.297] (-986.007) -- 0:04:07
12500 -- (-984.939) (-975.424) (-976.548) [-983.223] * (-989.554) (-981.400) (-976.380) [-973.716] -- 0:03:57
13000 -- (-978.685) [-978.189] (-971.110) (-984.889) * (-981.244) (-975.947) [-976.126] (-977.753) -- 0:03:47
13500 -- (-985.735) [-974.731] (-973.651) (-978.703) * (-973.336) (-977.833) [-978.123] (-978.064) -- 0:03:39
14000 -- [-981.190] (-989.891) (-979.939) (-992.357) * (-973.070) (-974.105) [-967.093] (-984.263) -- 0:03:31
14500 -- (-972.377) (-975.174) [-983.623] (-1001.885) * (-978.561) (-974.469) [-980.204] (-975.517) -- 0:04:31
15000 -- (-989.244) [-975.689] (-976.124) (-982.651) * (-976.927) (-982.769) [-985.045] (-982.450) -- 0:04:22
Average standard deviation of split frequencies: 0.071735
15500 -- (-982.045) (-996.320) (-970.404) [-978.641] * (-987.449) (-977.809) [-977.301] (-975.620) -- 0:04:14
16000 -- [-982.933] (-975.285) (-979.730) (-983.709) * (-976.638) (-977.843) (-994.136) [-979.758] -- 0:04:06
16500 -- (-981.600) (-983.159) [-970.348] (-986.868) * (-975.094) [-972.893] (-995.052) (-975.516) -- 0:03:58
17000 -- (-978.138) [-968.730] (-978.716) (-978.082) * (-984.428) [-971.750] (-996.104) (-980.236) -- 0:03:51
17500 -- (-988.659) (-966.121) (-977.672) [-974.208] * [-984.546] (-976.204) (-974.813) (-996.454) -- 0:03:44
18000 -- (-980.986) [-977.575] (-992.047) (-970.745) * (-973.742) [-976.152] (-987.241) (-998.830) -- 0:03:38
18500 -- (-985.759) [-974.498] (-982.372) (-968.421) * [-980.848] (-975.851) (-983.626) (-982.903) -- 0:04:25
19000 -- (-977.407) (-981.114) (-983.874) [-972.287] * (-984.440) [-979.308] (-978.547) (-989.321) -- 0:04:18
19500 -- (-981.211) (-973.202) [-973.011] (-983.802) * (-984.383) [-976.060] (-971.239) (-975.936) -- 0:04:11
20000 -- (-987.153) (-976.428) [-978.437] (-979.496) * (-975.072) (-974.199) [-976.034] (-977.384) -- 0:04:05
Average standard deviation of split frequencies: 0.052463
20500 -- (-970.629) (-985.226) [-975.985] (-984.470) * (-974.763) [-967.961] (-977.989) (-981.465) -- 0:03:58
21000 -- [-979.393] (-975.784) (-974.219) (-981.360) * (-981.451) (-980.588) [-975.656] (-987.149) -- 0:03:53
21500 -- [-971.517] (-992.094) (-981.533) (-975.323) * (-977.715) (-976.343) (-979.254) [-984.841] -- 0:03:47
22000 -- (-991.557) (-982.586) [-979.781] (-972.378) * (-975.689) (-979.680) (-984.409) [-986.495] -- 0:04:26
22500 -- (-979.237) (-985.323) [-978.150] (-973.495) * [-968.383] (-974.703) (-987.610) (-980.947) -- 0:04:20
23000 -- [-977.943] (-975.925) (-982.555) (-975.546) * (-984.141) [-974.133] (-982.315) (-972.637) -- 0:04:14
23500 -- [-980.905] (-980.213) (-973.826) (-971.400) * [-979.426] (-984.297) (-991.315) (-979.590) -- 0:04:09
24000 -- (-986.499) (-979.205) [-972.244] (-984.255) * (-983.153) [-975.780] (-978.353) (-988.719) -- 0:04:04
24500 -- (-987.501) [-979.217] (-978.382) (-977.736) * [-973.963] (-981.399) (-982.885) (-972.987) -- 0:03:58
25000 -- [-975.866] (-984.635) (-986.576) (-979.337) * (-976.361) [-976.953] (-975.395) (-982.954) -- 0:03:54
Average standard deviation of split frequencies: 0.038852
25500 -- (-977.802) (-978.548) [-976.781] (-979.128) * [-979.547] (-988.864) (-971.186) (-994.727) -- 0:03:49
26000 -- (-982.155) (-975.672) (-986.468) [-968.549] * (-984.704) (-989.469) [-972.791] (-989.920) -- 0:04:22
26500 -- (-980.335) (-990.248) (-975.550) [-970.904] * (-976.061) (-992.818) [-974.833] (-977.039) -- 0:04:17
27000 -- [-981.050] (-977.097) (-979.540) (-979.423) * (-981.547) (-988.867) [-970.505] (-999.344) -- 0:04:12
27500 -- (-985.712) (-971.830) (-992.589) [-975.685] * (-986.454) (-981.781) [-981.167] (-989.912) -- 0:04:07
28000 -- [-980.687] (-975.049) (-987.852) (-981.262) * (-990.067) [-984.050] (-993.680) (-971.523) -- 0:04:03
28500 -- (-991.745) [-982.742] (-972.588) (-984.520) * [-977.064] (-989.670) (-969.651) (-990.719) -- 0:03:58
29000 -- (-982.018) [-974.940] (-981.738) (-979.032) * [-974.966] (-989.997) (-974.279) (-973.739) -- 0:03:54
29500 -- (-978.514) (-983.946) (-975.208) [-971.993] * [-970.044] (-990.785) (-973.992) (-987.856) -- 0:03:50
30000 -- (-982.475) (-994.950) [-974.577] (-985.849) * (-980.355) (-988.374) [-981.943] (-975.482) -- 0:04:18
Average standard deviation of split frequencies: 0.028548
30500 -- (-979.712) (-982.878) [-974.575] (-983.245) * [-975.465] (-992.936) (-980.321) (-978.485) -- 0:04:14
31000 -- (-1004.517) [-977.874] (-979.437) (-978.543) * (-971.547) (-996.569) (-978.107) [-975.399] -- 0:04:10
31500 -- (-989.068) (-991.471) (-987.913) [-977.066] * [-980.072] (-994.226) (-979.013) (-971.510) -- 0:04:05
32000 -- (-992.416) [-969.177] (-982.076) (-982.693) * (-974.279) (-987.037) [-969.602] (-979.788) -- 0:04:02
32500 -- (-975.551) (-978.782) (-978.756) [-966.604] * [-981.193] (-988.140) (-978.298) (-992.572) -- 0:03:58
33000 -- (-987.008) (-976.065) [-972.635] (-980.649) * (-985.955) (-995.981) [-967.930] (-996.708) -- 0:03:54
33500 -- [-980.026] (-973.530) (-982.241) (-990.320) * [-978.903] (-986.150) (-972.469) (-979.068) -- 0:04:19
34000 -- [-976.361] (-974.004) (-979.111) (-987.073) * (-982.826) [-977.115] (-992.944) (-985.175) -- 0:04:15
34500 -- (-983.904) (-987.429) (-983.940) [-978.278] * (-999.478) (-979.114) [-978.005] (-986.134) -- 0:04:11
35000 -- (-980.226) (-986.729) (-976.144) [-980.265] * (-973.357) (-981.934) [-969.336] (-984.463) -- 0:04:08
Average standard deviation of split frequencies: 0.030951
35500 -- (-981.823) [-971.111] (-979.547) (-986.731) * (-978.382) [-977.453] (-994.345) (-998.058) -- 0:04:04
36000 -- (-986.729) (-989.632) [-974.369] (-981.508) * (-981.983) [-969.881] (-982.866) (-976.668) -- 0:04:01
36500 -- (-981.108) (-985.268) (-995.424) [-982.515] * [-982.919] (-983.277) (-968.544) (-998.824) -- 0:03:57
37000 -- (-982.777) [-974.471] (-992.320) (-980.776) * (-979.344) (-983.667) [-970.483] (-982.473) -- 0:04:20
37500 -- (-976.741) [-974.624] (-975.977) (-982.672) * (-973.537) [-979.534] (-980.706) (-983.082) -- 0:04:16
38000 -- (-975.693) (-990.898) [-975.544] (-983.265) * [-973.000] (-990.182) (-980.188) (-982.064) -- 0:04:13
38500 -- (-985.221) [-971.232] (-984.316) (-983.084) * (-976.632) (-992.109) [-968.563] (-982.636) -- 0:04:09
39000 -- (-970.698) (-977.646) (-979.014) [-975.267] * (-973.886) (-986.043) (-978.986) [-979.060] -- 0:04:06
39500 -- (-975.860) [-976.284] (-1001.509) (-969.644) * (-987.535) (-980.715) (-971.381) [-978.672] -- 0:04:03
40000 -- (-982.006) [-982.049] (-989.309) (-988.210) * (-973.362) (-986.984) (-984.157) [-972.044] -- 0:04:00
Average standard deviation of split frequencies: 0.033617
40500 -- (-983.550) (-979.804) (-982.839) [-976.388] * [-976.186] (-990.059) (-983.457) (-975.020) -- 0:03:56
41000 -- (-983.875) (-982.808) [-979.694] (-976.567) * [-969.737] (-979.725) (-973.749) (-987.941) -- 0:04:17
41500 -- (-989.657) (-982.718) [-976.790] (-981.864) * (-983.900) [-983.099] (-980.531) (-983.629) -- 0:04:14
42000 -- [-967.943] (-979.689) (-979.369) (-979.999) * (-981.763) (-974.227) (-980.462) [-986.111] -- 0:04:10
42500 -- [-973.727] (-971.576) (-982.348) (-984.531) * [-971.912] (-973.787) (-978.607) (-972.900) -- 0:04:07
43000 -- (-983.391) (-971.991) (-972.267) [-981.277] * (-983.265) [-967.303] (-983.829) (-980.257) -- 0:04:04
43500 -- (-982.870) [-973.532] (-978.455) (-986.485) * (-990.142) [-974.513] (-978.293) (-988.903) -- 0:04:01
44000 -- (-974.053) (-982.539) (-982.700) [-972.836] * (-988.669) (-975.435) [-973.554] (-972.976) -- 0:03:59
44500 -- (-983.646) (-986.623) (-976.241) [-969.621] * [-969.890] (-988.711) (-971.743) (-979.523) -- 0:04:17
45000 -- (-988.839) (-978.250) (-977.218) [-971.312] * (-972.932) (-991.070) [-976.590] (-981.692) -- 0:04:14
Average standard deviation of split frequencies: 0.029719
45500 -- (-991.733) (-979.261) (-992.771) [-973.672] * (-995.443) (-989.603) (-976.702) [-975.927] -- 0:04:11
46000 -- [-978.528] (-982.206) (-997.329) (-975.973) * (-986.776) (-976.799) (-982.992) [-975.161] -- 0:04:08
46500 -- (-983.772) (-983.323) (-977.249) [-978.310] * (-982.557) (-992.470) [-975.518] (-975.349) -- 0:04:06
47000 -- (-995.796) (-978.458) [-973.649] (-986.957) * [-979.284] (-987.346) (-978.495) (-976.672) -- 0:04:03
47500 -- [-973.908] (-985.744) (-983.940) (-973.761) * [-966.357] (-986.409) (-978.293) (-978.715) -- 0:04:00
48000 -- (-981.564) (-978.710) [-972.614] (-973.772) * (-985.983) [-973.291] (-980.029) (-972.206) -- 0:04:17
48500 -- (-974.101) (-982.021) [-975.852] (-975.389) * (-976.565) (-973.575) (-979.955) [-969.868] -- 0:04:15
49000 -- [-980.532] (-983.111) (-977.129) (-981.334) * (-971.969) (-986.234) (-973.961) [-973.544] -- 0:04:12
49500 -- (-981.826) (-982.222) (-981.104) [-973.157] * (-979.257) [-984.846] (-977.465) (-980.808) -- 0:04:09
50000 -- (-975.421) (-975.522) [-980.879] (-975.996) * (-980.729) (-995.003) [-975.319] (-985.703) -- 0:04:06
Average standard deviation of split frequencies: 0.032564
50500 -- (-979.647) (-982.388) [-973.495] (-986.613) * (-977.555) (-971.434) (-991.793) [-976.945] -- 0:04:04
51000 -- (-984.795) (-977.721) [-985.676] (-981.721) * (-976.522) [-970.515] (-976.019) (-973.680) -- 0:04:01
51500 -- (-992.426) (-974.812) (-970.347) [-968.428] * [-972.646] (-989.521) (-979.635) (-973.003) -- 0:03:59
52000 -- [-971.441] (-980.830) (-984.694) (-984.012) * (-979.819) [-977.425] (-976.520) (-973.261) -- 0:04:15
52500 -- (-980.025) [-964.373] (-977.173) (-980.406) * (-982.031) (-966.354) (-986.066) [-971.275] -- 0:04:12
53000 -- (-983.545) [-973.226] (-969.196) (-977.577) * (-971.127) (-978.410) (-977.379) [-979.968] -- 0:04:10
53500 -- [-976.600] (-982.633) (-982.153) (-977.548) * (-972.122) [-979.206] (-990.314) (-991.319) -- 0:04:07
54000 -- (-979.012) (-984.832) [-970.271] (-979.814) * [-973.054] (-981.589) (-993.520) (-974.301) -- 0:04:05
54500 -- (-967.042) [-974.832] (-989.691) (-971.013) * (-969.152) [-975.498] (-984.625) (-973.904) -- 0:04:02
55000 -- (-969.801) (-977.685) [-984.942] (-977.450) * [-983.000] (-977.108) (-984.298) (-979.377) -- 0:04:00
Average standard deviation of split frequencies: 0.035887
55500 -- (-988.901) (-973.946) (-976.760) [-973.443] * (-970.575) [-977.445] (-990.607) (-977.418) -- 0:04:15
56000 -- (-982.973) [-980.507] (-991.398) (-984.855) * (-970.398) [-969.342] (-977.157) (-975.073) -- 0:04:12
56500 -- (-979.075) (-978.118) [-976.126] (-980.319) * (-981.272) [-974.489] (-978.481) (-980.521) -- 0:04:10
57000 -- (-980.125) (-980.175) (-978.413) [-970.358] * [-970.856] (-978.823) (-983.568) (-974.887) -- 0:04:08
57500 -- (-976.989) (-972.932) [-968.969] (-991.202) * (-987.059) (-982.194) (-974.674) [-973.918] -- 0:04:05
58000 -- (-979.085) (-981.042) (-974.700) [-972.904] * (-983.715) (-977.242) [-974.881] (-976.242) -- 0:04:03
58500 -- (-975.535) (-976.590) [-974.031] (-977.912) * (-978.220) (-976.119) (-984.985) [-979.202] -- 0:04:01
59000 -- [-971.794] (-986.712) (-970.261) (-985.784) * (-986.652) [-975.817] (-972.883) (-980.571) -- 0:03:59
59500 -- [-969.726] (-988.552) (-981.234) (-978.182) * (-994.492) (-972.789) [-974.152] (-970.312) -- 0:04:12
60000 -- (-984.014) (-982.328) (-980.831) [-973.800] * (-984.994) (-980.374) [-970.660] (-969.195) -- 0:04:10
Average standard deviation of split frequencies: 0.034353
60500 -- (-978.493) [-975.549] (-984.604) (-975.940) * (-991.119) (-976.246) (-981.640) [-973.086] -- 0:04:08
61000 -- [-971.171] (-974.224) (-989.308) (-983.974) * (-980.758) (-978.121) (-991.941) [-977.410] -- 0:04:06
61500 -- (-980.894) (-973.919) (-979.454) [-973.800] * [-972.334] (-971.214) (-972.929) (-974.800) -- 0:04:04
62000 -- (-973.184) [-975.184] (-984.894) (-978.264) * (-985.851) [-962.906] (-984.017) (-982.542) -- 0:04:02
62500 -- [-968.175] (-981.752) (-989.412) (-986.901) * (-983.667) (-986.791) (-986.646) [-980.720] -- 0:04:15
63000 -- (-995.517) (-968.853) (-991.653) [-971.905] * [-969.467] (-976.392) (-974.380) (-973.949) -- 0:04:12
63500 -- (-990.452) [-974.051] (-985.124) (-976.271) * [-965.595] (-990.496) (-972.142) (-984.164) -- 0:04:10
64000 -- (-985.247) (-976.842) [-975.904] (-980.824) * (-981.612) (-992.850) [-975.918] (-983.702) -- 0:04:08
64500 -- (-980.489) [-977.251] (-974.002) (-974.854) * (-978.379) (-980.439) [-972.153] (-979.282) -- 0:04:06
65000 -- (-984.303) (-987.516) [-974.269] (-980.448) * (-978.449) (-982.637) (-977.713) [-970.605] -- 0:04:04
Average standard deviation of split frequencies: 0.031971
65500 -- (-985.703) (-975.319) [-985.789] (-977.683) * (-979.481) (-984.495) [-974.157] (-979.180) -- 0:04:02
66000 -- [-972.429] (-981.514) (-984.957) (-981.676) * [-974.250] (-985.259) (-981.095) (-986.175) -- 0:04:14
66500 -- (-973.744) [-988.511] (-985.450) (-981.935) * [-980.328] (-973.809) (-966.104) (-988.334) -- 0:04:12
67000 -- (-978.827) [-976.305] (-979.032) (-973.076) * (-980.569) [-977.412] (-976.249) (-986.206) -- 0:04:10
67500 -- (-995.428) (-970.406) [-982.733] (-993.316) * (-981.664) [-972.355] (-981.487) (-973.321) -- 0:04:08
68000 -- (-999.719) (-977.111) [-972.805] (-975.378) * (-988.008) (-983.132) [-972.657] (-990.982) -- 0:04:06
68500 -- (-986.451) (-979.490) [-966.015] (-976.154) * (-982.638) (-978.078) [-972.427] (-977.123) -- 0:04:04
69000 -- (-984.167) [-978.184] (-973.826) (-979.878) * (-977.241) [-985.919] (-977.396) (-980.518) -- 0:04:02
69500 -- (-995.094) [-981.864] (-980.174) (-982.150) * [-971.378] (-974.003) (-981.098) (-973.381) -- 0:04:14
70000 -- (-981.901) [-982.203] (-970.137) (-980.222) * (-978.254) (-980.136) [-986.751] (-982.659) -- 0:04:12
Average standard deviation of split frequencies: 0.032687
70500 -- (-999.821) [-981.250] (-981.908) (-981.017) * (-996.225) (-977.204) (-986.422) [-976.307] -- 0:04:10
71000 -- (-989.839) (-981.668) [-978.089] (-978.612) * (-971.363) [-977.304] (-983.643) (-978.366) -- 0:04:08
71500 -- [-977.827] (-980.008) (-975.344) (-982.900) * [-974.624] (-979.767) (-984.959) (-986.085) -- 0:04:06
72000 -- (-992.113) (-973.538) [-973.348] (-983.512) * (-980.332) [-979.607] (-975.538) (-977.568) -- 0:04:04
72500 -- (-983.091) (-979.739) (-985.197) [-978.556] * [-971.143] (-985.065) (-978.130) (-982.339) -- 0:04:03
73000 -- (-987.054) (-970.768) (-981.908) [-967.732] * (-971.439) [-971.850] (-980.981) (-979.394) -- 0:04:13
73500 -- [-973.031] (-979.760) (-977.322) (-977.741) * (-986.610) (-985.624) [-974.135] (-979.521) -- 0:04:12
74000 -- [-971.250] (-980.721) (-981.688) (-976.791) * (-980.232) (-976.404) (-972.055) [-977.992] -- 0:04:10
74500 -- (-989.642) (-981.201) (-977.337) [-972.919] * (-984.486) [-968.494] (-978.400) (-978.345) -- 0:04:08
75000 -- (-981.027) (-980.507) [-974.045] (-980.211) * (-1006.177) (-974.781) [-969.311] (-985.622) -- 0:04:06
Average standard deviation of split frequencies: 0.029153
75500 -- (-980.687) (-993.835) (-985.150) [-974.518] * (-978.099) (-983.073) [-974.180] (-981.001) -- 0:04:04
76000 -- (-987.806) (-1000.331) (-981.036) [-974.771] * (-979.879) (-981.249) (-985.450) [-973.397] -- 0:04:03
76500 -- [-966.287] (-980.876) (-978.963) (-990.434) * [-974.758] (-995.782) (-982.460) (-987.289) -- 0:04:01
77000 -- (-970.975) [-977.566] (-989.095) (-983.200) * [-970.633] (-968.918) (-994.822) (-984.357) -- 0:04:11
77500 -- (-983.256) (-981.092) (-983.000) [-976.671] * [-968.019] (-968.351) (-983.852) (-982.852) -- 0:04:09
78000 -- [-973.493] (-976.332) (-981.562) (-981.091) * (-977.353) (-975.492) (-979.195) [-975.162] -- 0:04:08
78500 -- (-971.342) (-976.223) (-990.323) [-973.055] * (-981.885) (-983.700) (-989.010) [-980.694] -- 0:04:06
79000 -- [-975.297] (-972.941) (-984.029) (-979.428) * [-979.069] (-988.750) (-985.344) (-975.170) -- 0:04:04
79500 -- (-992.076) [-970.096] (-986.960) (-981.223) * (-976.683) (-990.373) (-981.874) [-976.877] -- 0:04:03
80000 -- (-975.488) (-975.589) [-970.497] (-976.977) * (-982.369) (-982.480) [-988.574] (-987.540) -- 0:04:01
Average standard deviation of split frequencies: 0.032791
80500 -- [-974.224] (-976.532) (-980.510) (-977.282) * (-976.506) [-967.845] (-994.830) (-991.881) -- 0:04:11
81000 -- (-980.283) [-973.633] (-991.699) (-971.056) * (-981.835) (-977.055) (-988.749) [-972.540] -- 0:04:09
81500 -- (-978.960) (-988.986) (-983.108) [-989.929] * [-971.728] (-978.497) (-993.732) (-978.041) -- 0:04:07
82000 -- [-967.458] (-977.030) (-973.349) (-987.261) * (-975.673) (-984.695) [-978.601] (-979.386) -- 0:04:06
82500 -- [-979.360] (-978.237) (-973.299) (-988.741) * (-974.255) (-988.328) (-985.314) [-964.466] -- 0:04:04
83000 -- [-979.994] (-971.590) (-992.549) (-989.717) * [-982.221] (-992.239) (-984.254) (-972.697) -- 0:04:03
83500 -- [-972.753] (-992.559) (-979.981) (-984.560) * (-999.945) (-979.165) (-992.161) [-982.054] -- 0:04:01
84000 -- (-984.985) (-982.170) [-975.666] (-991.465) * [-982.142] (-982.953) (-990.676) (-970.749) -- 0:04:10
84500 -- (-977.467) [-975.002] (-984.171) (-985.265) * [-975.249] (-989.785) (-996.230) (-967.074) -- 0:04:09
85000 -- (-975.161) (-981.335) [-969.267] (-989.613) * (-977.426) (-975.490) (-992.672) [-974.362] -- 0:04:07
Average standard deviation of split frequencies: 0.032584
85500 -- (-977.419) (-983.194) [-975.541] (-987.088) * (-983.980) (-981.368) (-979.578) [-969.246] -- 0:04:06
86000 -- [-969.800] (-975.220) (-977.724) (-984.513) * (-977.518) (-978.081) (-987.535) [-967.394] -- 0:04:04
86500 -- [-970.881] (-972.738) (-977.909) (-1001.053) * (-977.926) (-981.606) (-995.121) [-980.986] -- 0:04:02
87000 -- (-978.241) [-974.370] (-979.869) (-989.249) * [-975.979] (-970.609) (-996.353) (-978.713) -- 0:04:01
87500 -- (-983.844) (-983.148) [-980.492] (-986.834) * [-978.556] (-982.471) (-980.478) (-976.654) -- 0:03:59
88000 -- (-975.846) [-975.366] (-981.890) (-975.201) * (-972.826) (-966.787) (-989.889) [-980.290] -- 0:04:08
88500 -- [-970.993] (-989.633) (-976.686) (-970.160) * [-980.513] (-987.512) (-992.124) (-964.656) -- 0:04:07
89000 -- [-973.178] (-984.835) (-977.521) (-974.417) * [-984.180] (-987.175) (-986.390) (-975.940) -- 0:04:05
89500 -- (-985.782) (-977.389) (-973.786) [-980.657] * (-975.614) (-980.308) [-982.039] (-974.665) -- 0:04:04
90000 -- (-985.890) (-980.904) (-973.416) [-975.939] * (-974.069) (-977.410) [-979.014] (-988.792) -- 0:04:02
Average standard deviation of split frequencies: 0.027091
90500 -- (-967.059) [-975.245] (-987.926) (-980.152) * [-979.501] (-981.262) (-978.329) (-982.304) -- 0:04:01
91000 -- (-976.447) [-976.907] (-980.719) (-978.434) * (-981.715) (-984.244) (-970.970) [-976.528] -- 0:03:59
91500 -- (-974.235) (-979.035) [-966.280] (-974.653) * [-979.390] (-1004.739) (-975.434) (-983.366) -- 0:04:08
92000 -- [-973.172] (-983.778) (-975.474) (-989.885) * [-984.780] (-982.884) (-973.250) (-984.118) -- 0:04:06
92500 -- (-985.832) (-976.832) [-974.531] (-994.242) * (-980.785) (-975.637) [-976.418] (-978.395) -- 0:04:05
93000 -- (-979.013) [-970.548] (-980.822) (-973.682) * (-979.441) (-987.775) [-969.011] (-979.644) -- 0:04:03
93500 -- (-980.182) (-983.891) [-981.657] (-973.321) * (-980.033) [-973.540] (-979.592) (-974.299) -- 0:04:02
94000 -- (-975.766) (-974.683) [-978.051] (-986.259) * (-979.563) (-976.666) (-976.655) [-977.367] -- 0:04:00
94500 -- (-985.939) [-971.096] (-987.877) (-979.767) * (-982.345) (-972.507) [-975.267] (-982.589) -- 0:03:59
95000 -- (-988.593) [-969.155] (-972.335) (-978.226) * [-980.045] (-984.559) (-982.426) (-981.499) -- 0:03:58
Average standard deviation of split frequencies: 0.024552
95500 -- [-987.169] (-977.798) (-984.210) (-981.494) * [-981.567] (-987.193) (-976.579) (-980.739) -- 0:04:06
96000 -- (-974.872) (-982.069) [-970.713] (-977.756) * (-977.109) (-985.347) (-976.721) [-971.558] -- 0:04:04
96500 -- (-986.837) (-984.044) [-976.577] (-976.331) * [-973.400] (-982.222) (-977.924) (-976.532) -- 0:04:03
97000 -- (-984.065) (-985.101) (-978.785) [-977.410] * (-978.628) (-979.443) [-970.748] (-979.051) -- 0:04:02
97500 -- (-986.297) (-984.586) [-975.340] (-977.555) * (-979.755) (-983.068) (-982.767) [-977.323] -- 0:04:00
98000 -- (-986.292) (-974.792) [-973.572] (-976.118) * [-975.037] (-975.560) (-973.848) (-986.782) -- 0:03:59
98500 -- (-985.481) [-978.961] (-973.302) (-986.377) * (-980.425) [-968.190] (-978.839) (-978.334) -- 0:03:57
99000 -- (-984.592) (-978.349) (-974.736) [-979.152] * [-968.203] (-979.942) (-971.334) (-968.724) -- 0:04:05
99500 -- (-977.210) (-977.863) [-974.965] (-999.169) * (-987.849) (-987.018) [-973.523] (-978.585) -- 0:04:04
100000 -- (-977.630) [-978.437] (-985.684) (-984.875) * [-980.828] (-972.223) (-980.758) (-968.855) -- 0:04:03
Average standard deviation of split frequencies: 0.023154
100500 -- (-976.042) (-975.552) [-980.945] (-987.409) * (-977.274) [-981.358] (-993.292) (-980.735) -- 0:04:01
101000 -- (-978.485) (-984.835) (-988.305) [-980.916] * (-987.186) (-982.153) (-983.401) [-970.635] -- 0:04:00
101500 -- (-984.023) [-977.977] (-984.516) (-990.188) * (-980.378) (-978.054) [-973.048] (-979.533) -- 0:03:59
102000 -- (-995.446) [-984.289] (-977.982) (-990.924) * [-974.274] (-968.304) (-988.296) (-972.549) -- 0:03:57
102500 -- (-979.340) (-983.391) [-973.918] (-987.267) * (-978.530) [-975.371] (-981.047) (-982.161) -- 0:04:05
103000 -- [-973.024] (-971.969) (-988.396) (-984.967) * (-979.384) (-972.353) (-981.994) [-978.259] -- 0:04:03
103500 -- [-977.051] (-979.763) (-994.704) (-971.504) * (-972.743) (-980.734) (-980.933) [-977.547] -- 0:04:02
104000 -- (-986.009) (-974.530) [-971.524] (-977.198) * (-978.304) (-974.889) [-970.772] (-983.183) -- 0:04:01
104500 -- (-981.902) (-986.616) (-988.971) [-983.096] * [-988.429] (-984.036) (-983.592) (-981.261) -- 0:03:59
105000 -- (-975.082) [-972.926] (-978.906) (-988.992) * (-989.428) (-976.301) (-985.786) [-972.787] -- 0:03:58
Average standard deviation of split frequencies: 0.022938
105500 -- [-975.653] (-979.060) (-975.589) (-985.532) * (-971.441) (-986.497) (-978.028) [-977.890] -- 0:03:57
106000 -- (-982.518) (-986.471) [-978.333] (-976.698) * (-986.762) (-983.453) (-984.767) [-976.290] -- 0:03:56
106500 -- (-983.775) (-978.551) [-972.817] (-988.299) * [-975.959] (-980.271) (-978.650) (-982.187) -- 0:04:03
107000 -- (-992.971) (-977.539) [-973.993] (-981.706) * (-989.422) (-978.049) (-979.448) [-971.378] -- 0:04:02
107500 -- (-998.647) (-986.261) [-982.527] (-985.162) * (-970.832) (-987.643) [-974.654] (-978.725) -- 0:04:00
108000 -- (-975.199) (-981.844) (-986.204) [-970.721] * [-980.209] (-990.193) (-979.831) (-983.238) -- 0:03:59
108500 -- [-978.827] (-984.538) (-974.753) (-978.460) * [-971.517] (-973.693) (-978.604) (-980.007) -- 0:03:58
109000 -- [-973.208] (-987.408) (-979.410) (-973.405) * (-974.803) (-986.978) (-975.166) [-968.330] -- 0:03:57
109500 -- (-987.232) (-975.700) [-982.010] (-985.400) * (-981.284) (-979.650) [-974.179] (-976.794) -- 0:03:55
110000 -- [-978.689] (-974.535) (-981.482) (-988.468) * (-975.413) [-971.942] (-967.472) (-979.438) -- 0:04:02
Average standard deviation of split frequencies: 0.019879
110500 -- [-973.949] (-985.303) (-974.291) (-981.171) * (-984.070) (-976.535) (-982.814) [-974.980] -- 0:04:01
111000 -- (-979.829) (-975.154) (-977.720) [-978.865] * [-972.349] (-983.282) (-982.428) (-975.751) -- 0:04:00
111500 -- (-978.592) (-981.998) (-988.520) [-981.860] * [-969.750] (-995.059) (-980.903) (-984.216) -- 0:03:59
112000 -- [-977.871] (-980.219) (-993.625) (-972.017) * [-973.379] (-996.684) (-981.082) (-980.996) -- 0:03:57
112500 -- (-979.198) [-979.597] (-973.100) (-982.703) * (-979.992) (-983.887) [-970.444] (-972.845) -- 0:03:56
113000 -- (-981.544) (-984.506) [-966.208] (-974.017) * (-979.475) (-978.616) (-973.239) [-976.663] -- 0:03:55
113500 -- (-983.375) (-986.429) [-981.279] (-976.922) * (-973.843) (-977.135) [-972.330] (-981.176) -- 0:04:02
114000 -- (-977.742) (-983.281) (-994.423) [-973.401] * [-973.726] (-977.547) (-973.932) (-979.134) -- 0:04:00
114500 -- [-973.211] (-986.048) (-976.851) (-981.710) * (-979.711) (-982.176) [-968.624] (-976.393) -- 0:03:59
115000 -- (-974.809) [-966.664] (-989.555) (-977.343) * (-975.857) (-981.219) [-979.681] (-991.568) -- 0:03:58
Average standard deviation of split frequencies: 0.018608
115500 -- [-976.796] (-987.367) (-973.330) (-983.519) * (-983.816) [-978.078] (-970.390) (-986.618) -- 0:03:57
116000 -- (-982.754) [-971.907] (-976.661) (-980.357) * (-990.194) (-976.563) (-973.602) [-978.148] -- 0:03:56
116500 -- (-976.948) (-979.227) [-979.446] (-982.855) * (-982.013) (-975.463) (-971.138) [-976.764] -- 0:03:55
117000 -- (-989.694) (-975.773) [-976.869] (-980.544) * [-976.556] (-976.452) (-980.378) (-980.985) -- 0:03:53
117500 -- [-973.728] (-982.642) (-974.127) (-982.770) * [-974.323] (-983.212) (-976.948) (-982.602) -- 0:04:00
118000 -- [-973.276] (-988.645) (-970.227) (-979.953) * (-990.525) (-974.728) (-978.159) [-972.244] -- 0:03:59
118500 -- [-979.691] (-976.422) (-975.966) (-981.725) * [-981.285] (-974.682) (-984.055) (-981.900) -- 0:03:58
119000 -- (-996.832) (-969.670) (-987.935) [-975.287] * (-978.136) [-968.024] (-978.710) (-991.297) -- 0:03:56
119500 -- (-1000.413) [-970.454] (-973.954) (-984.736) * (-978.977) (-983.148) [-976.524] (-983.233) -- 0:03:55
120000 -- (-982.879) [-976.085] (-974.386) (-981.835) * (-978.748) [-968.592] (-985.056) (-986.100) -- 0:03:54
Average standard deviation of split frequencies: 0.018300
120500 -- [-970.810] (-982.237) (-977.922) (-983.243) * (-979.617) (-978.811) (-990.242) [-977.785] -- 0:03:53
121000 -- (-974.875) [-976.663] (-986.224) (-988.790) * (-982.037) (-972.135) (-995.936) [-975.003] -- 0:03:59
121500 -- (-984.600) (-969.950) [-965.998] (-989.908) * [-977.276] (-966.472) (-968.506) (-990.170) -- 0:03:58
122000 -- (-985.386) (-973.581) [-976.113] (-977.021) * (-977.987) [-968.722] (-985.054) (-972.915) -- 0:03:57
122500 -- [-979.483] (-983.872) (-983.022) (-994.168) * (-985.762) [-966.607] (-979.293) (-981.996) -- 0:03:56
123000 -- (-984.709) (-985.193) (-983.529) [-978.336] * (-989.100) (-984.482) (-975.589) [-979.139] -- 0:03:55
123500 -- [-973.561] (-988.687) (-986.053) (-981.112) * (-981.082) [-978.072] (-986.021) (-986.425) -- 0:03:54
124000 -- (-981.173) (-975.518) (-980.953) [-979.332] * [-978.486] (-979.797) (-966.410) (-989.988) -- 0:03:53
124500 -- (-989.166) (-984.034) (-988.941) [-978.789] * (-981.886) (-984.522) [-972.945] (-974.226) -- 0:03:52
125000 -- (-978.278) [-980.147] (-996.350) (-984.758) * (-980.914) (-977.777) (-981.985) [-970.369] -- 0:03:58
Average standard deviation of split frequencies: 0.021463
125500 -- [-979.463] (-990.796) (-979.963) (-975.504) * (-964.698) (-994.359) [-975.752] (-987.777) -- 0:03:56
126000 -- (-979.385) (-988.314) [-980.774] (-988.491) * (-970.089) (-980.857) (-975.911) [-966.228] -- 0:03:55
126500 -- (-973.828) (-988.233) (-979.788) [-977.271] * (-983.838) (-977.881) (-979.045) [-970.464] -- 0:03:54
127000 -- [-974.262] (-991.753) (-983.176) (-974.228) * [-978.735] (-973.922) (-980.746) (-985.972) -- 0:03:53
127500 -- (-978.528) (-984.515) (-987.384) [-980.564] * [-969.527] (-978.898) (-980.817) (-981.974) -- 0:03:52
128000 -- (-977.531) (-987.727) (-990.492) [-965.880] * (-978.721) [-972.282] (-976.059) (-985.400) -- 0:03:51
128500 -- (-993.334) (-983.525) (-980.101) [-981.158] * (-983.563) [-974.475] (-973.195) (-975.919) -- 0:03:57
129000 -- (-984.047) (-977.277) [-979.341] (-982.973) * (-973.798) (-974.919) [-968.379] (-982.732) -- 0:03:56
129500 -- [-980.222] (-982.581) (-976.274) (-986.952) * (-997.301) (-987.582) [-973.294] (-972.347) -- 0:03:55
130000 -- (-981.193) (-981.576) (-977.254) [-980.650] * (-992.410) (-964.586) (-976.083) [-974.765] -- 0:03:54
Average standard deviation of split frequencies: 0.019747
130500 -- (-972.698) [-975.966] (-983.159) (-982.506) * (-979.957) (-977.038) [-979.156] (-994.238) -- 0:03:53
131000 -- (-979.626) [-971.402] (-980.649) (-989.264) * (-984.788) (-985.373) [-983.157] (-972.615) -- 0:03:52
131500 -- (-974.735) (-987.483) [-971.102] (-985.834) * [-968.241] (-980.593) (-970.111) (-985.451) -- 0:03:51
132000 -- (-982.546) [-972.834] (-983.138) (-989.174) * [-977.767] (-977.905) (-971.901) (-985.124) -- 0:03:56
132500 -- (-983.929) [-973.002] (-981.099) (-973.314) * [-971.569] (-979.263) (-987.964) (-979.037) -- 0:03:55
133000 -- (-982.855) [-974.155] (-973.617) (-982.513) * (-984.510) (-984.982) (-978.250) [-974.981] -- 0:03:54
133500 -- (-975.710) (-982.730) (-972.866) [-977.826] * (-980.285) [-970.574] (-982.238) (-967.036) -- 0:03:53
134000 -- (-977.838) (-979.882) (-976.612) [-970.879] * (-984.458) (-980.491) [-982.432] (-972.321) -- 0:03:52
134500 -- (-976.477) (-978.960) (-980.302) [-970.492] * (-971.044) (-979.414) [-967.824] (-974.238) -- 0:03:51
135000 -- [-976.535] (-973.146) (-987.225) (-983.237) * (-970.645) (-991.855) (-987.065) [-979.309] -- 0:03:50
Average standard deviation of split frequencies: 0.020615
135500 -- (-981.731) (-971.993) [-972.878] (-979.793) * (-975.182) (-976.715) [-978.543] (-982.096) -- 0:03:49
136000 -- [-973.401] (-995.086) (-976.712) (-982.294) * (-973.943) (-977.144) [-976.976] (-994.678) -- 0:03:55
136500 -- (-976.594) (-985.532) (-968.445) [-974.459] * (-975.558) (-976.301) (-975.312) [-972.754] -- 0:03:54
137000 -- [-983.964] (-979.075) (-977.127) (-988.702) * [-976.807] (-975.234) (-985.881) (-968.660) -- 0:03:53
137500 -- (-982.278) (-976.017) (-981.092) [-972.945] * [-972.776] (-984.841) (-994.493) (-977.524) -- 0:03:52
138000 -- (-982.167) (-979.318) [-971.621] (-979.434) * (-977.386) (-996.755) [-985.507] (-970.044) -- 0:03:51
138500 -- [-976.858] (-987.830) (-977.581) (-995.483) * (-982.760) (-988.463) (-987.674) [-973.443] -- 0:03:50
139000 -- (-983.940) (-980.852) [-969.009] (-992.184) * (-975.462) (-991.091) [-982.841] (-981.924) -- 0:03:49
139500 -- (-983.354) (-979.178) [-974.726] (-983.703) * (-976.500) (-979.123) (-990.113) [-971.812] -- 0:03:54
140000 -- [-969.249] (-976.769) (-983.537) (-977.273) * (-974.575) (-981.988) (-983.981) [-973.731] -- 0:03:53
Average standard deviation of split frequencies: 0.019755
140500 -- (-974.181) (-970.848) [-969.468] (-973.959) * (-985.716) [-974.438] (-978.155) (-974.257) -- 0:03:52
141000 -- (-977.954) [-970.327] (-978.833) (-979.260) * (-976.641) [-971.165] (-993.999) (-971.607) -- 0:03:51
141500 -- [-978.229] (-976.737) (-972.851) (-975.298) * (-969.737) (-980.249) (-983.457) [-972.580] -- 0:03:50
142000 -- (-978.123) [-973.417] (-974.708) (-980.506) * (-984.939) (-977.611) (-972.652) [-969.114] -- 0:03:49
142500 -- (-983.132) (-976.516) (-977.567) [-982.408] * (-981.365) (-974.835) (-981.026) [-969.511] -- 0:03:48
143000 -- [-977.470] (-988.662) (-984.500) (-977.411) * [-976.713] (-990.706) (-989.668) (-981.777) -- 0:03:53
143500 -- (-979.226) (-983.615) (-979.634) [-976.110] * (-981.768) (-987.693) [-968.813] (-970.848) -- 0:03:52
144000 -- [-970.567] (-986.470) (-988.975) (-976.258) * (-984.608) (-979.141) [-976.890] (-987.583) -- 0:03:51
144500 -- (-976.117) (-979.566) [-976.392] (-979.499) * (-978.065) (-976.822) (-982.809) [-973.768] -- 0:03:50
145000 -- (-981.185) (-977.226) [-985.445] (-975.937) * (-969.512) (-977.454) (-986.547) [-970.252] -- 0:03:49
Average standard deviation of split frequencies: 0.021242
145500 -- (-977.241) (-967.061) (-987.068) [-976.038] * (-974.493) (-977.908) (-978.686) [-971.406] -- 0:03:49
146000 -- (-984.012) (-988.316) [-969.018] (-980.497) * (-969.320) (-983.993) (-979.743) [-972.645] -- 0:03:48
146500 -- (-983.147) (-981.399) [-975.492] (-999.544) * [-975.779] (-978.081) (-980.467) (-981.743) -- 0:03:47
147000 -- (-978.656) (-979.709) [-974.585] (-993.294) * [-964.665] (-975.525) (-981.498) (-976.125) -- 0:03:52
147500 -- (-977.982) (-971.097) [-971.386] (-973.769) * (-978.645) [-970.241] (-987.879) (-978.728) -- 0:03:51
148000 -- (-984.964) [-973.094] (-975.491) (-976.049) * (-980.396) [-969.449] (-988.130) (-973.734) -- 0:03:50
148500 -- (-982.920) (-979.161) (-973.265) [-983.282] * (-982.219) (-977.628) (-983.501) [-971.174] -- 0:03:49
149000 -- (-991.889) [-972.759] (-982.825) (-976.691) * [-980.431] (-980.622) (-988.840) (-976.545) -- 0:03:48
149500 -- [-984.916] (-971.449) (-987.069) (-977.246) * [-971.539] (-977.772) (-989.189) (-982.535) -- 0:03:47
150000 -- (-978.892) (-980.111) [-977.496] (-984.457) * [-968.781] (-975.099) (-990.221) (-976.541) -- 0:03:46
Average standard deviation of split frequencies: 0.019596
150500 -- (-977.558) (-974.289) (-973.391) [-973.932] * (-980.180) (-976.794) [-982.037] (-984.283) -- 0:03:51
151000 -- (-988.217) (-975.384) [-969.227] (-972.386) * (-982.955) [-968.151] (-980.036) (-981.387) -- 0:03:50
151500 -- (-986.732) (-983.998) [-968.175] (-978.136) * (-987.382) [-977.831] (-978.811) (-997.346) -- 0:03:49
152000 -- (-978.402) (-977.017) (-980.319) [-972.425] * (-982.917) (-998.251) (-978.038) [-972.927] -- 0:03:48
152500 -- (-983.301) (-979.384) (-983.021) [-974.966] * (-970.578) [-978.678] (-983.593) (-969.743) -- 0:03:47
153000 -- (-980.186) [-970.294] (-986.391) (-976.868) * [-976.404] (-974.652) (-971.360) (-985.393) -- 0:03:46
153500 -- (-985.953) (-981.138) [-979.175] (-976.067) * [-982.360] (-972.003) (-974.770) (-982.499) -- 0:03:46
154000 -- [-969.434] (-987.093) (-975.303) (-981.157) * [-969.110] (-986.841) (-985.574) (-994.892) -- 0:03:45
154500 -- (-977.755) [-969.958] (-983.000) (-968.615) * (-989.114) [-970.974] (-995.420) (-971.583) -- 0:03:49
155000 -- (-984.692) (-978.240) (-972.651) [-974.262] * (-975.657) (-981.639) (-992.746) [-976.611] -- 0:03:48
Average standard deviation of split frequencies: 0.019306
155500 -- (-989.947) (-974.015) (-981.018) [-975.253] * [-987.139] (-986.159) (-986.548) (-980.817) -- 0:03:48
156000 -- (-982.584) [-977.513] (-982.376) (-987.144) * (-970.055) [-981.760] (-998.696) (-982.590) -- 0:03:47
156500 -- (-987.119) (-987.501) [-977.575] (-982.447) * [-973.245] (-980.927) (-987.438) (-973.036) -- 0:03:46
157000 -- (-984.730) (-980.211) [-977.531] (-975.952) * (-985.511) [-976.367] (-984.898) (-982.675) -- 0:03:45
157500 -- (-979.852) (-970.317) (-978.367) [-968.503] * (-978.892) (-992.807) (-973.222) [-982.326] -- 0:03:44
158000 -- (-981.374) [-973.252] (-973.312) (-969.306) * (-991.151) (-988.391) [-974.833] (-978.473) -- 0:03:49
158500 -- (-990.116) (-973.819) [-977.348] (-976.829) * (-987.705) (-980.521) [-977.050] (-973.028) -- 0:03:48
159000 -- (-987.146) (-972.568) [-970.224] (-986.818) * (-988.261) (-975.441) (-976.539) [-977.462] -- 0:03:47
159500 -- (-981.373) [-982.678] (-981.183) (-983.570) * [-971.816] (-972.077) (-988.271) (-974.232) -- 0:03:46
160000 -- [-971.427] (-978.885) (-975.777) (-983.077) * (-979.884) (-977.701) (-991.482) [-980.188] -- 0:03:45
Average standard deviation of split frequencies: 0.017441
160500 -- (-968.925) [-980.636] (-979.178) (-976.632) * [-976.119] (-981.607) (-988.810) (-979.250) -- 0:03:44
161000 -- (-991.501) [-981.092] (-982.770) (-980.585) * (-986.619) [-981.218] (-980.943) (-989.052) -- 0:03:44
161500 -- (-996.661) (-991.740) (-975.456) [-973.803] * (-996.797) [-975.618] (-980.295) (-971.806) -- 0:03:48
162000 -- [-985.151] (-985.131) (-973.833) (-987.037) * (-974.855) (-974.801) (-974.994) [-981.814] -- 0:03:47
162500 -- (-987.229) (-983.413) [-972.429] (-988.535) * (-976.455) (-980.555) [-976.757] (-981.812) -- 0:03:46
163000 -- (-977.773) (-976.587) [-971.087] (-988.197) * [-976.353] (-982.945) (-974.407) (-984.023) -- 0:03:45
163500 -- (-971.623) [-973.781] (-985.794) (-982.852) * (-985.468) (-987.506) (-988.406) [-979.658] -- 0:03:45
164000 -- [-969.714] (-984.291) (-976.856) (-979.218) * [-974.910] (-981.356) (-982.938) (-984.370) -- 0:03:44
164500 -- (-969.022) (-979.521) [-983.984] (-980.316) * (-976.640) [-979.242] (-984.107) (-981.378) -- 0:03:43
165000 -- [-970.428] (-979.586) (-979.277) (-985.736) * (-989.564) [-979.652] (-985.571) (-976.476) -- 0:03:42
Average standard deviation of split frequencies: 0.017039
165500 -- (-991.617) (-980.030) [-968.636] (-980.392) * (-989.056) [-977.547] (-985.863) (-977.969) -- 0:03:46
166000 -- [-984.036] (-990.654) (-972.206) (-981.297) * [-964.534] (-973.951) (-984.627) (-986.939) -- 0:03:46
166500 -- [-981.138] (-979.198) (-978.383) (-982.767) * (-971.000) (-979.098) (-992.066) [-972.373] -- 0:03:45
167000 -- (-982.736) (-975.239) [-973.506] (-985.108) * (-969.115) (-989.484) (-995.693) [-971.803] -- 0:03:44
167500 -- (-985.279) (-979.943) [-968.505] (-981.452) * [-968.088] (-969.640) (-983.933) (-987.563) -- 0:03:43
168000 -- (-974.947) (-972.968) (-971.732) [-993.704] * (-973.350) (-988.182) [-983.322] (-982.324) -- 0:03:42
168500 -- [-967.013] (-979.820) (-977.333) (-1000.678) * [-974.201] (-983.593) (-987.290) (-993.221) -- 0:03:42
169000 -- [-966.672] (-969.199) (-968.759) (-976.981) * (-977.689) (-979.687) [-983.438] (-985.126) -- 0:03:46
169500 -- [-978.408] (-986.643) (-973.038) (-976.629) * (-988.738) (-981.748) (-985.617) [-972.575] -- 0:03:45
170000 -- [-972.895] (-985.175) (-985.855) (-990.377) * [-979.617] (-969.626) (-985.730) (-978.389) -- 0:03:44
Average standard deviation of split frequencies: 0.015760
170500 -- (-973.897) (-988.452) [-972.924] (-983.223) * (-984.019) [-972.811] (-981.316) (-981.810) -- 0:03:43
171000 -- (-992.921) (-978.370) [-978.930] (-972.312) * (-976.624) [-968.422] (-989.733) (-977.297) -- 0:03:43
171500 -- (-980.581) (-977.935) (-984.998) [-972.712] * [-979.538] (-970.305) (-999.183) (-973.196) -- 0:03:42
172000 -- [-971.971] (-970.135) (-978.308) (-976.938) * (-983.045) (-986.271) (-986.370) [-984.453] -- 0:03:41
172500 -- [-978.172] (-975.783) (-982.978) (-973.805) * (-978.876) (-987.224) (-982.046) [-984.578] -- 0:03:45
173000 -- (-975.124) [-981.104] (-974.590) (-980.899) * (-979.871) (-983.569) (-976.000) [-978.748] -- 0:03:44
173500 -- (-970.161) (-976.712) (-981.020) [-980.448] * [-979.662] (-979.374) (-988.731) (-977.663) -- 0:03:43
174000 -- (-971.265) (-971.077) [-971.864] (-980.320) * (-976.881) [-978.417] (-983.784) (-980.472) -- 0:03:43
174500 -- (-979.091) (-986.031) [-979.399] (-987.639) * (-985.617) (-981.113) [-980.024] (-980.134) -- 0:03:42
175000 -- [-975.872] (-972.133) (-988.193) (-990.849) * (-974.552) [-978.467] (-973.253) (-976.473) -- 0:03:41
Average standard deviation of split frequencies: 0.014731
175500 -- (-978.039) [-974.137] (-981.243) (-978.354) * (-984.692) (-975.927) (-971.902) [-968.219] -- 0:03:40
176000 -- [-982.232] (-974.943) (-975.853) (-988.003) * (-982.374) (-968.665) [-971.837] (-983.981) -- 0:03:40
176500 -- (-978.046) (-982.505) [-969.579] (-980.533) * (-988.540) [-979.444] (-982.009) (-973.011) -- 0:03:43
177000 -- [-978.397] (-979.641) (-980.300) (-982.725) * (-982.856) (-966.828) [-971.260] (-980.721) -- 0:03:43
177500 -- (-987.921) [-980.979] (-974.340) (-982.046) * (-977.329) (-972.230) [-980.257] (-990.948) -- 0:03:42
178000 -- (-979.821) (-978.176) [-972.168] (-990.280) * (-981.762) [-969.989] (-976.789) (-982.293) -- 0:03:41
178500 -- (-983.430) (-986.403) (-967.167) [-979.315] * [-982.406] (-983.240) (-967.421) (-983.274) -- 0:03:40
179000 -- (-979.611) (-976.380) [-975.145] (-985.123) * (-985.150) [-975.926] (-973.244) (-976.851) -- 0:03:40
179500 -- (-983.740) [-980.552] (-972.071) (-987.577) * (-980.192) (-975.251) [-974.731] (-987.452) -- 0:03:39
180000 -- (-981.951) [-972.112] (-981.582) (-987.410) * (-981.303) [-982.112] (-962.250) (-983.211) -- 0:03:43
Average standard deviation of split frequencies: 0.013660
180500 -- (-986.882) [-982.556] (-971.075) (-984.715) * [-983.179] (-988.852) (-979.618) (-995.386) -- 0:03:42
181000 -- (-978.694) [-968.764] (-979.750) (-986.281) * [-981.047] (-978.133) (-992.865) (-980.764) -- 0:03:41
181500 -- (-1000.694) [-971.449] (-984.421) (-984.297) * (-971.507) (-980.809) (-985.410) [-985.040] -- 0:03:40
182000 -- [-976.601] (-977.741) (-975.248) (-992.233) * (-989.118) [-975.110] (-977.701) (-974.567) -- 0:03:40
182500 -- (-973.850) [-974.460] (-982.463) (-987.524) * (-984.516) (-990.994) (-972.501) [-971.973] -- 0:03:39
183000 -- (-974.295) (-977.924) [-975.242] (-992.052) * (-989.075) (-984.857) (-978.692) [-973.430] -- 0:03:38
183500 -- [-972.433] (-987.001) (-986.471) (-982.390) * (-985.512) (-982.814) (-982.451) [-979.474] -- 0:03:38
184000 -- (-981.554) [-978.188] (-989.372) (-975.224) * (-972.083) (-974.544) [-974.508] (-990.777) -- 0:03:41
184500 -- (-968.960) (-983.417) [-981.985] (-984.412) * [-974.011] (-973.072) (-976.755) (-996.928) -- 0:03:41
185000 -- (-987.147) (-989.125) (-984.768) [-975.280] * [-971.368] (-976.846) (-972.962) (-977.114) -- 0:03:40
Average standard deviation of split frequencies: 0.013095
185500 -- [-974.493] (-985.995) (-977.058) (-977.464) * [-974.304] (-981.926) (-982.010) (-971.425) -- 0:03:39
186000 -- (-977.985) [-974.203] (-977.417) (-973.407) * (-978.237) (-982.838) (-986.223) [-971.335] -- 0:03:38
186500 -- (-979.960) (-990.450) (-993.567) [-977.410] * (-979.495) (-970.922) (-978.249) [-972.928] -- 0:03:38
187000 -- [-980.317] (-974.595) (-975.909) (-977.552) * (-973.256) (-978.606) [-966.685] (-980.047) -- 0:03:37
187500 -- (-980.783) [-971.083] (-975.549) (-974.535) * (-971.848) (-977.078) [-967.129] (-990.833) -- 0:03:41
188000 -- (-984.268) [-974.796] (-977.702) (-977.149) * (-987.724) [-970.226] (-993.896) (-971.333) -- 0:03:40
188500 -- (-994.938) [-972.882] (-979.919) (-981.869) * (-984.030) (-991.936) (-984.063) [-977.819] -- 0:03:39
189000 -- (-975.458) [-976.821] (-978.596) (-976.014) * (-979.261) (-990.610) (-982.278) [-979.198] -- 0:03:38
189500 -- [-969.988] (-981.081) (-972.386) (-984.948) * [-975.879] (-986.235) (-984.654) (-977.800) -- 0:03:38
190000 -- (-985.920) (-987.877) (-974.526) [-978.621] * [-968.758] (-981.546) (-989.412) (-974.667) -- 0:03:37
Average standard deviation of split frequencies: 0.012225
190500 -- [-976.884] (-982.699) (-974.534) (-983.110) * [-980.570] (-986.787) (-976.468) (-974.875) -- 0:03:36
191000 -- [-973.176] (-979.390) (-975.396) (-995.402) * (-982.075) (-984.717) [-980.885] (-978.375) -- 0:03:36
191500 -- (-991.067) [-984.799] (-981.670) (-970.327) * (-977.305) (-978.950) (-979.662) [-972.628] -- 0:03:39
192000 -- (-987.222) (-979.044) [-974.933] (-985.804) * (-973.876) (-990.101) (-984.324) [-976.038] -- 0:03:38
192500 -- [-978.674] (-978.421) (-980.889) (-981.536) * (-990.518) (-982.677) (-981.286) [-970.528] -- 0:03:38
193000 -- [-972.143] (-986.799) (-989.409) (-973.551) * [-975.852] (-973.968) (-974.241) (-975.976) -- 0:03:37
193500 -- [-973.936] (-977.561) (-985.777) (-973.774) * [-971.150] (-978.469) (-986.699) (-982.828) -- 0:03:36
194000 -- (-979.698) (-981.249) (-974.919) [-986.919] * (-980.836) [-974.280] (-985.261) (-987.346) -- 0:03:36
194500 -- (-976.832) [-972.946] (-985.359) (-975.728) * (-986.057) (-973.940) [-973.955] (-1000.796) -- 0:03:35
195000 -- (-978.011) (-984.357) [-981.520] (-986.001) * [-971.215] (-979.143) (-993.116) (-986.744) -- 0:03:38
Average standard deviation of split frequencies: 0.012159
195500 -- (-977.891) (-984.450) (-987.928) [-978.974] * (-979.271) [-976.658] (-986.948) (-983.548) -- 0:03:38
196000 -- [-975.821] (-976.969) (-978.634) (-993.009) * (-972.749) [-976.459] (-985.385) (-986.166) -- 0:03:37
196500 -- (-977.046) (-972.753) (-984.848) [-980.389] * (-979.804) [-978.736] (-984.236) (-982.429) -- 0:03:36
197000 -- (-987.766) [-983.164] (-979.040) (-987.168) * (-986.005) (-977.465) [-970.783] (-986.541) -- 0:03:36
197500 -- (-981.682) (-980.346) (-975.550) [-980.340] * (-986.153) (-976.560) [-973.301] (-982.665) -- 0:03:35
198000 -- (-989.716) (-978.575) [-977.986] (-982.844) * (-984.330) [-979.992] (-981.509) (-981.691) -- 0:03:34
198500 -- (-980.213) (-988.535) [-986.039] (-988.676) * (-981.229) (-983.105) (-976.917) [-972.347] -- 0:03:34
199000 -- (-970.169) (-977.290) [-982.484] (-980.074) * (-992.182) (-978.801) (-982.423) [-979.169] -- 0:03:37
199500 -- [-983.760] (-978.397) (-975.693) (-983.595) * (-980.236) (-972.576) (-991.375) [-976.677] -- 0:03:36
200000 -- (-975.493) (-977.210) [-973.232] (-981.564) * (-972.849) [-977.058] (-981.527) (-995.306) -- 0:03:36
Average standard deviation of split frequencies: 0.012007
200500 -- (-982.200) (-985.742) [-972.517] (-983.404) * (-988.636) (-981.965) [-983.372] (-977.369) -- 0:03:35
201000 -- (-972.050) [-972.181] (-976.618) (-977.340) * (-985.673) [-980.792] (-971.010) (-987.734) -- 0:03:34
201500 -- (-973.379) [-974.699] (-974.161) (-982.394) * [-983.771] (-986.504) (-976.980) (-981.983) -- 0:03:33
202000 -- (-980.331) [-971.620] (-988.518) (-985.124) * [-977.720] (-984.915) (-981.529) (-974.311) -- 0:03:33
202500 -- [-966.671] (-981.982) (-983.164) (-978.960) * (-982.527) (-994.048) (-972.899) [-975.443] -- 0:03:36
203000 -- (-974.616) (-975.049) [-973.231] (-983.119) * (-979.961) (-979.801) [-973.653] (-978.184) -- 0:03:35
203500 -- (-973.939) (-970.119) [-971.178] (-989.760) * (-976.582) (-978.902) (-990.450) [-981.615] -- 0:03:35
204000 -- [-974.040] (-979.140) (-970.501) (-992.697) * (-971.316) (-978.177) [-977.352] (-989.952) -- 0:03:34
204500 -- [-969.334] (-979.054) (-977.563) (-983.421) * [-970.853] (-997.783) (-979.495) (-985.509) -- 0:03:33
205000 -- (-978.971) (-988.926) [-969.424] (-987.717) * (-981.138) (-987.073) (-988.608) [-978.823] -- 0:03:33
Average standard deviation of split frequencies: 0.010933
205500 -- (-975.956) (-980.233) [-979.498] (-976.191) * [-967.442] (-986.371) (-973.477) (-977.266) -- 0:03:32
206000 -- (-980.769) (-976.349) [-975.668] (-975.529) * (-985.281) (-973.306) (-982.410) [-985.819] -- 0:03:31
206500 -- [-971.753] (-978.193) (-981.102) (-981.118) * (-982.686) [-980.312] (-974.968) (-977.372) -- 0:03:35
207000 -- (-976.711) (-975.882) (-981.463) [-976.325] * (-988.474) (-980.666) [-984.216] (-985.143) -- 0:03:34
207500 -- (-971.478) (-985.842) [-968.514] (-982.569) * (-979.984) (-980.312) [-971.893] (-985.993) -- 0:03:33
208000 -- (-977.875) (-980.498) [-974.145] (-979.139) * (-972.884) [-975.638] (-970.057) (-991.432) -- 0:03:33
208500 -- (-981.500) (-991.540) [-973.569] (-980.482) * (-979.490) (-988.017) (-985.275) [-977.321] -- 0:03:32
209000 -- (-980.845) [-977.374] (-984.543) (-984.269) * (-978.319) (-979.375) (-968.566) [-972.131] -- 0:03:31
209500 -- (-994.976) (-987.677) (-977.918) [-975.613] * (-974.457) [-976.855] (-974.550) (-976.267) -- 0:03:31
210000 -- (-1000.452) (-978.001) (-978.904) [-966.994] * (-972.916) [-973.911] (-974.926) (-974.127) -- 0:03:34
Average standard deviation of split frequencies: 0.011810
210500 -- (-987.481) (-972.408) [-970.211] (-978.113) * (-982.579) [-969.919] (-984.074) (-982.522) -- 0:03:33
211000 -- (-981.809) (-974.524) (-988.987) [-974.507] * (-974.967) (-974.137) (-977.233) [-974.855] -- 0:03:33
211500 -- (-982.426) (-970.636) [-970.219] (-978.036) * (-964.906) [-986.925] (-975.973) (-983.018) -- 0:03:32
212000 -- (-992.167) [-967.933] (-974.039) (-992.881) * [-971.523] (-992.090) (-985.535) (-981.114) -- 0:03:31
212500 -- (-974.832) (-973.836) [-976.258] (-986.454) * (-991.819) (-985.947) (-987.363) [-973.032] -- 0:03:31
213000 -- (-983.096) (-967.825) [-966.963] (-977.589) * (-982.950) [-977.632] (-977.627) (-971.795) -- 0:03:30
213500 -- (-984.110) [-973.017] (-974.326) (-981.350) * (-980.802) (-982.737) [-982.869] (-990.593) -- 0:03:33
214000 -- [-976.467] (-977.539) (-977.106) (-979.279) * (-978.143) [-980.297] (-980.551) (-986.277) -- 0:03:33
214500 -- (-980.354) (-982.859) (-973.774) [-977.222] * (-983.677) (-969.590) (-994.199) [-978.457] -- 0:03:32
215000 -- (-982.449) (-980.823) [-974.204] (-992.925) * [-974.431] (-976.122) (-980.735) (-983.674) -- 0:03:31
Average standard deviation of split frequencies: 0.012488
215500 -- [-975.044] (-988.761) (-979.341) (-978.317) * (-994.066) (-970.094) [-970.880] (-987.962) -- 0:03:31
216000 -- [-970.012] (-980.489) (-969.484) (-975.530) * (-982.763) (-985.144) [-969.025] (-977.028) -- 0:03:30
216500 -- (-983.673) [-986.495] (-982.362) (-984.843) * (-980.044) (-981.080) [-979.100] (-987.346) -- 0:03:29
217000 -- (-981.121) (-991.163) (-979.536) [-984.603] * (-990.470) (-987.151) (-980.445) [-973.969] -- 0:03:32
217500 -- (-976.677) [-972.069] (-974.780) (-990.705) * (-970.546) [-978.730] (-982.669) (-985.687) -- 0:03:32
218000 -- (-977.764) [-971.308] (-979.967) (-986.709) * (-982.082) (-976.313) [-974.801] (-973.189) -- 0:03:31
218500 -- (-992.951) (-977.295) (-986.192) [-973.851] * (-993.990) (-981.153) [-976.729] (-979.401) -- 0:03:31
219000 -- (-982.810) [-984.472] (-982.098) (-977.800) * (-995.482) (-988.766) [-973.732] (-980.005) -- 0:03:30
219500 -- (-976.558) [-966.501] (-974.578) (-979.913) * (-985.824) [-980.391] (-977.994) (-987.908) -- 0:03:29
220000 -- [-977.456] (-978.767) (-993.722) (-973.667) * [-981.796] (-976.401) (-975.880) (-977.244) -- 0:03:29
Average standard deviation of split frequencies: 0.012106
220500 -- [-971.261] (-980.267) (-972.894) (-982.662) * (-987.802) (-988.660) (-975.435) [-979.873] -- 0:03:28
221000 -- (-983.172) (-970.722) [-979.957] (-985.898) * (-987.940) [-970.881] (-984.840) (-982.017) -- 0:03:31
221500 -- (-984.835) (-976.057) (-976.979) [-986.327] * (-996.825) (-974.541) (-985.045) [-975.652] -- 0:03:30
222000 -- (-985.918) (-987.494) (-982.377) [-971.826] * (-976.581) (-988.016) (-982.152) [-976.741] -- 0:03:30
222500 -- [-973.283] (-979.898) (-981.921) (-979.577) * (-979.120) (-981.484) [-971.902] (-986.008) -- 0:03:29
223000 -- (-977.285) (-980.751) (-976.856) [-973.389] * [-970.674] (-974.571) (-983.468) (-977.627) -- 0:03:29
223500 -- [-976.846] (-977.000) (-976.882) (-972.564) * (-991.006) (-971.320) (-977.892) [-969.377] -- 0:03:28
224000 -- (-972.136) (-978.724) (-977.848) [-977.104] * (-979.407) [-975.652] (-982.848) (-982.124) -- 0:03:27
224500 -- (-975.823) (-980.290) (-979.205) [-971.490] * (-980.350) (-973.698) (-975.452) [-977.487] -- 0:03:30
225000 -- [-974.688] (-984.987) (-979.990) (-989.675) * (-981.903) (-979.383) (-981.988) [-978.608] -- 0:03:30
Average standard deviation of split frequencies: 0.012979
225500 -- (-982.210) (-982.865) [-979.818] (-978.158) * (-979.839) (-981.032) [-975.318] (-981.488) -- 0:03:29
226000 -- [-978.275] (-986.173) (-981.978) (-977.655) * [-968.892] (-979.429) (-980.039) (-985.177) -- 0:03:28
226500 -- (-981.113) (-986.406) [-971.054] (-985.294) * (-985.325) (-975.535) (-995.759) [-979.824] -- 0:03:28
227000 -- (-983.430) [-975.030] (-970.464) (-986.005) * (-985.579) (-982.860) (-990.300) [-978.059] -- 0:03:27
227500 -- (-971.830) [-974.708] (-980.378) (-981.434) * (-976.371) (-976.275) (-983.097) [-964.648] -- 0:03:27
228000 -- [-976.186] (-980.894) (-982.388) (-999.182) * (-975.614) (-969.111) (-982.044) [-972.963] -- 0:03:29
228500 -- [-974.686] (-978.447) (-982.847) (-979.093) * (-979.288) [-977.945] (-977.711) (-980.358) -- 0:03:29
229000 -- [-976.420] (-994.700) (-976.199) (-983.600) * (-976.492) (-986.221) [-975.274] (-978.533) -- 0:03:28
229500 -- (-982.247) (-984.113) [-977.879] (-994.428) * [-973.732] (-986.087) (-977.470) (-979.671) -- 0:03:28
230000 -- (-984.490) [-977.576] (-982.962) (-976.515) * [-974.699] (-980.444) (-973.936) (-985.271) -- 0:03:27
Average standard deviation of split frequencies: 0.012489
230500 -- [-975.849] (-997.290) (-977.779) (-988.730) * (-975.707) (-974.347) [-971.175] (-983.668) -- 0:03:26
231000 -- (-973.581) [-980.605] (-991.803) (-981.263) * (-988.264) [-983.951] (-972.264) (-985.750) -- 0:03:26
231500 -- (-975.100) [-978.890] (-986.815) (-985.718) * (-982.490) [-971.497] (-974.032) (-977.705) -- 0:03:25
232000 -- (-986.910) [-973.478] (-983.935) (-983.073) * (-978.936) [-970.457] (-985.592) (-993.466) -- 0:03:28
232500 -- (-991.695) (-977.635) (-983.787) [-980.010] * (-976.739) [-976.569] (-975.198) (-972.397) -- 0:03:27
233000 -- (-981.830) [-979.039] (-981.214) (-987.771) * (-984.217) (-975.292) (-976.275) [-976.098] -- 0:03:27
233500 -- [-974.331] (-974.720) (-977.068) (-978.261) * (-984.268) [-966.947] (-994.746) (-980.025) -- 0:03:26
234000 -- (-975.244) (-984.250) (-980.122) [-975.206] * (-985.960) (-975.183) (-980.921) [-972.790] -- 0:03:26
234500 -- [-971.630] (-980.678) (-999.182) (-981.186) * (-985.050) (-982.934) [-975.679] (-982.249) -- 0:03:25
235000 -- [-975.442] (-986.997) (-981.949) (-982.935) * (-987.423) [-968.806] (-987.698) (-973.680) -- 0:03:25
Average standard deviation of split frequencies: 0.013206
235500 -- (-980.661) (-976.616) (-984.331) [-976.003] * (-994.745) (-979.599) [-984.097] (-975.902) -- 0:03:27
236000 -- (-984.448) (-986.159) (-983.759) [-968.499] * (-986.118) (-984.561) [-977.508] (-978.984) -- 0:03:27
236500 -- [-986.178] (-987.952) (-983.322) (-978.180) * (-976.221) [-977.216] (-989.008) (-971.161) -- 0:03:26
237000 -- [-983.756] (-979.008) (-981.530) (-978.066) * [-972.393] (-970.864) (-981.962) (-990.234) -- 0:03:26
237500 -- [-978.029] (-989.785) (-978.811) (-972.797) * (-987.627) (-987.819) (-979.979) [-975.645] -- 0:03:25
238000 -- [-984.449] (-985.978) (-981.558) (-979.352) * (-982.264) (-981.759) (-985.603) [-981.838] -- 0:03:24
238500 -- (-980.831) [-975.229] (-993.126) (-967.462) * (-997.993) (-982.325) [-972.445] (-978.510) -- 0:03:24
239000 -- (-986.161) [-980.130] (-974.468) (-988.586) * (-988.913) (-977.007) (-981.848) [-976.350] -- 0:03:23
239500 -- (-973.545) (-981.602) (-983.930) [-975.945] * (-995.027) (-970.215) (-980.245) [-989.497] -- 0:03:26
240000 -- (-982.597) (-988.392) [-972.537] (-979.104) * (-989.561) (-981.497) (-973.089) [-969.895] -- 0:03:25
Average standard deviation of split frequencies: 0.013167
240500 -- [-968.657] (-975.694) (-981.118) (-978.838) * (-971.417) [-981.011] (-974.570) (-985.382) -- 0:03:25
241000 -- (-989.015) [-969.499] (-981.644) (-982.533) * (-987.771) (-979.011) (-974.472) [-975.675] -- 0:03:24
241500 -- (-982.065) (-985.086) (-976.919) [-978.811] * (-976.995) (-975.454) [-976.091] (-975.237) -- 0:03:24
242000 -- (-983.627) (-977.753) [-970.021] (-977.618) * (-975.455) (-989.130) (-980.251) [-971.623] -- 0:03:23
242500 -- (-986.022) (-996.089) (-982.795) [-978.685] * (-971.819) [-982.755] (-976.809) (-970.410) -- 0:03:23
243000 -- (-979.783) (-985.175) [-974.249] (-986.363) * (-981.951) (-976.791) (-976.202) [-969.529] -- 0:03:22
243500 -- (-977.244) (-979.689) [-980.404] (-989.775) * (-977.216) [-975.552] (-977.779) (-980.609) -- 0:03:25
244000 -- (-985.596) (-985.359) (-974.860) [-979.045] * (-980.075) [-971.317] (-983.375) (-977.611) -- 0:03:24
244500 -- (-992.260) (-971.564) [-978.954] (-972.149) * [-972.674] (-975.044) (-984.713) (-982.265) -- 0:03:23
245000 -- (-980.305) [-973.776] (-979.822) (-979.306) * (-995.279) (-987.427) (-977.276) [-976.904] -- 0:03:23
Average standard deviation of split frequencies: 0.013414
245500 -- (-979.624) (-982.799) (-987.945) [-973.959] * [-982.245] (-980.306) (-974.272) (-981.492) -- 0:03:22
246000 -- (-997.518) (-971.323) (-981.299) [-970.882] * [-978.360] (-979.030) (-977.738) (-979.369) -- 0:03:22
246500 -- (-987.401) [-972.675] (-980.431) (-977.423) * [-969.060] (-981.704) (-978.768) (-977.859) -- 0:03:21
247000 -- (-982.560) [-979.062] (-979.741) (-973.222) * (-974.236) [-969.635] (-977.449) (-979.023) -- 0:03:24
247500 -- [-977.770] (-979.134) (-983.286) (-976.225) * (-979.845) (-977.903) (-976.525) [-971.396] -- 0:03:23
248000 -- (-991.789) (-983.139) (-995.323) [-981.235] * [-980.996] (-978.889) (-985.595) (-978.693) -- 0:03:23
248500 -- (-983.349) (-979.418) (-984.796) [-975.316] * (-972.688) [-980.261] (-990.780) (-981.253) -- 0:03:22
249000 -- [-972.887] (-976.129) (-973.118) (-982.232) * (-978.591) (-985.037) (-997.383) [-978.442] -- 0:03:22
249500 -- (-983.273) (-967.812) (-974.944) [-976.338] * [-975.674] (-976.065) (-992.612) (-992.142) -- 0:03:21
250000 -- (-985.596) (-980.641) [-979.036] (-982.284) * (-975.191) [-980.243] (-976.382) (-981.549) -- 0:03:21
Average standard deviation of split frequencies: 0.014352
250500 -- (-977.971) [-974.550] (-982.793) (-990.968) * (-983.334) (-985.761) [-974.586] (-993.948) -- 0:03:23
251000 -- (-979.202) [-971.839] (-985.531) (-980.860) * [-974.667] (-980.564) (-981.177) (-989.444) -- 0:03:22
251500 -- (-985.297) [-973.642] (-975.523) (-987.604) * (-979.421) (-988.883) (-979.949) [-977.872] -- 0:03:22
252000 -- (-974.060) (-975.260) (-975.350) [-982.011] * (-981.656) (-978.638) (-977.759) [-980.179] -- 0:03:21
252500 -- [-980.810] (-983.099) (-981.630) (-986.148) * (-977.938) (-980.660) (-986.945) [-979.276] -- 0:03:21
253000 -- (-977.926) (-970.801) [-975.948] (-977.145) * [-978.340] (-976.043) (-977.956) (-974.196) -- 0:03:20
253500 -- [-977.033] (-977.682) (-981.671) (-981.155) * (-979.015) (-980.577) [-975.669] (-981.615) -- 0:03:20
254000 -- (-978.089) (-983.453) (-982.354) [-974.894] * (-982.227) (-981.344) (-972.484) [-976.496] -- 0:03:19
254500 -- (-982.565) (-978.626) (-982.395) [-973.346] * (-977.799) (-975.509) (-968.886) [-972.063] -- 0:03:22
255000 -- (-972.691) (-981.254) (-969.082) [-972.774] * [-987.678] (-976.875) (-977.543) (-978.186) -- 0:03:21
Average standard deviation of split frequencies: 0.013197
255500 -- (-974.251) (-976.026) [-972.095] (-985.935) * [-970.466] (-984.436) (-979.713) (-980.767) -- 0:03:21
256000 -- (-992.309) (-977.975) (-984.068) [-973.812] * [-967.587] (-975.953) (-986.244) (-976.391) -- 0:03:20
256500 -- [-975.590] (-988.889) (-978.016) (-986.284) * (-982.184) [-982.283] (-991.598) (-982.424) -- 0:03:20
257000 -- [-985.165] (-979.527) (-980.830) (-976.515) * (-973.326) (-985.774) [-977.540] (-982.237) -- 0:03:19
257500 -- (-981.679) [-969.328] (-980.337) (-988.466) * [-974.066] (-979.295) (-992.590) (-978.620) -- 0:03:18
258000 -- (-986.221) [-975.657] (-995.037) (-980.946) * (-974.650) [-990.997] (-974.911) (-979.203) -- 0:03:21
258500 -- (-985.735) (-981.103) [-980.318] (-989.357) * (-971.701) (-975.970) (-989.927) [-973.068] -- 0:03:20
259000 -- [-970.246] (-967.854) (-986.691) (-982.611) * (-983.113) [-969.007] (-976.194) (-980.460) -- 0:03:20
259500 -- (-975.398) [-969.271] (-974.683) (-980.430) * (-978.855) [-965.585] (-977.335) (-977.881) -- 0:03:19
260000 -- (-976.241) (-976.312) [-971.227] (-984.209) * (-975.307) [-971.104] (-978.874) (-973.929) -- 0:03:19
Average standard deviation of split frequencies: 0.014066
260500 -- [-977.197] (-983.241) (-990.281) (-986.688) * [-967.724] (-968.703) (-978.744) (-982.555) -- 0:03:18
261000 -- (-975.552) [-981.760] (-990.831) (-975.425) * (-978.107) (-972.591) (-987.640) [-977.765] -- 0:03:18
261500 -- (-979.742) (-983.292) (-977.328) [-971.017] * (-984.139) [-973.454] (-980.500) (-982.108) -- 0:03:17
262000 -- (-984.440) (-980.511) [-975.740] (-978.505) * (-979.105) (-973.323) [-980.654] (-984.532) -- 0:03:19
262500 -- (-971.830) (-970.968) [-979.395] (-982.862) * (-972.772) [-971.606] (-973.996) (-982.954) -- 0:03:19
263000 -- (-973.553) (-993.265) (-977.768) [-973.347] * (-978.795) [-973.159] (-983.070) (-976.829) -- 0:03:18
263500 -- [-973.250] (-988.236) (-975.168) (-985.864) * (-986.721) [-971.561] (-983.106) (-984.966) -- 0:03:18
264000 -- (-980.654) (-976.793) [-970.039] (-980.372) * (-976.277) [-975.758] (-976.681) (-984.654) -- 0:03:17
264500 -- (-990.166) [-971.305] (-976.561) (-981.717) * [-978.436] (-977.554) (-976.332) (-980.305) -- 0:03:17
265000 -- [-969.500] (-974.004) (-977.384) (-975.629) * (-980.874) (-975.089) (-983.028) [-972.552] -- 0:03:16
Average standard deviation of split frequencies: 0.013784
265500 -- (-990.837) (-972.939) (-983.552) [-978.164] * [-970.765] (-984.804) (-979.539) (-988.925) -- 0:03:19
266000 -- (-989.473) (-977.882) [-973.847] (-980.728) * (-976.479) (-984.234) [-977.205] (-974.326) -- 0:03:18
266500 -- (-984.067) (-980.320) (-977.858) [-975.029] * (-982.909) [-970.526] (-975.003) (-971.479) -- 0:03:18
267000 -- [-977.957] (-973.017) (-978.023) (-987.818) * (-980.601) (-978.048) (-983.259) [-975.647] -- 0:03:17
267500 -- (-990.332) (-984.271) (-968.238) [-972.217] * (-990.654) (-980.382) [-975.031] (-978.471) -- 0:03:17
268000 -- (-983.405) (-978.310) (-981.428) [-975.690] * (-989.957) (-977.059) [-980.078] (-967.262) -- 0:03:16
268500 -- (-987.207) [-973.515] (-979.803) (-972.601) * (-984.908) (-969.332) [-973.025] (-987.215) -- 0:03:16
269000 -- (-988.503) (-988.702) (-981.471) [-971.840] * (-988.861) (-986.539) (-988.882) [-976.879] -- 0:03:15
269500 -- (-980.303) (-995.436) [-973.086] (-981.464) * (-1003.371) [-972.547] (-982.296) (-981.190) -- 0:03:17
270000 -- (-978.482) (-976.861) (-977.501) [-976.843] * (-976.548) (-982.547) (-987.140) [-985.345] -- 0:03:17
Average standard deviation of split frequencies: 0.014320
270500 -- (-975.480) (-975.535) (-966.924) [-974.011] * (-992.131) (-978.034) (-983.252) [-970.948] -- 0:03:16
271000 -- (-979.229) [-975.973] (-974.750) (-985.620) * (-998.214) (-972.137) [-977.458] (-967.297) -- 0:03:16
271500 -- (-973.830) [-981.822] (-975.929) (-975.270) * (-999.489) (-975.492) [-977.120] (-975.971) -- 0:03:15
272000 -- (-987.450) (-974.548) (-992.287) [-973.431] * (-991.623) (-979.067) [-972.507] (-979.682) -- 0:03:15
272500 -- (-978.659) (-987.281) [-975.201] (-977.093) * [-986.642] (-977.437) (-979.751) (-976.596) -- 0:03:14
273000 -- [-978.504] (-980.124) (-986.203) (-968.770) * (-981.549) (-985.651) [-985.036] (-973.678) -- 0:03:17
273500 -- (-971.364) (-970.877) (-973.489) [-970.008] * (-990.330) (-976.016) [-972.148] (-971.158) -- 0:03:16
274000 -- (-977.834) (-967.566) [-980.531] (-999.289) * [-979.905] (-985.381) (-973.576) (-981.502) -- 0:03:16
274500 -- (-980.237) [-972.295] (-980.431) (-997.184) * (-981.827) (-985.942) [-971.746] (-980.186) -- 0:03:15
275000 -- [-969.419] (-979.655) (-987.097) (-988.509) * (-988.424) [-969.133] (-977.402) (-975.381) -- 0:03:15
Average standard deviation of split frequencies: 0.014423
275500 -- (-982.622) (-981.330) (-982.026) [-984.392] * (-973.732) (-980.644) [-980.172] (-989.439) -- 0:03:14
276000 -- (-986.214) (-976.659) (-979.278) [-978.714] * [-977.491] (-976.931) (-983.744) (-989.202) -- 0:03:14
276500 -- [-974.875] (-975.709) (-978.476) (-982.037) * (-987.533) [-969.392] (-980.993) (-971.609) -- 0:03:13
277000 -- (-977.259) (-977.113) [-973.609] (-970.084) * (-981.790) (-974.144) (-972.242) [-971.592] -- 0:03:15
277500 -- (-976.093) (-978.409) (-978.928) [-971.234] * [-975.749] (-992.865) (-981.295) (-976.317) -- 0:03:15
278000 -- (-980.734) (-993.181) [-979.447] (-978.080) * (-989.199) (-977.841) [-979.283] (-984.098) -- 0:03:14
278500 -- (-974.519) (-991.629) [-975.125] (-975.458) * [-987.014] (-979.603) (-982.244) (-979.367) -- 0:03:14
279000 -- (-970.595) [-971.041] (-976.770) (-998.716) * (-999.305) (-979.608) [-977.804] (-969.381) -- 0:03:13
279500 -- (-981.667) (-986.070) (-977.164) [-980.564] * (-989.364) [-980.796] (-990.931) (-989.203) -- 0:03:13
280000 -- (-982.278) [-976.151] (-977.536) (-985.493) * (-988.594) (-978.404) [-978.027] (-976.132) -- 0:03:12
Average standard deviation of split frequencies: 0.014743
280500 -- (-983.523) (-976.093) [-969.707] (-983.087) * (-988.568) (-972.018) (-975.563) [-971.304] -- 0:03:14
281000 -- (-981.918) (-970.678) (-978.409) [-977.916] * (-992.551) (-979.603) (-981.631) [-980.059] -- 0:03:14
281500 -- (-980.628) [-972.834] (-984.283) (-975.971) * [-982.846] (-982.045) (-985.144) (-983.476) -- 0:03:13
282000 -- (-980.233) (-979.092) [-971.511] (-979.819) * (-993.520) (-978.927) (-990.827) [-973.907] -- 0:03:13
282500 -- [-972.992] (-969.429) (-983.817) (-982.266) * (-992.691) [-973.207] (-988.219) (-971.978) -- 0:03:13
283000 -- (-978.691) (-982.378) (-984.516) [-972.122] * (-998.145) [-981.770] (-979.559) (-979.243) -- 0:03:12
283500 -- (-977.377) (-981.224) (-986.500) [-981.269] * (-993.114) (-976.752) (-973.599) [-976.987] -- 0:03:12
284000 -- [-976.972] (-981.468) (-992.333) (-991.678) * [-973.853] (-972.438) (-979.228) (-994.510) -- 0:03:14
284500 -- (-979.132) (-989.033) (-975.078) [-987.148] * (-988.926) [-976.118] (-978.239) (-972.676) -- 0:03:13
285000 -- [-981.673] (-988.302) (-982.152) (-988.965) * [-978.263] (-990.347) (-980.746) (-973.563) -- 0:03:13
Average standard deviation of split frequencies: 0.015528
285500 -- (-984.070) [-979.184] (-987.476) (-979.263) * (-988.852) (-988.499) [-982.520] (-976.343) -- 0:03:12
286000 -- (-976.917) [-968.151] (-987.636) (-980.235) * (-982.327) [-977.848] (-978.399) (-983.392) -- 0:03:12
286500 -- (-986.434) [-976.319] (-990.127) (-974.985) * (-988.470) (-972.162) (-974.959) [-977.303] -- 0:03:11
287000 -- (-987.803) (-980.380) (-990.734) [-973.630] * (-992.377) (-977.934) (-983.550) [-977.993] -- 0:03:11
287500 -- (-992.220) [-979.874] (-991.221) (-968.080) * (-985.462) [-979.764] (-980.182) (-980.828) -- 0:03:13
288000 -- (-1000.851) [-975.950] (-970.364) (-978.265) * [-974.403] (-981.290) (-984.263) (-976.956) -- 0:03:12
288500 -- (-976.782) (-975.292) [-975.501] (-979.135) * [-988.322] (-976.019) (-970.736) (-975.349) -- 0:03:12
289000 -- (-974.987) (-975.221) (-973.375) [-969.020] * (-979.584) (-980.854) [-977.814] (-980.972) -- 0:03:11
289500 -- (-972.950) [-974.437] (-982.013) (-978.383) * (-985.747) (-974.596) (-979.864) [-981.429] -- 0:03:11
290000 -- (-979.197) (-989.886) [-975.301] (-977.382) * (-972.377) [-985.445] (-990.253) (-976.876) -- 0:03:10
Average standard deviation of split frequencies: 0.014957
290500 -- (-971.654) (-995.345) [-977.539] (-981.570) * (-971.483) [-979.493] (-981.082) (-971.270) -- 0:03:10
291000 -- (-988.857) (-979.189) (-990.341) [-985.514] * (-981.173) (-982.760) [-972.757] (-983.665) -- 0:03:12
291500 -- (-976.865) [-971.752] (-995.043) (-981.838) * (-976.345) (-990.942) [-980.616] (-980.201) -- 0:03:12
292000 -- (-972.780) (-985.963) [-980.134] (-985.494) * [-975.673] (-977.759) (-972.778) (-984.048) -- 0:03:11
292500 -- (-970.824) [-973.037] (-991.570) (-982.534) * (-981.961) (-987.670) [-972.124] (-969.706) -- 0:03:11
293000 -- (-976.074) [-976.380] (-986.445) (-986.110) * (-981.319) (-977.908) [-970.485] (-968.056) -- 0:03:10
293500 -- (-972.423) (-979.822) [-976.347] (-999.502) * [-972.193] (-978.350) (-990.842) (-982.887) -- 0:03:10
294000 -- (-976.660) (-977.126) [-971.412] (-985.673) * (-982.761) (-976.302) (-982.771) [-978.578] -- 0:03:09
294500 -- (-981.795) [-976.833] (-990.635) (-984.543) * (-1002.617) [-971.095] (-985.779) (-991.249) -- 0:03:09
295000 -- (-979.649) [-973.079] (-982.793) (-978.098) * (-982.679) (-973.055) (-985.380) [-989.356] -- 0:03:11
Average standard deviation of split frequencies: 0.015591
295500 -- (-991.421) [-973.709] (-984.984) (-990.778) * [-978.252] (-970.455) (-987.341) (-985.071) -- 0:03:10
296000 -- (-975.043) [-988.640] (-972.738) (-975.163) * (-969.817) (-973.436) [-983.779] (-1003.663) -- 0:03:10
296500 -- (-979.098) (-980.672) (-983.357) [-981.208] * (-986.564) (-985.189) [-977.328] (-980.524) -- 0:03:09
297000 -- [-972.512] (-971.756) (-989.898) (-976.961) * (-973.834) (-977.144) [-985.729] (-969.790) -- 0:03:09
297500 -- (-974.410) [-975.016] (-978.314) (-978.150) * (-973.986) [-976.952] (-996.499) (-976.703) -- 0:03:08
298000 -- (-976.841) (-975.852) (-975.996) [-973.608] * [-980.586] (-997.356) (-982.178) (-978.480) -- 0:03:08
298500 -- (-978.507) (-984.446) (-974.220) [-970.347] * (-974.844) (-988.235) (-983.368) [-975.116] -- 0:03:10
299000 -- (-987.573) [-979.916] (-993.810) (-977.377) * (-978.190) [-970.313] (-994.138) (-1000.592) -- 0:03:09
299500 -- (-978.605) [-967.816] (-990.380) (-980.997) * (-982.036) (-981.790) [-978.280] (-982.323) -- 0:03:09
300000 -- [-980.899] (-983.547) (-991.881) (-979.977) * (-980.128) (-981.900) [-971.548] (-979.560) -- 0:03:09
Average standard deviation of split frequencies: 0.013533
300500 -- [-978.908] (-990.683) (-989.537) (-975.055) * (-980.416) (-981.852) (-975.963) [-978.852] -- 0:03:08
301000 -- (-982.378) (-981.279) [-975.047] (-988.165) * (-992.530) [-975.414] (-980.809) (-993.054) -- 0:03:08
301500 -- (-972.519) [-975.736] (-971.752) (-979.921) * (-985.266) (-979.312) [-974.194] (-985.404) -- 0:03:07
302000 -- (-992.188) [-976.320] (-973.937) (-984.589) * (-979.761) [-973.405] (-979.132) (-976.172) -- 0:03:09
302500 -- (-972.593) (-987.651) (-986.623) [-973.925] * [-976.626] (-980.280) (-982.706) (-968.208) -- 0:03:09
303000 -- (-978.311) [-982.995] (-979.229) (-989.505) * (-971.124) (-977.274) (-991.422) [-971.535] -- 0:03:08
303500 -- (-976.294) (-976.046) [-970.004] (-972.172) * (-968.980) (-973.678) [-982.893] (-980.144) -- 0:03:08
304000 -- (-978.564) (-982.708) (-970.901) [-966.492] * (-974.218) (-983.106) [-975.613] (-979.210) -- 0:03:07
304500 -- (-978.013) [-977.270] (-970.294) (-976.059) * [-974.299] (-981.729) (-982.031) (-984.441) -- 0:03:07
305000 -- (-980.309) (-983.195) [-975.329] (-979.362) * [-970.070] (-983.248) (-982.251) (-980.621) -- 0:03:06
Average standard deviation of split frequencies: 0.012811
305500 -- [-979.093] (-988.689) (-978.288) (-975.626) * (-986.245) (-985.378) [-981.485] (-981.224) -- 0:03:06
306000 -- [-977.852] (-980.091) (-980.531) (-981.249) * (-981.082) [-969.836] (-980.697) (-983.158) -- 0:03:08
306500 -- [-973.689] (-981.198) (-989.509) (-973.357) * (-978.857) (-980.759) (-983.865) [-974.633] -- 0:03:07
307000 -- (-985.116) (-972.470) (-983.000) [-979.776] * (-975.732) [-984.548] (-981.867) (-984.114) -- 0:03:07
307500 -- [-969.360] (-988.232) (-981.951) (-972.287) * [-976.053] (-980.958) (-990.544) (-981.126) -- 0:03:06
308000 -- [-972.347] (-984.041) (-980.252) (-975.354) * [-978.062] (-974.747) (-983.101) (-983.035) -- 0:03:06
308500 -- (-973.060) (-988.417) (-985.830) [-977.282] * (-972.174) (-985.268) (-987.851) [-984.142] -- 0:03:06
309000 -- (-975.422) (-989.993) (-987.066) [-983.323] * (-977.727) (-980.060) (-985.344) [-983.032] -- 0:03:05
309500 -- (-985.393) (-989.410) [-985.059] (-971.940) * (-978.794) (-989.035) [-979.357] (-989.355) -- 0:03:07
310000 -- (-980.596) (-987.449) [-976.182] (-987.234) * (-980.434) (-985.220) [-979.381] (-979.919) -- 0:03:06
Average standard deviation of split frequencies: 0.013177
310500 -- (-984.085) (-976.987) [-971.577] (-980.822) * (-967.715) (-993.897) [-969.866] (-988.595) -- 0:03:06
311000 -- [-972.992] (-984.818) (-978.678) (-985.954) * (-987.227) (-974.161) (-979.865) [-984.212] -- 0:03:06
311500 -- (-978.547) [-969.957] (-974.667) (-993.033) * (-980.058) [-978.105] (-974.183) (-976.307) -- 0:03:05
312000 -- (-975.376) (-969.211) [-973.330] (-990.970) * (-981.876) (-972.812) [-974.387] (-993.449) -- 0:03:05
312500 -- (-984.225) (-974.495) [-981.170] (-983.411) * (-988.652) [-972.832] (-992.272) (-981.274) -- 0:03:04
313000 -- [-981.480] (-971.536) (-978.589) (-982.651) * (-991.987) (-985.688) [-975.461] (-976.551) -- 0:03:06
313500 -- (-999.048) (-978.341) (-974.057) [-972.806] * [-981.735] (-980.103) (-974.084) (-978.393) -- 0:03:06
314000 -- [-977.308] (-981.899) (-977.309) (-977.429) * (-984.009) [-973.823] (-978.285) (-981.217) -- 0:03:05
314500 -- (-985.214) (-982.178) (-974.902) [-980.764] * (-978.700) (-982.814) [-976.401] (-979.670) -- 0:03:05
315000 -- (-973.636) (-975.385) [-970.040] (-979.357) * (-977.140) [-972.599] (-980.041) (-990.546) -- 0:03:04
Average standard deviation of split frequencies: 0.012597
315500 -- (-992.214) (-984.083) (-979.550) [-977.728] * (-977.491) (-986.770) [-977.350] (-982.188) -- 0:03:04
316000 -- [-979.037] (-988.101) (-976.408) (-992.429) * (-977.457) (-981.865) (-971.205) [-969.431] -- 0:03:03
316500 -- (-973.944) (-976.890) [-979.649] (-988.884) * (-971.601) (-984.810) (-980.511) [-978.340] -- 0:03:03
317000 -- (-980.756) (-980.990) (-977.334) [-985.017] * (-981.034) (-981.220) (-973.989) [-980.999] -- 0:03:05
317500 -- (-986.020) [-991.769] (-971.250) (-990.569) * (-974.693) (-975.968) (-977.660) [-982.891] -- 0:03:04
318000 -- [-973.659] (-979.308) (-981.985) (-992.314) * (-972.034) (-985.145) [-986.465] (-985.927) -- 0:03:04
318500 -- (-977.899) [-979.653] (-980.205) (-987.769) * (-972.414) (-985.908) (-977.606) [-981.546] -- 0:03:04
319000 -- [-971.372] (-998.696) (-969.368) (-975.413) * (-986.886) [-982.652] (-978.888) (-977.212) -- 0:03:03
319500 -- (-966.616) (-986.219) [-971.055] (-987.140) * (-972.236) (-978.141) [-973.371] (-980.169) -- 0:03:03
320000 -- (-971.215) (-980.392) [-974.880] (-975.792) * [-972.503] (-983.572) (-978.038) (-990.385) -- 0:03:02
Average standard deviation of split frequencies: 0.013772
320500 -- (-986.464) (-986.450) (-973.952) [-972.840] * [-971.172] (-979.726) (-988.249) (-982.058) -- 0:03:04
321000 -- [-981.534] (-987.112) (-987.996) (-973.763) * (-976.933) [-976.355] (-985.218) (-992.773) -- 0:03:04
321500 -- (-988.357) [-971.204] (-979.206) (-987.772) * (-978.503) [-972.112] (-986.203) (-977.519) -- 0:03:03
322000 -- (-982.216) (-993.186) [-974.941] (-977.771) * (-987.507) (-982.321) [-979.628] (-979.711) -- 0:03:03
322500 -- [-976.492] (-985.272) (-975.507) (-978.483) * (-993.515) [-975.851] (-981.537) (-979.564) -- 0:03:02
323000 -- (-976.543) (-973.628) (-975.482) [-979.816] * (-973.435) [-977.087] (-979.768) (-981.110) -- 0:03:02
323500 -- (-973.206) (-992.200) (-975.780) [-971.432] * (-977.578) (-986.152) (-976.421) [-972.360] -- 0:03:01
324000 -- (-971.724) (-981.839) [-978.030] (-985.002) * (-983.918) [-969.859] (-977.562) (-984.237) -- 0:03:01
324500 -- (-985.864) (-981.974) (-979.062) [-982.961] * (-989.026) (-974.268) (-974.162) [-977.794] -- 0:03:03
325000 -- (-989.491) (-984.216) (-969.264) [-978.405] * (-992.313) (-979.876) [-974.096] (-967.398) -- 0:03:02
Average standard deviation of split frequencies: 0.013851
325500 -- (-986.038) (-981.148) [-971.511] (-983.920) * (-985.979) (-978.059) (-974.350) [-967.177] -- 0:03:02
326000 -- (-978.731) (-986.196) [-976.542] (-978.861) * (-992.651) (-978.649) [-974.940] (-973.721) -- 0:03:01
326500 -- [-986.299] (-971.206) (-984.487) (-987.441) * (-985.854) [-991.602] (-979.163) (-978.839) -- 0:03:01
327000 -- (-983.050) (-976.900) (-985.600) [-982.290] * (-982.093) (-982.850) [-976.255] (-978.426) -- 0:03:01
327500 -- (-986.648) [-980.636] (-981.163) (-981.245) * (-989.693) [-975.076] (-976.424) (-981.573) -- 0:03:00
328000 -- [-974.989] (-979.731) (-984.514) (-985.662) * (-988.717) [-971.487] (-984.057) (-983.645) -- 0:03:02
328500 -- (-989.148) (-970.031) (-982.622) [-987.862] * (-979.903) [-979.170] (-978.512) (-972.947) -- 0:03:01
329000 -- (-987.611) (-982.900) (-979.634) [-973.204] * [-982.814] (-976.657) (-985.327) (-981.838) -- 0:03:01
329500 -- [-975.480] (-985.613) (-979.743) (-971.218) * (-984.522) (-977.107) [-972.577] (-984.648) -- 0:03:01
330000 -- (-982.015) (-979.992) [-979.407] (-983.589) * (-989.490) [-977.996] (-973.514) (-979.817) -- 0:03:00
Average standard deviation of split frequencies: 0.014031
330500 -- (-986.079) (-982.271) [-974.554] (-983.640) * (-982.854) (-966.995) [-977.890] (-985.442) -- 0:03:00
331000 -- (-982.269) (-978.032) (-977.459) [-970.624] * (-980.223) (-975.163) [-976.351] (-984.032) -- 0:02:59
331500 -- (-974.079) (-978.968) [-975.932] (-978.849) * (-990.632) [-981.467] (-966.726) (-982.078) -- 0:03:01
332000 -- (-975.044) (-981.941) (-976.110) [-988.894] * (-984.136) [-971.455] (-976.448) (-977.381) -- 0:03:01
332500 -- (-973.377) (-984.789) (-977.604) [-974.885] * (-988.957) [-974.079] (-972.524) (-968.830) -- 0:03:00
333000 -- [-970.526] (-979.431) (-969.193) (-986.661) * (-995.761) (-983.254) [-977.640] (-974.940) -- 0:03:00
333500 -- [-971.475] (-977.347) (-980.059) (-981.073) * (-990.307) [-969.639] (-971.230) (-970.055) -- 0:02:59
334000 -- (-984.100) (-979.144) (-993.108) [-978.660] * (-976.466) (-991.393) (-979.525) [-974.465] -- 0:02:59
334500 -- (-978.032) [-973.514] (-976.666) (-978.021) * [-978.181] (-983.300) (-990.941) (-986.673) -- 0:02:59
335000 -- (-991.244) [-979.690] (-980.491) (-975.347) * (-982.360) [-971.610] (-983.613) (-983.083) -- 0:02:58
Average standard deviation of split frequencies: 0.014473
335500 -- (-981.884) [-973.512] (-983.070) (-987.326) * (-986.387) (-975.558) (-976.267) [-974.058] -- 0:03:00
336000 -- (-980.846) (-979.082) (-983.625) [-967.149] * [-974.694] (-981.312) (-970.471) (-977.268) -- 0:02:59
336500 -- (-984.757) (-982.784) (-983.808) [-971.783] * (-976.989) [-971.675] (-974.680) (-975.148) -- 0:02:59
337000 -- (-975.139) (-983.005) (-981.278) [-985.075] * [-975.347] (-990.206) (-979.438) (-978.663) -- 0:02:59
337500 -- (-984.619) (-973.398) (-983.927) [-968.863] * [-984.295] (-977.177) (-984.252) (-979.237) -- 0:02:58
338000 -- (-984.780) (-988.885) [-973.199] (-976.393) * (-986.947) [-980.576] (-985.914) (-983.052) -- 0:02:58
338500 -- (-976.458) (-985.046) (-977.667) [-969.692] * [-974.938] (-980.904) (-970.751) (-976.612) -- 0:02:57
339000 -- (-975.930) (-978.558) [-978.505] (-969.256) * (-973.115) [-969.965] (-984.538) (-983.631) -- 0:02:59
339500 -- (-985.117) (-992.931) [-971.204] (-974.395) * [-981.943] (-996.335) (-976.782) (-976.149) -- 0:02:58
340000 -- (-975.692) (-986.580) [-973.021] (-975.630) * (-976.942) (-973.135) [-971.979] (-977.312) -- 0:02:58
Average standard deviation of split frequencies: 0.014493
340500 -- (-981.871) (-982.296) [-983.802] (-980.887) * (-971.981) (-979.962) (-984.583) [-973.343] -- 0:02:58
341000 -- [-969.083] (-986.932) (-975.493) (-977.241) * (-983.707) (-978.444) (-969.920) [-978.473] -- 0:02:57
341500 -- (-981.782) (-982.732) [-971.369] (-983.771) * [-969.448] (-978.161) (-977.204) (-997.266) -- 0:02:57
342000 -- (-983.845) (-983.673) (-969.413) [-976.559] * (-973.999) [-973.960] (-968.052) (-974.581) -- 0:02:57
342500 -- (-986.684) (-984.803) (-970.592) [-975.183] * (-983.315) [-979.893] (-979.850) (-972.558) -- 0:02:58
343000 -- (-988.177) [-975.153] (-980.417) (-985.865) * (-980.229) [-967.263] (-981.391) (-978.838) -- 0:02:58
343500 -- (-982.989) (-988.352) (-977.993) [-972.197] * (-973.811) [-970.326] (-980.372) (-978.369) -- 0:02:57
344000 -- (-983.646) [-972.450] (-984.585) (-971.971) * (-983.855) (-984.304) [-976.783] (-971.863) -- 0:02:57
344500 -- [-977.432] (-978.860) (-978.103) (-974.256) * (-977.580) [-981.878] (-986.713) (-984.765) -- 0:02:56
345000 -- (-989.295) (-978.281) [-976.910] (-988.617) * (-975.486) (-976.747) (-983.464) [-973.519] -- 0:02:56
Average standard deviation of split frequencies: 0.013851
345500 -- (-987.758) (-978.070) (-981.522) [-983.538] * (-980.558) (-987.969) [-976.819] (-969.003) -- 0:02:56
346000 -- [-977.772] (-983.013) (-974.279) (-975.639) * (-972.117) (-983.928) (-981.961) [-974.179] -- 0:02:55
346500 -- (-981.067) (-982.793) (-976.208) [-971.567] * (-983.589) [-973.816] (-985.633) (-984.035) -- 0:02:57
347000 -- [-969.560] (-996.497) (-974.294) (-979.670) * [-976.934] (-972.092) (-974.898) (-986.326) -- 0:02:56
347500 -- (-987.566) (-971.920) (-990.808) [-976.377] * (-979.394) [-969.841] (-973.469) (-984.577) -- 0:02:56
348000 -- (-977.546) (-981.381) (-979.829) [-975.386] * (-972.231) (-981.230) [-976.539] (-992.128) -- 0:02:56
348500 -- [-976.109] (-994.441) (-995.973) (-973.764) * (-986.771) [-967.069] (-979.222) (-989.578) -- 0:02:55
349000 -- [-974.053] (-976.639) (-973.923) (-994.494) * [-982.674] (-969.136) (-982.337) (-977.495) -- 0:02:55
349500 -- [-968.227] (-975.931) (-972.925) (-972.504) * (-980.409) (-986.601) (-975.491) [-977.166] -- 0:02:54
350000 -- (-984.694) (-979.817) [-983.183] (-975.905) * (-990.688) (-982.214) (-988.191) [-984.332] -- 0:02:56
Average standard deviation of split frequencies: 0.014041
350500 -- [-978.680] (-974.971) (-987.325) (-979.287) * (-985.498) (-979.986) [-984.336] (-986.136) -- 0:02:56
351000 -- (-987.714) (-979.718) (-981.379) [-974.617] * (-981.821) (-987.937) [-982.148] (-974.165) -- 0:02:55
351500 -- (-967.850) (-978.123) (-982.760) [-973.030] * (-983.296) (-981.498) [-977.095] (-991.800) -- 0:02:55
352000 -- (-976.223) (-977.207) (-984.766) [-972.933] * (-992.123) [-975.738] (-975.868) (-969.406) -- 0:02:54
352500 -- [-974.250] (-975.698) (-984.160) (-980.259) * (-985.281) (-968.569) (-976.319) [-974.801] -- 0:02:54
353000 -- (-977.031) [-979.228] (-989.025) (-975.322) * [-972.363] (-983.808) (-971.951) (-974.432) -- 0:02:54
353500 -- (-974.280) [-978.855] (-994.231) (-980.126) * (-984.239) (-992.212) [-972.979] (-974.435) -- 0:02:53
354000 -- (-976.538) [-973.353] (-984.618) (-975.803) * (-968.716) (-989.989) (-989.796) [-969.388] -- 0:02:55
354500 -- (-973.136) (-996.641) (-974.083) [-980.990] * [-982.126] (-992.185) (-969.785) (-982.724) -- 0:02:54
355000 -- [-980.874] (-986.476) (-966.188) (-978.534) * [-974.080] (-992.787) (-982.350) (-984.255) -- 0:02:54
Average standard deviation of split frequencies: 0.014492
355500 -- [-973.076] (-987.389) (-986.501) (-976.545) * [-981.127] (-975.183) (-979.552) (-984.723) -- 0:02:54
356000 -- [-985.998] (-990.429) (-983.910) (-982.599) * (-989.088) [-979.688] (-976.823) (-987.313) -- 0:02:53
356500 -- [-975.625] (-993.664) (-987.744) (-979.683) * (-976.697) (-978.713) (-976.765) [-983.404] -- 0:02:53
357000 -- [-978.694] (-989.300) (-986.726) (-974.624) * (-987.119) [-974.473] (-977.051) (-995.444) -- 0:02:52
357500 -- (-979.741) (-973.685) [-976.243] (-971.457) * [-973.936] (-973.779) (-979.317) (-980.995) -- 0:02:54
358000 -- (-979.646) (-979.494) [-990.965] (-975.802) * (-974.657) [-976.377] (-972.376) (-979.101) -- 0:02:53
358500 -- (-971.052) (-983.673) (-977.120) [-980.517] * (-977.352) (-978.177) (-969.467) [-979.228] -- 0:02:53
359000 -- [-976.563] (-983.451) (-986.290) (-976.912) * (-985.812) (-980.896) [-968.111] (-981.164) -- 0:02:53
359500 -- (-989.101) (-986.530) [-973.578] (-982.620) * (-977.711) [-975.934] (-980.421) (-978.961) -- 0:02:52
360000 -- (-982.899) (-977.292) [-973.118] (-979.871) * (-982.417) (-977.026) [-971.039] (-975.406) -- 0:02:52
Average standard deviation of split frequencies: 0.015249
360500 -- (-976.316) [-975.650] (-981.727) (-978.595) * (-981.644) [-979.866] (-973.064) (-979.616) -- 0:02:52
361000 -- (-978.610) (-991.556) [-972.274] (-970.570) * (-980.667) [-981.320] (-983.194) (-985.149) -- 0:02:51
361500 -- (-990.642) (-982.458) [-974.586] (-971.785) * (-981.644) [-980.697] (-979.787) (-974.326) -- 0:02:53
362000 -- (-980.633) (-979.046) [-972.766] (-977.489) * [-967.689] (-987.005) (-990.967) (-988.689) -- 0:02:52
362500 -- (-976.412) (-979.673) (-978.531) [-976.168] * (-973.085) (-980.959) [-972.357] (-986.893) -- 0:02:52
363000 -- (-974.405) (-981.361) [-983.876] (-983.607) * (-975.500) [-975.213] (-984.233) (-976.496) -- 0:02:51
363500 -- (-981.650) (-996.247) (-981.148) [-979.618] * [-970.963] (-992.356) (-977.056) (-977.416) -- 0:02:51
364000 -- [-974.753] (-975.308) (-984.819) (-977.482) * (-980.360) (-977.049) [-973.764] (-982.010) -- 0:02:51
364500 -- (-980.778) (-982.225) (-970.882) [-974.920] * (-981.710) (-974.881) [-976.849] (-979.421) -- 0:02:50
365000 -- (-990.345) [-976.225] (-970.100) (-972.415) * [-976.677] (-973.540) (-971.133) (-994.290) -- 0:02:52
Average standard deviation of split frequencies: 0.015313
365500 -- (-981.820) (-977.562) (-975.812) [-983.499] * [-980.069] (-973.461) (-986.878) (-987.231) -- 0:02:51
366000 -- (-985.805) (-982.331) [-974.726] (-978.975) * [-976.508] (-981.239) (-968.050) (-978.695) -- 0:02:51
366500 -- [-981.679] (-984.724) (-980.955) (-973.535) * (-985.615) (-983.430) [-980.168] (-984.125) -- 0:02:51
367000 -- (-994.889) (-977.023) [-974.055] (-985.330) * (-998.875) [-972.894] (-974.505) (-982.377) -- 0:02:50
367500 -- (-981.473) [-976.018] (-984.065) (-976.408) * (-984.154) (-974.041) [-979.469] (-992.668) -- 0:02:50
368000 -- (-989.215) [-972.567] (-977.440) (-981.914) * [-976.110] (-979.791) (-974.260) (-991.780) -- 0:02:50
368500 -- (-978.239) (-988.631) (-977.920) [-978.207] * (-982.589) [-968.960] (-979.182) (-991.914) -- 0:02:51
369000 -- [-975.444] (-989.083) (-984.198) (-979.651) * (-987.752) [-972.068] (-974.596) (-984.446) -- 0:02:51
369500 -- (-980.785) (-985.561) (-976.836) [-976.196] * (-977.305) (-982.681) [-976.206] (-985.717) -- 0:02:50
370000 -- [-976.667] (-986.314) (-972.937) (-987.544) * [-976.916] (-972.614) (-974.988) (-979.376) -- 0:02:50
Average standard deviation of split frequencies: 0.014201
370500 -- [-973.750] (-985.152) (-979.424) (-977.800) * (-981.006) [-972.300] (-977.777) (-985.359) -- 0:02:49
371000 -- [-978.560] (-978.981) (-993.575) (-972.506) * [-970.660] (-981.718) (-978.079) (-984.956) -- 0:02:49
371500 -- (-984.444) [-971.797] (-978.131) (-980.177) * (-980.954) [-977.327] (-984.450) (-985.130) -- 0:02:49
372000 -- (-979.238) (-992.048) [-973.872] (-980.485) * (-973.219) (-978.822) (-983.349) [-978.731] -- 0:02:48
372500 -- [-975.926] (-977.076) (-975.739) (-982.291) * (-990.491) (-972.901) (-989.860) [-974.232] -- 0:02:50
373000 -- (-980.293) (-988.910) [-986.107] (-988.515) * (-978.712) (-977.133) (-969.498) [-980.289] -- 0:02:49
373500 -- (-980.623) (-973.798) (-983.359) [-973.543] * (-982.474) (-978.397) [-970.127] (-975.066) -- 0:02:49
374000 -- [-971.546] (-984.287) (-976.701) (-974.026) * (-987.556) (-983.253) [-968.777] (-983.427) -- 0:02:49
374500 -- (-985.653) (-982.611) (-966.084) [-976.740] * (-987.589) [-986.091] (-979.714) (-976.815) -- 0:02:48
375000 -- (-978.921) (-983.234) (-971.295) [-972.082] * (-977.914) (-985.616) [-977.753] (-971.788) -- 0:02:48
Average standard deviation of split frequencies: 0.013512
375500 -- (-987.187) (-974.182) (-979.822) [-979.484] * (-974.423) (-985.869) (-981.840) [-972.740] -- 0:02:47
376000 -- (-974.704) (-978.496) [-977.890] (-975.396) * [-974.176] (-985.854) (-979.657) (-979.427) -- 0:02:49
376500 -- (-976.242) [-981.980] (-984.433) (-973.928) * [-979.490] (-980.784) (-975.650) (-979.761) -- 0:02:48
377000 -- (-979.412) (-982.505) (-989.473) [-977.512] * [-976.343] (-986.581) (-973.194) (-974.824) -- 0:02:48
377500 -- (-980.430) [-985.287] (-982.540) (-971.756) * (-974.210) [-974.080] (-974.737) (-998.659) -- 0:02:48
378000 -- (-971.456) (-985.124) (-978.118) [-972.486] * (-980.339) (-981.601) [-971.235] (-998.638) -- 0:02:47
378500 -- (-982.404) [-977.640] (-977.216) (-978.953) * (-987.191) (-977.274) [-976.958] (-983.823) -- 0:02:47
379000 -- (-981.202) (-980.254) [-969.789] (-977.865) * [-967.996] (-979.735) (-977.983) (-978.825) -- 0:02:47
379500 -- [-970.379] (-993.486) (-982.506) (-995.112) * (-989.255) [-972.470] (-989.843) (-976.226) -- 0:02:46
380000 -- [-972.257] (-984.310) (-982.310) (-978.351) * (-979.990) (-980.084) (-977.452) [-970.927] -- 0:02:48
Average standard deviation of split frequencies: 0.013622
380500 -- [-974.199] (-991.993) (-970.987) (-977.051) * [-974.718] (-983.160) (-978.493) (-987.325) -- 0:02:47
381000 -- (-984.820) [-990.202] (-971.367) (-982.812) * (-975.870) (-979.882) [-970.107] (-974.793) -- 0:02:47
381500 -- (-976.174) [-974.544] (-990.103) (-984.604) * (-977.083) [-976.176] (-978.322) (-970.579) -- 0:02:46
382000 -- (-985.384) [-973.277] (-979.537) (-979.933) * [-976.970] (-987.820) (-974.559) (-982.049) -- 0:02:46
382500 -- (-971.985) [-974.938] (-987.831) (-969.632) * (-988.667) (-971.609) (-981.864) [-978.495] -- 0:02:46
383000 -- (-984.309) (-972.886) [-977.873] (-980.004) * (-982.930) [-975.840] (-987.773) (-974.802) -- 0:02:45
383500 -- [-978.657] (-977.496) (-977.776) (-994.306) * (-984.304) (-974.591) (-987.273) [-969.330] -- 0:02:47
384000 -- (-978.278) (-974.975) [-979.137] (-991.088) * (-980.413) [-980.269] (-980.785) (-978.838) -- 0:02:46
384500 -- [-972.546] (-973.561) (-998.625) (-983.685) * (-989.088) [-975.325] (-976.640) (-981.620) -- 0:02:46
385000 -- (-981.242) (-980.596) [-977.901] (-987.900) * (-988.222) (-978.804) (-983.034) [-973.138] -- 0:02:46
Average standard deviation of split frequencies: 0.013366
385500 -- [-970.168] (-975.402) (-982.673) (-989.008) * (-986.633) (-988.069) [-984.313] (-969.155) -- 0:02:45
386000 -- (-984.325) [-972.669] (-984.919) (-980.530) * (-985.641) (-984.022) (-981.016) [-981.463] -- 0:02:45
386500 -- (-969.583) [-973.919] (-981.737) (-984.678) * [-987.086] (-974.845) (-974.649) (-971.858) -- 0:02:45
387000 -- (-982.063) (-983.432) [-972.428] (-972.834) * (-990.850) (-978.866) [-973.504] (-980.163) -- 0:02:46
387500 -- [-972.264] (-981.522) (-970.138) (-992.546) * (-985.850) (-984.780) (-973.615) [-981.482] -- 0:02:45
388000 -- (-975.495) (-978.223) [-976.195] (-986.334) * (-983.929) (-985.638) (-994.115) [-969.550] -- 0:02:45
388500 -- (-970.128) (-986.536) (-980.734) [-980.775] * (-975.762) (-984.220) [-967.946] (-980.639) -- 0:02:45
389000 -- (-976.230) [-976.354] (-971.028) (-983.923) * (-987.019) [-975.673] (-984.207) (-981.154) -- 0:02:44
389500 -- [-971.477] (-985.713) (-980.828) (-968.294) * [-978.324] (-976.661) (-977.890) (-983.717) -- 0:02:44
390000 -- (-976.973) [-981.395] (-981.668) (-986.181) * (-983.256) [-970.771] (-986.150) (-974.077) -- 0:02:44
Average standard deviation of split frequencies: 0.013206
390500 -- (-980.163) (-977.679) [-977.722] (-973.167) * (-988.958) [-970.711] (-969.005) (-998.234) -- 0:02:43
391000 -- (-986.887) (-975.161) (-984.902) [-971.521] * (-987.002) (-988.195) (-981.622) [-974.871] -- 0:02:45
391500 -- (-969.646) (-975.214) (-976.317) [-967.739] * [-981.618] (-986.826) (-984.492) (-983.417) -- 0:02:44
392000 -- [-979.294] (-976.609) (-979.232) (-973.247) * (-978.774) [-978.064] (-984.640) (-986.511) -- 0:02:44
392500 -- (-979.549) (-979.726) [-973.008] (-974.731) * (-991.405) (-977.082) [-972.287] (-988.902) -- 0:02:44
393000 -- (-979.486) (-979.992) (-977.776) [-972.600] * (-984.208) [-975.360] (-986.436) (-978.472) -- 0:02:43
393500 -- [-973.899] (-978.115) (-975.440) (-981.353) * (-982.991) (-979.639) [-972.663] (-984.846) -- 0:02:43
394000 -- [-976.750] (-974.939) (-975.847) (-979.517) * (-982.978) (-985.606) (-983.886) [-975.192] -- 0:02:43
394500 -- (-976.635) (-990.080) (-995.527) [-987.976] * (-977.874) [-978.904] (-984.573) (-994.358) -- 0:02:44
395000 -- (-978.828) [-972.599] (-1006.037) (-984.557) * (-980.467) (-980.013) [-985.622] (-985.441) -- 0:02:43
Average standard deviation of split frequencies: 0.012565
395500 -- (-984.384) (-976.319) (-986.405) [-974.803] * (-985.958) [-974.776] (-975.312) (-980.575) -- 0:02:43
396000 -- (-980.175) [-970.471] (-990.681) (-973.929) * [-982.732] (-982.385) (-973.967) (-976.363) -- 0:02:43
396500 -- [-979.187] (-989.073) (-991.984) (-980.618) * (-986.271) (-991.152) [-973.755] (-975.436) -- 0:02:42
397000 -- (-980.708) (-980.782) (-979.204) [-980.844] * [-970.447] (-980.424) (-985.304) (-995.689) -- 0:02:42
397500 -- (-980.530) (-978.701) [-978.915] (-975.157) * (-981.007) (-977.673) (-971.188) [-978.884] -- 0:02:42
398000 -- (-991.486) (-973.922) [-974.804] (-981.522) * (-978.545) (-991.681) [-978.147] (-982.112) -- 0:02:43
398500 -- (-982.517) (-979.659) [-981.410] (-977.402) * (-969.735) (-978.347) [-979.223] (-984.238) -- 0:02:43
399000 -- (-978.475) (-983.850) [-971.517] (-983.159) * (-978.190) [-986.026] (-980.124) (-971.488) -- 0:02:42
399500 -- (-984.234) (-983.342) (-975.928) [-973.741] * (-982.743) (-979.947) (-980.562) [-975.212] -- 0:02:42
400000 -- (-982.752) [-980.903] (-974.576) (-975.242) * [-976.424] (-978.704) (-986.351) (-985.823) -- 0:02:42
Average standard deviation of split frequencies: 0.012550
400500 -- (-991.442) (-982.801) [-979.052] (-981.446) * (-985.655) [-978.652] (-979.829) (-978.623) -- 0:02:41
401000 -- (-979.141) (-974.112) (-974.929) [-973.270] * (-980.921) (-975.453) [-967.427] (-975.257) -- 0:02:41
401500 -- [-972.787] (-978.989) (-989.737) (-980.247) * (-987.867) (-988.637) (-980.886) [-975.586] -- 0:02:40
402000 -- [-967.932] (-977.391) (-993.198) (-994.828) * (-988.496) (-990.604) [-976.751] (-976.589) -- 0:02:42
402500 -- (-982.350) (-976.382) [-975.545] (-982.221) * (-994.837) [-986.208] (-978.482) (-974.231) -- 0:02:41
403000 -- (-991.135) (-971.142) [-976.056] (-980.076) * (-994.142) (-974.869) (-976.290) [-980.911] -- 0:02:41
403500 -- (-975.015) [-978.021] (-980.407) (-982.061) * (-976.490) [-978.531] (-980.142) (-982.265) -- 0:02:41
404000 -- (-977.033) [-980.883] (-992.234) (-972.687) * [-981.960] (-991.179) (-972.797) (-981.461) -- 0:02:40
404500 -- (-978.205) (-1000.318) (-981.676) [-976.207] * (-997.401) (-999.347) [-975.533] (-974.172) -- 0:02:40
405000 -- [-981.387] (-987.155) (-972.758) (-987.066) * (-988.088) (-984.425) (-978.505) [-987.860] -- 0:02:40
Average standard deviation of split frequencies: 0.011482
405500 -- (-980.284) (-972.576) [-969.927] (-984.409) * (-994.129) (-977.389) (-987.575) [-977.337] -- 0:02:41
406000 -- (-981.116) [-980.802] (-975.968) (-981.913) * (-976.481) [-975.681] (-978.964) (-985.237) -- 0:02:40
406500 -- (-972.945) (-976.490) [-975.727] (-973.994) * [-966.726] (-976.345) (-983.723) (-996.000) -- 0:02:40
407000 -- (-975.906) [-984.768] (-981.779) (-992.022) * [-976.590] (-983.772) (-982.541) (-977.066) -- 0:02:40
407500 -- (-975.769) (-976.618) [-978.075] (-991.378) * (-969.115) (-986.660) (-969.337) [-972.805] -- 0:02:39
408000 -- (-979.910) [-982.141] (-982.599) (-979.391) * (-982.154) [-977.101] (-977.667) (-983.359) -- 0:02:39
408500 -- (-974.489) (-976.965) [-970.907] (-978.947) * (-980.969) [-978.294] (-983.493) (-983.522) -- 0:02:39
409000 -- [-979.060] (-974.138) (-976.532) (-972.208) * (-996.525) (-984.812) [-971.727] (-983.516) -- 0:02:38
409500 -- (-976.028) [-980.336] (-978.249) (-972.216) * (-973.477) (-981.132) [-971.302] (-988.530) -- 0:02:40
410000 -- (-978.566) (-982.258) [-969.987] (-976.362) * (-977.169) [-973.342] (-982.960) (-983.743) -- 0:02:39
Average standard deviation of split frequencies: 0.012244
410500 -- (-989.533) (-983.280) (-973.110) [-969.898] * (-977.757) (-985.135) [-978.240] (-991.085) -- 0:02:39
411000 -- (-980.134) (-982.418) (-973.352) [-972.329] * (-994.019) (-989.465) (-984.748) [-979.210] -- 0:02:39
411500 -- (-979.919) (-984.170) (-974.977) [-987.087] * [-981.752] (-991.377) (-978.090) (-976.046) -- 0:02:38
412000 -- (-972.019) (-992.756) (-977.397) [-970.702] * (-983.309) (-982.038) (-980.300) [-982.065] -- 0:02:38
412500 -- (-985.326) (-977.893) (-996.550) [-978.313] * (-979.388) (-977.990) [-973.984] (-989.926) -- 0:02:39
413000 -- [-978.769] (-982.739) (-979.673) (-988.504) * (-980.491) (-972.264) [-974.671] (-983.290) -- 0:02:39
413500 -- (-981.503) (-992.056) [-968.729] (-978.258) * (-986.731) (-972.297) (-980.429) [-976.066] -- 0:02:38
414000 -- [-975.662] (-983.375) (-982.141) (-980.989) * [-985.591] (-984.696) (-984.720) (-983.609) -- 0:02:38
414500 -- [-974.732] (-987.992) (-978.096) (-985.678) * [-973.266] (-975.771) (-976.976) (-986.154) -- 0:02:38
415000 -- [-975.567] (-1011.263) (-976.939) (-989.658) * [-971.587] (-982.942) (-979.311) (-989.542) -- 0:02:37
Average standard deviation of split frequencies: 0.012213
415500 -- (-975.992) (-997.783) [-978.627] (-975.931) * (-976.808) [-974.051] (-991.124) (-975.231) -- 0:02:37
416000 -- [-969.201] (-977.986) (-980.276) (-980.511) * (-974.476) (-981.597) [-980.998] (-979.957) -- 0:02:38
416500 -- (-979.709) (-987.791) (-981.615) [-979.814] * (-997.019) [-978.496] (-983.944) (-988.041) -- 0:02:38
417000 -- (-982.501) (-963.684) (-970.479) [-971.943] * (-991.287) [-972.488] (-985.505) (-982.692) -- 0:02:37
417500 -- (-974.789) [-977.541] (-973.700) (-985.330) * (-991.519) [-979.276] (-982.932) (-987.437) -- 0:02:37
418000 -- [-972.639] (-978.254) (-981.977) (-981.210) * [-984.719] (-963.568) (-991.148) (-970.004) -- 0:02:37
418500 -- (-979.294) [-968.654] (-976.172) (-984.787) * (-978.074) [-969.481] (-999.188) (-977.186) -- 0:02:37
419000 -- (-985.254) (-978.714) (-988.469) [-974.084] * (-978.192) [-975.027] (-978.270) (-987.476) -- 0:02:36
419500 -- (-990.894) (-981.724) (-981.043) [-979.062] * (-973.364) [-989.539] (-991.880) (-972.626) -- 0:02:37
420000 -- (-980.234) (-983.608) [-979.942] (-986.105) * (-984.069) (-980.132) (-990.188) [-976.081] -- 0:02:37
Average standard deviation of split frequencies: 0.011268
420500 -- (-982.619) (-971.084) (-973.650) [-978.375] * (-991.186) [-981.701] (-981.756) (-986.156) -- 0:02:37
421000 -- (-974.726) (-975.373) [-980.086] (-979.013) * (-977.104) (-992.419) (-994.065) [-970.871] -- 0:02:36
421500 -- [-971.495] (-980.391) (-974.119) (-991.466) * (-994.362) (-979.121) [-977.990] (-989.410) -- 0:02:36
422000 -- [-971.503] (-990.003) (-985.101) (-985.892) * (-985.738) (-978.236) [-970.110] (-976.288) -- 0:02:36
422500 -- [-975.266] (-982.040) (-980.835) (-994.149) * (-976.636) (-990.646) [-970.536] (-978.668) -- 0:02:35
423000 -- (-979.232) (-971.662) (-988.431) [-982.510] * (-987.101) (-981.639) [-982.144] (-987.696) -- 0:02:36
423500 -- (-983.911) (-975.578) (-977.723) [-975.717] * (-979.311) (-979.833) [-965.532] (-985.540) -- 0:02:36
424000 -- (-981.366) (-979.597) (-992.573) [-976.970] * (-987.194) (-977.494) (-978.457) [-983.871] -- 0:02:36
424500 -- (-989.329) [-978.604] (-980.365) (-981.191) * (-992.519) (-981.350) [-976.989] (-977.851) -- 0:02:35
425000 -- (-980.405) [-979.281] (-983.340) (-977.634) * (-998.170) [-970.412] (-972.240) (-970.989) -- 0:02:35
Average standard deviation of split frequencies: 0.012111
425500 -- (-986.585) [-965.869] (-990.656) (-969.248) * (-989.813) [-986.120] (-977.501) (-982.342) -- 0:02:35
426000 -- (-983.587) (-978.294) (-977.854) [-980.553] * (-981.088) (-981.190) (-978.219) [-970.398] -- 0:02:34
426500 -- (-974.909) [-966.574] (-981.561) (-975.423) * (-971.192) [-976.898] (-985.332) (-976.675) -- 0:02:35
427000 -- (-982.299) (-985.628) (-974.918) [-967.226] * (-991.286) (-991.963) [-978.979] (-982.098) -- 0:02:35
427500 -- (-978.876) (-997.660) [-974.470] (-972.374) * [-971.420] (-975.670) (-987.298) (-990.389) -- 0:02:35
428000 -- (-982.427) (-982.405) (-979.971) [-971.508] * [-970.083] (-984.823) (-987.008) (-991.451) -- 0:02:35
428500 -- (-995.939) [-979.364] (-972.677) (-976.188) * (-975.613) (-974.616) (-991.340) [-978.969] -- 0:02:34
429000 -- (-979.666) (-986.035) (-983.066) [-973.186] * (-986.550) (-975.535) [-974.066] (-978.222) -- 0:02:34
429500 -- (-975.706) (-991.972) [-971.117] (-974.523) * (-982.718) (-975.889) (-975.655) [-974.093] -- 0:02:35
430000 -- [-976.441] (-989.932) (-969.701) (-971.921) * (-996.359) (-986.358) (-980.223) [-980.374] -- 0:02:35
Average standard deviation of split frequencies: 0.012649
430500 -- (-982.450) (-982.443) (-982.617) [-977.182] * [-974.066] (-979.732) (-970.324) (-973.503) -- 0:02:34
431000 -- (-984.463) [-973.122] (-985.420) (-973.613) * (-974.352) (-988.072) [-980.115] (-982.618) -- 0:02:34
431500 -- (-985.999) (-977.289) [-969.805] (-1000.471) * [-972.037] (-979.194) (-973.494) (-985.980) -- 0:02:34
432000 -- (-992.147) (-974.525) (-979.990) [-973.950] * [-966.942] (-990.365) (-974.495) (-984.030) -- 0:02:33
432500 -- [-983.530] (-971.405) (-977.569) (-985.584) * (-976.064) (-995.446) [-972.664] (-982.547) -- 0:02:34
433000 -- [-976.880] (-974.654) (-982.221) (-987.472) * (-974.695) [-973.049] (-994.955) (-980.504) -- 0:02:34
433500 -- (-976.537) [-973.001] (-986.151) (-983.961) * (-984.383) [-975.479] (-969.244) (-982.059) -- 0:02:34
434000 -- (-982.050) [-965.980] (-985.875) (-976.752) * (-980.970) [-970.275] (-969.342) (-979.400) -- 0:02:33
434500 -- (-973.787) (-984.792) [-974.785] (-980.519) * (-984.944) [-967.537] (-981.747) (-967.622) -- 0:02:33
435000 -- (-973.316) (-986.673) [-980.744] (-992.732) * [-972.339] (-975.351) (-970.498) (-986.313) -- 0:02:33
Average standard deviation of split frequencies: 0.012194
435500 -- (-972.388) (-978.371) [-979.336] (-1000.196) * [-964.392] (-987.532) (-982.947) (-990.732) -- 0:02:32
436000 -- [-990.361] (-977.258) (-985.809) (-989.230) * (-984.714) [-971.519] (-982.432) (-980.498) -- 0:02:32
436500 -- (-977.225) [-977.771] (-991.908) (-973.544) * (-988.066) (-974.817) [-976.129] (-971.195) -- 0:02:33
437000 -- [-975.598] (-976.631) (-973.781) (-994.618) * (-976.846) [-982.764] (-981.455) (-984.812) -- 0:02:33
437500 -- (-978.630) [-980.525] (-979.409) (-984.682) * (-982.684) (-976.939) [-974.122] (-984.559) -- 0:02:33
438000 -- (-982.106) (-972.184) [-978.113] (-977.282) * (-981.385) [-972.863] (-979.035) (-985.217) -- 0:02:32
438500 -- (-966.931) (-968.423) [-976.851] (-981.467) * (-975.227) (-977.167) (-982.545) [-977.049] -- 0:02:32
439000 -- (-987.622) [-977.548] (-983.035) (-974.566) * [-978.535] (-976.913) (-978.816) (-975.645) -- 0:02:32
439500 -- (-984.135) [-982.421] (-978.030) (-995.548) * (-977.264) [-972.839] (-984.792) (-983.700) -- 0:02:31
440000 -- [-975.699] (-974.862) (-976.685) (-987.730) * (-972.148) [-970.064] (-988.690) (-977.255) -- 0:02:32
Average standard deviation of split frequencies: 0.012480
440500 -- [-972.997] (-981.205) (-988.293) (-980.232) * [-974.077] (-997.997) (-992.040) (-974.396) -- 0:02:32
441000 -- (-986.008) [-973.532] (-988.617) (-973.132) * [-977.641] (-980.925) (-988.002) (-973.130) -- 0:02:32
441500 -- (-993.052) [-972.487] (-978.320) (-980.881) * (-974.967) (-982.113) (-982.558) [-973.156] -- 0:02:31
442000 -- (-981.475) [-983.300] (-977.141) (-970.341) * (-979.701) [-980.057] (-1002.987) (-980.100) -- 0:02:31
442500 -- [-966.207] (-979.114) (-984.407) (-981.843) * (-979.825) (-965.966) (-979.021) [-986.528] -- 0:02:31
443000 -- (-982.864) [-978.225] (-980.113) (-974.789) * (-989.799) [-973.676] (-980.837) (-992.502) -- 0:02:30
443500 -- [-975.439] (-976.950) (-986.789) (-969.369) * (-970.318) (-981.292) [-978.992] (-987.839) -- 0:02:30
444000 -- (-970.869) (-972.598) [-974.938] (-972.982) * (-974.361) (-989.850) (-971.896) [-978.265] -- 0:02:31
444500 -- [-979.477] (-982.059) (-979.801) (-986.195) * (-983.720) (-983.979) [-982.439] (-986.267) -- 0:02:31
445000 -- (-971.898) [-975.215] (-984.009) (-979.246) * (-975.039) (-975.426) (-968.836) [-974.326] -- 0:02:30
Average standard deviation of split frequencies: 0.012977
445500 -- (-969.130) (-987.764) (-980.191) [-971.435] * (-976.882) (-969.260) [-975.553] (-983.166) -- 0:02:30
446000 -- [-972.692] (-974.519) (-982.188) (-992.672) * (-982.953) [-974.691] (-972.769) (-980.558) -- 0:02:30
446500 -- (-975.897) (-979.592) (-979.208) [-967.838] * (-980.007) [-971.067] (-975.739) (-983.317) -- 0:02:29
447000 -- (-974.746) [-975.561] (-980.029) (-983.759) * (-991.324) [-981.024] (-990.146) (-980.748) -- 0:02:30
447500 -- (-981.866) (-972.942) [-968.360] (-983.358) * [-989.234] (-977.060) (-991.987) (-975.410) -- 0:02:30
448000 -- (-980.977) (-978.734) (-974.931) [-976.343] * (-976.560) (-976.386) (-980.315) [-967.577] -- 0:02:30
448500 -- (-975.488) [-974.344] (-978.840) (-971.231) * (-992.982) (-978.882) (-987.164) [-974.283] -- 0:02:30
449000 -- (-982.243) (-971.955) [-969.713] (-982.487) * [-964.672] (-992.070) (-989.233) (-974.775) -- 0:02:29
449500 -- (-988.322) (-969.915) [-974.726] (-982.316) * [-970.674] (-983.316) (-980.753) (-983.765) -- 0:02:29
450000 -- [-978.868] (-986.659) (-984.060) (-985.113) * (-972.689) [-975.331] (-989.114) (-982.116) -- 0:02:29
Average standard deviation of split frequencies: 0.013366
450500 -- (-980.898) (-979.830) (-994.118) [-975.009] * [-969.819] (-974.455) (-983.276) (-976.392) -- 0:02:30
451000 -- (-977.978) (-979.835) (-989.377) [-976.896] * (-979.171) [-972.319] (-985.056) (-973.375) -- 0:02:29
451500 -- [-970.466] (-974.022) (-992.515) (-972.237) * (-973.507) [-971.007] (-999.745) (-980.959) -- 0:02:29
452000 -- (-972.731) (-975.465) (-981.296) [-976.332] * [-975.317] (-979.885) (-978.627) (-980.800) -- 0:02:29
452500 -- (-985.840) (-978.217) (-982.686) [-973.233] * [-976.023] (-980.710) (-985.513) (-989.076) -- 0:02:28
453000 -- (-968.379) (-983.073) [-977.486] (-970.174) * [-976.730] (-973.639) (-978.150) (-978.201) -- 0:02:28
453500 -- (-977.561) [-986.429] (-986.990) (-976.919) * [-971.321] (-978.845) (-978.136) (-979.394) -- 0:02:29
454000 -- (-975.063) (-991.411) (-988.698) [-980.754] * (-979.335) [-981.536] (-972.311) (-985.758) -- 0:02:29
454500 -- (-985.659) (-990.067) (-981.596) [-980.275] * [-979.458] (-991.192) (-973.744) (-988.129) -- 0:02:28
455000 -- (-985.776) (-973.108) (-980.819) [-988.567] * (-978.982) [-982.983] (-981.711) (-986.580) -- 0:02:28
Average standard deviation of split frequencies: 0.013669
455500 -- (-983.441) (-988.145) (-983.600) [-986.404] * [-970.520] (-986.175) (-976.390) (-984.390) -- 0:02:28
456000 -- (-983.730) (-982.720) (-985.310) [-979.948] * [-973.792] (-980.546) (-974.603) (-972.568) -- 0:02:27
456500 -- (-982.146) (-975.062) (-975.157) [-970.223] * (-982.680) [-979.177] (-977.297) (-994.976) -- 0:02:27
457000 -- (-984.358) [-973.081] (-991.884) (-986.816) * (-982.392) (-981.428) (-986.236) [-975.471] -- 0:02:28
457500 -- (-982.864) [-969.881] (-976.045) (-968.250) * (-985.976) [-966.648] (-969.744) (-978.260) -- 0:02:28
458000 -- (-983.510) (-976.471) (-997.899) [-973.152] * (-979.470) (-978.491) [-976.883] (-981.664) -- 0:02:27
458500 -- (-983.702) [-972.262] (-980.668) (-980.533) * [-975.955] (-971.589) (-976.734) (-981.354) -- 0:02:27
459000 -- (-984.162) [-974.584] (-973.245) (-1000.468) * (-976.275) [-976.071] (-978.669) (-978.819) -- 0:02:27
459500 -- (-985.016) (-981.025) (-982.529) [-979.839] * [-970.835] (-980.257) (-974.434) (-976.693) -- 0:02:27
460000 -- (-984.757) [-975.379] (-975.475) (-978.788) * (-981.970) [-972.129] (-999.775) (-973.075) -- 0:02:26
Average standard deviation of split frequencies: 0.013701
460500 -- (-983.931) [-970.028] (-983.020) (-974.459) * (-987.674) (-984.647) [-980.272] (-977.175) -- 0:02:26
461000 -- (-986.503) (-984.925) (-991.298) [-969.960] * (-981.528) [-984.448] (-975.424) (-979.116) -- 0:02:27
461500 -- (-988.472) (-992.230) [-972.467] (-974.606) * (-977.151) (-984.883) [-979.822] (-984.503) -- 0:02:27
462000 -- [-972.684] (-992.105) (-974.573) (-984.671) * (-974.371) (-972.996) [-980.837] (-979.716) -- 0:02:26
462500 -- [-968.918] (-981.305) (-976.129) (-970.192) * (-983.305) (-978.832) [-983.145] (-988.289) -- 0:02:26
463000 -- (-967.133) [-977.338] (-986.083) (-986.647) * (-991.967) [-972.500] (-976.083) (-972.726) -- 0:02:26
463500 -- (-979.422) [-978.147] (-978.185) (-994.168) * (-975.785) [-976.023] (-979.751) (-969.778) -- 0:02:25
464000 -- (-992.503) (-983.611) [-975.260] (-978.953) * (-980.489) [-975.395] (-986.244) (-977.965) -- 0:02:25
464500 -- [-984.289] (-982.911) (-978.805) (-977.562) * (-991.304) [-973.029] (-969.578) (-988.169) -- 0:02:26
465000 -- (-988.134) (-979.348) [-972.820] (-981.000) * (-970.765) (-972.848) (-973.144) [-971.435] -- 0:02:26
Average standard deviation of split frequencies: 0.013263
465500 -- (-982.558) (-973.721) (-973.900) [-985.272] * (-976.646) [-975.551] (-974.523) (-977.318) -- 0:02:25
466000 -- (-984.006) (-974.489) [-979.717] (-969.549) * (-970.159) (-981.372) [-980.772] (-973.580) -- 0:02:25
466500 -- (-986.200) [-977.858] (-978.946) (-978.844) * (-985.786) (-982.586) (-973.381) [-973.541] -- 0:02:25
467000 -- [-989.298] (-968.883) (-977.497) (-978.015) * (-991.868) (-979.831) (-981.218) [-964.899] -- 0:02:24
467500 -- (-978.423) (-979.179) [-972.289] (-977.542) * (-967.008) (-977.532) [-978.193] (-975.335) -- 0:02:24
468000 -- [-969.293] (-982.574) (-979.087) (-985.924) * (-971.391) (-977.581) (-983.516) [-976.602] -- 0:02:25
468500 -- (-967.160) (-987.084) [-983.064] (-981.965) * (-985.108) [-978.915] (-975.055) (-997.994) -- 0:02:25
469000 -- (-970.157) (-979.262) (-989.098) [-975.538] * (-977.204) (-988.194) (-977.937) [-977.385] -- 0:02:24
469500 -- [-972.713] (-984.397) (-987.569) (-986.153) * (-972.851) [-975.393] (-980.615) (-977.317) -- 0:02:24
470000 -- (-975.461) [-966.662] (-982.257) (-988.789) * (-979.103) (-977.144) (-980.470) [-976.749] -- 0:02:24
Average standard deviation of split frequencies: 0.013668
470500 -- (-993.712) (-975.637) (-979.247) [-979.244] * (-986.920) (-991.566) (-978.726) [-974.359] -- 0:02:24
471000 -- (-980.647) (-984.255) (-973.504) [-972.704] * [-975.910] (-976.799) (-978.623) (-979.565) -- 0:02:23
471500 -- (-979.175) [-969.887] (-983.881) (-983.968) * (-978.651) (-980.104) (-972.566) [-968.030] -- 0:02:24
472000 -- (-986.010) (-974.223) [-972.553] (-986.370) * (-976.307) [-975.477] (-977.513) (-978.373) -- 0:02:24
472500 -- [-968.739] (-976.830) (-983.508) (-970.166) * (-983.746) [-972.746] (-981.190) (-978.776) -- 0:02:24
473000 -- (-974.499) [-963.382] (-979.337) (-990.996) * (-980.061) [-971.956] (-980.379) (-982.809) -- 0:02:23
473500 -- (-977.130) [-975.571] (-978.381) (-978.442) * (-983.139) (-977.184) (-983.753) [-972.007] -- 0:02:23
474000 -- [-978.071] (-975.159) (-992.732) (-981.570) * [-968.078] (-981.385) (-981.513) (-976.051) -- 0:02:23
474500 -- (-976.694) (-999.163) [-975.145] (-999.584) * (-979.322) (-988.815) [-971.156] (-978.766) -- 0:02:22
475000 -- [-980.421] (-982.668) (-983.218) (-987.309) * (-974.205) [-978.200] (-977.646) (-988.943) -- 0:02:23
Average standard deviation of split frequencies: 0.013515
475500 -- (-984.894) [-980.923] (-975.191) (-972.015) * (-984.278) [-974.198] (-978.098) (-979.983) -- 0:02:23
476000 -- (-982.827) (-978.784) (-972.716) [-977.512] * (-989.015) [-972.293] (-986.650) (-977.395) -- 0:02:23
476500 -- [-971.855] (-981.483) (-974.536) (-973.084) * (-975.629) [-975.912] (-981.464) (-984.959) -- 0:02:22
477000 -- (-977.999) (-984.424) (-980.761) [-971.552] * (-980.948) [-978.506] (-988.160) (-990.939) -- 0:02:22
477500 -- (-977.283) [-979.651] (-986.994) (-985.189) * (-980.863) (-980.583) (-982.627) [-973.290] -- 0:02:22
478000 -- (-992.442) [-982.135] (-983.438) (-984.913) * (-976.021) (-983.671) (-977.734) [-978.453] -- 0:02:21
478500 -- (-981.233) (-976.339) (-989.568) [-983.333] * (-988.012) (-978.540) [-968.236] (-1000.355) -- 0:02:21
479000 -- (-976.218) [-974.050] (-978.669) (-977.265) * (-978.473) (-972.944) (-978.521) [-991.245] -- 0:02:22
479500 -- (-983.292) (-980.971) [-969.625] (-993.028) * (-978.754) [-973.712] (-987.226) (-974.105) -- 0:02:22
480000 -- [-971.647] (-981.807) (-989.530) (-973.222) * (-981.753) (-977.726) (-975.235) [-978.565] -- 0:02:21
Average standard deviation of split frequencies: 0.013326
480500 -- (-975.944) (-977.881) [-979.273] (-985.122) * (-985.967) [-973.096] (-982.047) (-985.412) -- 0:02:21
481000 -- (-979.367) (-984.263) (-992.045) [-980.167] * [-975.919] (-987.357) (-972.856) (-970.548) -- 0:02:21
481500 -- (-988.818) (-977.699) (-981.130) [-978.202] * [-979.924] (-976.599) (-971.937) (-983.559) -- 0:02:21
482000 -- (-975.941) [-972.778] (-983.257) (-978.647) * (-975.275) (-983.720) (-973.252) [-969.067] -- 0:02:20
482500 -- [-979.618] (-980.033) (-977.153) (-996.430) * (-974.467) [-980.912] (-980.266) (-976.535) -- 0:02:21
483000 -- (-979.032) (-978.334) [-978.636] (-985.025) * (-977.832) (-972.538) (-976.480) [-976.820] -- 0:02:21
483500 -- (-997.328) [-971.157] (-984.581) (-976.852) * (-985.460) (-981.404) [-973.563] (-985.546) -- 0:02:21
484000 -- [-969.825] (-973.783) (-981.078) (-990.765) * [-971.892] (-977.524) (-970.348) (-969.584) -- 0:02:20
484500 -- [-977.307] (-983.417) (-976.047) (-988.977) * [-973.227] (-994.385) (-977.307) (-980.441) -- 0:02:20
485000 -- [-975.137] (-972.515) (-977.388) (-988.140) * (-985.792) [-978.762] (-980.520) (-979.815) -- 0:02:20
Average standard deviation of split frequencies: 0.013237
485500 -- (-975.818) (-975.041) (-978.580) [-981.024] * [-984.971] (-983.215) (-978.760) (-980.192) -- 0:02:19
486000 -- (-977.271) (-985.586) [-978.683] (-984.844) * [-972.654] (-974.276) (-990.210) (-973.902) -- 0:02:20
486500 -- (-981.788) (-985.652) [-974.513] (-981.661) * (-980.533) (-980.683) [-973.136] (-978.481) -- 0:02:20
487000 -- [-975.658] (-972.074) (-981.779) (-980.854) * (-982.525) (-973.160) (-985.244) [-971.131] -- 0:02:20
487500 -- (-978.414) (-986.252) (-983.149) [-977.999] * (-981.649) (-977.846) [-977.012] (-981.423) -- 0:02:19
488000 -- (-982.710) (-981.080) [-972.929] (-985.269) * [-976.515] (-988.810) (-982.001) (-976.431) -- 0:02:19
488500 -- (-984.775) (-984.381) (-976.472) [-990.773] * (-983.919) [-978.992] (-979.598) (-978.799) -- 0:02:19
489000 -- (-975.778) (-977.456) [-981.325] (-980.667) * [-972.853] (-983.209) (-980.426) (-990.734) -- 0:02:18
489500 -- [-979.202] (-973.266) (-976.517) (-980.548) * (-978.561) (-978.794) [-976.261] (-980.853) -- 0:02:19
490000 -- (-985.878) (-979.186) (-970.111) [-971.890] * (-978.317) (-978.784) (-981.508) [-966.261] -- 0:02:19
Average standard deviation of split frequencies: 0.013789
490500 -- (-989.957) (-989.334) [-970.774] (-974.919) * (-976.682) (-979.894) (-973.888) [-969.933] -- 0:02:19
491000 -- (-977.817) (-976.339) (-987.442) [-968.952] * [-976.656] (-988.570) (-975.834) (-985.509) -- 0:02:18
491500 -- (-968.902) (-977.823) (-994.456) [-982.017] * (-986.923) (-978.442) [-979.450] (-974.941) -- 0:02:18
492000 -- [-972.234] (-976.076) (-976.683) (-978.035) * (-978.851) [-986.119] (-982.365) (-983.024) -- 0:02:18
492500 -- (-983.511) (-988.385) [-972.361] (-976.185) * (-975.683) (-986.614) [-976.900] (-980.496) -- 0:02:19
493000 -- (-981.084) (-976.128) (-977.820) [-969.946] * (-980.933) [-975.224] (-981.695) (-980.763) -- 0:02:18
493500 -- [-974.365] (-974.785) (-976.687) (-975.010) * (-989.671) (-979.525) [-976.749] (-978.753) -- 0:02:18
494000 -- (-975.023) (-974.262) [-975.160] (-981.855) * [-981.501] (-986.914) (-980.041) (-976.334) -- 0:02:18
494500 -- (-978.429) (-973.502) [-972.902] (-988.036) * (-990.028) (-980.001) [-975.615] (-974.989) -- 0:02:18
495000 -- (-970.092) [-975.835] (-981.847) (-973.605) * (-982.100) (-990.333) [-975.029] (-973.873) -- 0:02:17
Average standard deviation of split frequencies: 0.012859
495500 -- (-988.716) (-977.205) [-973.430] (-988.491) * (-985.927) (-980.269) [-972.308] (-994.068) -- 0:02:18
496000 -- (-972.083) [-975.470] (-980.361) (-982.755) * (-988.857) [-972.971] (-981.359) (-980.075) -- 0:02:18
496500 -- (-972.745) (-977.007) (-983.364) [-974.339] * (-971.725) (-974.333) [-974.743] (-985.509) -- 0:02:17
497000 -- (-973.265) [-979.008] (-978.050) (-974.279) * (-979.430) (-971.688) [-965.765] (-974.974) -- 0:02:17
497500 -- (-989.243) [-976.364] (-966.101) (-990.761) * [-975.485] (-969.096) (-972.073) (-980.111) -- 0:02:17
498000 -- [-982.259] (-972.526) (-984.138) (-977.879) * (-982.831) (-979.259) [-976.617] (-984.823) -- 0:02:17
498500 -- (-991.394) [-982.184] (-972.945) (-987.798) * [-977.980] (-987.297) (-975.305) (-989.840) -- 0:02:17
499000 -- [-974.382] (-980.681) (-976.551) (-983.754) * (-974.640) [-978.713] (-976.065) (-973.367) -- 0:02:17
499500 -- (-985.695) [-978.160] (-977.411) (-980.781) * (-981.170) (-988.404) [-976.143] (-984.720) -- 0:02:17
500000 -- (-981.007) (-985.059) (-984.905) [-980.682] * (-973.616) (-977.008) [-977.030] (-984.395) -- 0:02:17
Average standard deviation of split frequencies: 0.012739
500500 -- (-983.591) (-974.287) (-973.675) [-981.301] * (-985.116) [-972.313] (-974.818) (-991.141) -- 0:02:16
501000 -- (-990.614) (-978.468) [-974.982] (-994.185) * (-983.344) (-978.088) (-980.967) [-967.506] -- 0:02:16
501500 -- (-979.985) (-980.528) [-969.888] (-992.254) * [-977.698] (-972.494) (-970.977) (-981.190) -- 0:02:16
502000 -- (-993.740) (-979.038) (-988.980) [-964.520] * (-980.891) (-979.676) (-979.534) [-984.723] -- 0:02:16
502500 -- (-986.724) (-974.815) [-974.765] (-973.118) * (-979.963) [-982.202] (-976.285) (-983.716) -- 0:02:16
503000 -- [-976.321] (-977.897) (-984.307) (-981.126) * (-1002.553) (-984.141) (-978.710) [-989.232] -- 0:02:16
503500 -- (-975.760) (-982.466) (-983.702) [-973.240] * [-970.976] (-975.502) (-985.030) (-978.594) -- 0:02:16
504000 -- [-981.691] (-978.324) (-973.294) (-979.106) * (-979.041) [-981.422] (-981.307) (-978.886) -- 0:02:15
504500 -- (-974.970) (-977.992) (-980.635) [-973.006] * (-977.894) (-973.102) [-973.103] (-984.062) -- 0:02:15
505000 -- (-976.181) (-982.337) [-968.867] (-976.796) * (-975.362) [-967.274] (-974.337) (-991.882) -- 0:02:15
Average standard deviation of split frequencies: 0.012266
505500 -- (-974.841) (-983.980) [-971.838] (-975.181) * [-975.566] (-981.211) (-981.583) (-981.083) -- 0:02:15
506000 -- [-982.135] (-980.965) (-978.398) (-971.420) * (-975.785) (-984.047) (-976.186) [-973.900] -- 0:02:15
506500 -- (-973.866) (-976.204) [-973.876] (-981.321) * (-978.530) [-976.822] (-980.312) (-985.560) -- 0:02:15
507000 -- (-986.560) (-985.265) (-982.180) [-970.412] * (-977.533) (-982.496) (-991.554) [-969.954] -- 0:02:15
507500 -- [-969.019] (-976.604) (-972.715) (-985.823) * (-979.344) [-973.519] (-973.036) (-983.530) -- 0:02:14
508000 -- (-983.502) [-976.191] (-985.204) (-986.707) * (-978.531) (-993.167) [-977.675] (-981.456) -- 0:02:14
508500 -- (-972.103) (-971.824) (-992.069) [-977.386] * (-975.366) (-985.210) (-972.062) [-971.740] -- 0:02:14
509000 -- [-975.520] (-988.446) (-978.443) (-971.599) * (-992.570) [-976.158] (-972.219) (-978.375) -- 0:02:14
509500 -- [-970.129] (-966.816) (-983.103) (-977.578) * (-986.279) (-984.408) (-976.694) [-985.457] -- 0:02:14
510000 -- [-975.654] (-974.136) (-980.078) (-975.773) * (-985.373) (-978.541) (-980.914) [-978.327] -- 0:02:14
Average standard deviation of split frequencies: 0.012359
510500 -- (-975.718) (-996.463) [-992.597] (-979.452) * (-986.241) (-979.462) (-979.636) [-970.332] -- 0:02:14
511000 -- (-988.305) (-986.892) (-977.518) [-971.690] * (-982.900) (-976.573) (-971.169) [-983.252] -- 0:02:13
511500 -- (-981.446) (-1003.214) [-980.233] (-990.976) * (-988.689) (-983.271) [-970.702] (-979.391) -- 0:02:13
512000 -- (-982.208) [-973.058] (-995.094) (-981.609) * (-987.225) (-970.872) [-974.512] (-976.593) -- 0:02:13
512500 -- (-971.389) [-973.435] (-990.646) (-986.139) * (-984.093) (-980.909) [-976.266] (-973.856) -- 0:02:13
513000 -- (-974.310) (-979.967) (-984.708) [-974.881] * (-973.118) (-980.425) [-975.449] (-976.243) -- 0:02:13
513500 -- [-972.076] (-976.446) (-980.140) (-977.601) * (-973.150) (-977.594) (-987.756) [-981.095] -- 0:02:13
514000 -- (-973.883) [-979.498] (-979.402) (-983.470) * (-977.336) (-982.802) (-975.859) [-975.310] -- 0:02:13
514500 -- (-973.055) [-969.062] (-980.466) (-976.806) * (-972.331) (-979.965) (-979.876) [-976.512] -- 0:02:13
515000 -- (-973.013) [-973.570] (-983.532) (-971.992) * (-992.900) (-973.890) (-976.886) [-976.943] -- 0:02:12
Average standard deviation of split frequencies: 0.011420
515500 -- (-981.453) (-989.051) (-989.264) [-971.309] * [-969.878] (-989.240) (-974.655) (-986.005) -- 0:02:12
516000 -- (-969.981) (-995.964) [-972.367] (-975.971) * (-984.863) [-971.432] (-986.607) (-974.604) -- 0:02:12
516500 -- (-976.233) (-984.439) (-983.866) [-973.106] * (-983.301) (-995.043) [-979.946] (-984.834) -- 0:02:12
517000 -- (-971.939) (-975.261) (-987.831) [-974.766] * (-978.045) (-997.096) (-976.268) [-976.210] -- 0:02:12
517500 -- (-972.425) (-988.091) (-987.734) [-977.941] * (-978.580) (-977.577) [-968.772] (-979.195) -- 0:02:12
518000 -- (-974.534) [-973.800] (-980.635) (-984.006) * (-984.210) (-980.800) [-970.083] (-976.329) -- 0:02:12
518500 -- (-982.362) [-976.183] (-973.923) (-984.240) * [-979.375] (-976.810) (-980.588) (-991.933) -- 0:02:11
519000 -- (-985.194) (-980.464) (-977.649) [-977.804] * (-970.195) (-979.415) (-984.790) [-984.100] -- 0:02:11
519500 -- (-982.893) (-978.811) [-976.566] (-984.902) * (-977.726) (-983.485) (-972.850) [-984.170] -- 0:02:11
520000 -- [-974.301] (-980.228) (-980.982) (-977.530) * [-974.624] (-976.871) (-991.811) (-983.851) -- 0:02:11
Average standard deviation of split frequencies: 0.011291
520500 -- (-976.059) (-979.093) (-976.223) [-976.481] * [-968.874] (-984.862) (-988.746) (-984.611) -- 0:02:11
521000 -- (-983.564) [-983.231] (-982.308) (-986.301) * (-981.234) (-988.142) [-971.224] (-986.672) -- 0:02:11
521500 -- (-974.631) (-985.876) [-983.268] (-981.660) * (-971.999) (-978.111) [-969.918] (-985.957) -- 0:02:11
522000 -- (-977.387) (-979.869) (-976.402) [-988.922] * (-992.242) (-973.080) [-974.439] (-982.652) -- 0:02:10
522500 -- [-981.152] (-971.200) (-984.060) (-981.329) * (-972.905) [-980.230] (-972.657) (-993.772) -- 0:02:10
523000 -- (-975.637) (-980.700) (-981.209) [-973.546] * [-984.253] (-971.357) (-979.396) (-969.266) -- 0:02:10
523500 -- [-977.585] (-984.479) (-990.869) (-979.801) * (-978.552) [-973.808] (-973.582) (-977.992) -- 0:02:10
524000 -- [-978.747] (-981.756) (-983.112) (-978.813) * (-991.265) (-982.751) (-969.383) [-972.020] -- 0:02:10
524500 -- (-978.580) (-981.799) (-984.493) [-976.942] * (-980.082) [-978.549] (-979.816) (-980.218) -- 0:02:10
525000 -- (-971.204) (-991.846) [-985.233] (-996.291) * (-984.367) [-973.057] (-976.177) (-972.641) -- 0:02:10
Average standard deviation of split frequencies: 0.011651
525500 -- (-977.873) (-991.236) [-974.952] (-972.591) * (-975.534) [-978.436] (-973.220) (-984.036) -- 0:02:10
526000 -- (-982.609) [-968.712] (-975.126) (-972.277) * (-979.602) (-980.803) (-974.607) [-975.384] -- 0:02:09
526500 -- [-973.291] (-982.586) (-977.804) (-991.672) * [-979.418] (-967.561) (-982.337) (-982.010) -- 0:02:09
527000 -- (-983.168) [-981.335] (-984.968) (-981.560) * (-990.488) [-967.862] (-980.054) (-977.746) -- 0:02:09
527500 -- (-972.204) [-981.906] (-982.014) (-982.745) * [-982.160] (-986.117) (-987.411) (-972.261) -- 0:02:09
528000 -- (-986.754) [-975.578] (-982.937) (-977.474) * (-983.672) (-977.038) [-974.771] (-980.403) -- 0:02:09
528500 -- (-978.357) (-980.747) [-973.803] (-979.972) * (-982.902) [-978.302] (-986.219) (-990.895) -- 0:02:09
529000 -- (-989.021) (-984.715) [-985.394] (-969.796) * (-1001.980) [-971.683] (-985.010) (-972.213) -- 0:02:09
529500 -- [-972.922] (-978.927) (-979.132) (-973.672) * (-975.400) (-982.040) (-976.459) [-973.368] -- 0:02:08
530000 -- (-978.260) (-979.600) (-973.592) [-968.021] * [-980.191] (-986.755) (-974.685) (-973.509) -- 0:02:08
Average standard deviation of split frequencies: 0.011130
530500 -- (-970.871) (-994.037) (-979.465) [-965.459] * (-977.890) (-986.537) [-976.024] (-991.058) -- 0:02:08
531000 -- (-984.369) (-993.727) (-982.331) [-970.378] * (-982.263) (-984.915) [-969.923] (-973.197) -- 0:02:08
531500 -- (-976.061) (-986.722) (-978.887) [-978.456] * (-983.440) (-973.944) [-973.638] (-975.417) -- 0:02:08
532000 -- (-993.412) [-980.392] (-983.442) (-972.253) * (-980.809) [-975.094] (-989.431) (-987.953) -- 0:02:08
532500 -- (-988.402) [-970.614] (-987.169) (-975.493) * (-976.490) [-972.568] (-976.276) (-981.401) -- 0:02:08
533000 -- (-980.022) [-983.310] (-981.993) (-985.764) * [-973.618] (-984.229) (-981.327) (-980.465) -- 0:02:07
533500 -- (-975.536) (-981.009) [-982.553] (-981.562) * [-973.371] (-980.304) (-985.393) (-973.233) -- 0:02:07
534000 -- (-972.977) (-982.565) [-966.768] (-981.967) * (-986.706) (-978.351) [-975.308] (-987.427) -- 0:02:07
534500 -- (-984.103) (-985.472) (-989.713) [-975.700] * (-974.039) [-975.466] (-981.013) (-981.561) -- 0:02:07
535000 -- (-973.726) [-970.603] (-980.815) (-992.022) * (-979.154) (-988.495) [-979.274] (-977.006) -- 0:02:07
Average standard deviation of split frequencies: 0.010916
535500 -- [-971.338] (-980.398) (-975.628) (-980.155) * [-984.662] (-976.913) (-974.315) (-982.511) -- 0:02:07
536000 -- [-967.735] (-982.200) (-976.957) (-977.298) * (-977.470) (-979.591) (-972.300) [-971.554] -- 0:02:07
536500 -- (-979.409) (-986.575) [-976.860] (-976.014) * (-975.856) (-975.698) (-983.173) [-978.549] -- 0:02:06
537000 -- (-984.592) [-976.052] (-976.264) (-976.047) * (-980.158) (-977.217) (-975.149) [-975.739] -- 0:02:06
537500 -- (-982.616) (-979.727) (-972.487) [-968.889] * [-978.287] (-980.893) (-974.078) (-976.381) -- 0:02:06
538000 -- [-969.970] (-976.281) (-976.246) (-985.300) * (-970.158) (-972.908) (-981.394) [-970.304] -- 0:02:06
538500 -- (-982.531) (-979.304) [-979.482] (-986.718) * (-978.235) (-979.437) (-976.029) [-976.931] -- 0:02:06
539000 -- [-973.213] (-976.038) (-974.590) (-988.257) * (-983.029) (-982.644) [-974.955] (-982.834) -- 0:02:06
539500 -- [-981.022] (-981.444) (-980.988) (-983.868) * (-985.761) (-979.978) (-977.593) [-975.957] -- 0:02:06
540000 -- (-987.187) (-965.207) (-979.648) [-985.478] * (-973.121) (-974.899) [-981.473] (-984.623) -- 0:02:06
Average standard deviation of split frequencies: 0.010873
540500 -- [-970.594] (-975.374) (-975.110) (-976.563) * [-972.545] (-971.665) (-978.288) (-971.283) -- 0:02:05
541000 -- (-976.195) [-975.731] (-977.827) (-988.574) * (-983.910) (-981.259) [-979.558] (-975.972) -- 0:02:05
541500 -- [-979.480] (-981.076) (-977.106) (-976.267) * (-974.277) (-983.606) (-985.598) [-981.705] -- 0:02:05
542000 -- [-973.638] (-979.951) (-989.775) (-988.235) * [-981.454] (-984.837) (-980.527) (-984.034) -- 0:02:05
542500 -- (-984.997) (-975.191) [-976.153] (-981.601) * [-974.304] (-988.765) (-980.058) (-976.305) -- 0:02:05
543000 -- [-974.064] (-993.199) (-983.477) (-979.234) * (-987.202) (-974.571) (-985.960) [-972.504] -- 0:02:05
543500 -- [-980.777] (-990.391) (-990.916) (-974.232) * (-975.800) (-982.552) (-986.728) [-981.572] -- 0:02:05
544000 -- [-978.405] (-985.244) (-981.918) (-977.512) * (-968.360) (-984.928) [-979.902] (-985.917) -- 0:02:04
544500 -- (-979.438) (-982.773) [-977.216] (-980.060) * (-977.223) (-971.659) [-990.642] (-994.639) -- 0:02:04
545000 -- (-988.935) (-977.557) [-977.863] (-988.411) * [-974.934] (-983.031) (-985.941) (-992.484) -- 0:02:04
Average standard deviation of split frequencies: 0.011173
545500 -- (-972.282) (-976.659) [-973.560] (-981.571) * (-977.523) [-975.018] (-977.798) (-983.051) -- 0:02:04
546000 -- (-985.487) (-985.932) (-970.890) [-975.949] * [-981.160] (-988.554) (-978.384) (-980.029) -- 0:02:04
546500 -- (-972.618) (-979.066) [-978.023] (-975.491) * (-983.067) [-982.313] (-981.133) (-976.304) -- 0:02:04
547000 -- (-988.796) [-982.079] (-981.877) (-968.775) * (-972.972) (-984.808) (-989.533) [-971.595] -- 0:02:04
547500 -- (-979.438) (-977.875) (-975.113) [-977.508] * (-975.233) (-990.184) (-983.788) [-980.782] -- 0:02:03
548000 -- (-976.197) (-968.463) [-978.282] (-975.532) * [-970.529] (-993.335) (-983.121) (-974.894) -- 0:02:03
548500 -- (-976.930) (-980.684) [-972.288] (-981.452) * (-970.386) (-981.531) [-978.696] (-986.665) -- 0:02:03
549000 -- (-972.539) (-978.914) [-976.873] (-978.425) * (-974.235) (-986.141) (-973.773) [-971.493] -- 0:02:03
549500 -- (-981.722) [-976.009] (-997.677) (-983.002) * (-971.338) (-984.437) [-982.096] (-986.983) -- 0:02:03
550000 -- (-975.097) [-974.534] (-991.412) (-989.178) * [-971.030] (-993.176) (-982.602) (-978.891) -- 0:02:03
Average standard deviation of split frequencies: 0.011431
550500 -- (-975.303) (-981.029) (-984.284) [-980.895] * [-975.734] (-987.652) (-983.055) (-969.132) -- 0:02:03
551000 -- (-986.398) (-972.971) (-986.686) [-971.865] * (-977.145) (-983.991) (-976.479) [-970.255] -- 0:02:03
551500 -- (-984.456) (-975.044) (-987.221) [-970.506] * (-971.580) (-991.825) [-979.581] (-991.896) -- 0:02:02
552000 -- (-978.127) [-974.101] (-977.481) (-986.285) * (-969.267) (-985.961) [-974.391] (-973.794) -- 0:02:02
552500 -- (-986.998) [-971.034] (-974.801) (-982.733) * (-988.331) (-984.654) [-982.458] (-982.166) -- 0:02:02
553000 -- [-970.576] (-983.680) (-983.391) (-993.431) * [-975.488] (-978.578) (-982.040) (-977.173) -- 0:02:02
553500 -- (-978.833) (-978.897) (-975.075) [-974.473] * (-975.556) (-986.666) (-979.494) [-969.475] -- 0:02:02
554000 -- [-979.708] (-985.105) (-974.053) (-974.158) * (-977.709) (-980.968) (-984.386) [-975.894] -- 0:02:02
554500 -- [-973.756] (-990.625) (-986.559) (-985.059) * (-988.874) (-979.982) [-978.424] (-980.516) -- 0:02:02
555000 -- [-984.621] (-1001.561) (-975.960) (-978.207) * (-985.415) [-976.585] (-978.162) (-973.089) -- 0:02:01
Average standard deviation of split frequencies: 0.011222
555500 -- [-968.772] (-994.936) (-972.271) (-972.277) * [-985.960] (-978.427) (-980.405) (-984.498) -- 0:02:01
556000 -- (-989.491) (-992.245) [-966.859] (-980.730) * (-984.223) (-978.446) [-985.362] (-979.058) -- 0:02:01
556500 -- (-979.438) (-987.431) [-968.240] (-983.913) * (-973.830) [-980.076] (-980.982) (-975.973) -- 0:02:01
557000 -- (-971.401) (-986.461) (-978.958) [-975.336] * [-976.290] (-974.843) (-974.205) (-974.657) -- 0:02:01
557500 -- (-979.835) [-970.819] (-984.455) (-982.777) * (-974.156) (-983.473) (-991.340) [-972.256] -- 0:02:01
558000 -- (-986.587) [-976.992] (-976.810) (-967.624) * [-972.919] (-976.424) (-988.898) (-986.720) -- 0:02:01
558500 -- (-980.619) [-974.727] (-974.938) (-981.842) * (-975.456) [-972.978] (-988.242) (-986.051) -- 0:02:00
559000 -- (-988.182) [-970.228] (-979.403) (-981.127) * [-968.949] (-981.606) (-979.540) (-975.541) -- 0:02:00
559500 -- (-980.532) (-999.852) (-969.389) [-974.221] * (-983.752) [-970.458] (-975.039) (-975.193) -- 0:02:00
560000 -- (-983.141) (-990.433) (-974.808) [-966.678] * (-983.974) (-982.090) (-976.359) [-971.895] -- 0:02:00
Average standard deviation of split frequencies: 0.011425
560500 -- [-972.370] (-995.114) (-982.437) (-970.420) * (-979.102) [-971.967] (-984.564) (-974.377) -- 0:01:59
561000 -- [-974.234] (-993.693) (-987.902) (-965.291) * (-982.864) (-982.421) [-975.521] (-984.035) -- 0:02:00
561500 -- (-984.762) (-990.940) [-978.277] (-986.200) * (-980.560) (-979.614) (-983.735) [-980.766] -- 0:02:00
562000 -- (-983.302) (-989.728) [-980.132] (-975.587) * (-981.097) [-981.811] (-983.617) (-987.403) -- 0:02:00
562500 -- (-984.185) (-996.827) [-972.067] (-975.546) * (-982.543) (-977.870) (-989.111) [-979.715] -- 0:01:59
563000 -- (-974.368) (-983.501) (-977.409) [-977.340] * [-977.306] (-991.863) (-989.471) (-985.670) -- 0:01:59
563500 -- (-981.098) (-978.123) [-975.829] (-982.582) * (-986.540) (-987.298) (-980.444) [-973.637] -- 0:01:59
564000 -- (-977.062) [-977.191] (-988.309) (-976.529) * [-981.897] (-989.646) (-983.245) (-985.024) -- 0:01:59
564500 -- [-974.315] (-979.328) (-986.659) (-984.727) * (-976.049) (-980.298) (-976.497) [-973.787] -- 0:01:59
565000 -- [-969.507] (-979.799) (-989.630) (-978.217) * [-974.969] (-977.179) (-985.755) (-976.795) -- 0:01:59
Average standard deviation of split frequencies: 0.011366
565500 -- (-971.227) (-981.027) [-973.935] (-987.587) * (-981.423) [-986.131] (-984.247) (-971.401) -- 0:01:59
566000 -- [-975.495] (-980.366) (-979.342) (-976.486) * [-967.761] (-994.270) (-988.522) (-972.723) -- 0:01:58
566500 -- [-972.044] (-976.944) (-977.390) (-985.192) * (-981.602) (-987.238) [-973.065] (-980.744) -- 0:01:58
567000 -- (-974.138) [-967.631] (-979.114) (-980.557) * (-973.435) (-984.247) (-977.956) [-972.397] -- 0:01:58
567500 -- (-980.494) (-982.837) (-989.248) [-974.719] * (-978.048) (-987.510) (-978.864) [-967.193] -- 0:01:58
568000 -- [-973.894] (-981.795) (-976.003) (-987.108) * (-986.040) (-996.169) [-977.560] (-972.875) -- 0:01:58
568500 -- (-982.458) (-981.655) [-974.936] (-971.412) * (-987.505) [-983.640] (-979.466) (-977.503) -- 0:01:58
569000 -- (-986.992) (-978.418) [-980.783] (-969.716) * [-986.363] (-988.485) (-992.181) (-972.098) -- 0:01:58
569500 -- (-974.195) (-979.980) (-991.322) [-973.500] * (-981.861) (-982.960) [-978.321] (-974.846) -- 0:01:57
570000 -- (-979.262) (-980.455) (-992.592) [-978.398] * (-984.718) [-976.570] (-984.767) (-981.926) -- 0:01:57
Average standard deviation of split frequencies: 0.010885
570500 -- (-996.121) (-974.902) [-988.564] (-978.651) * [-988.453] (-967.767) (-983.176) (-985.108) -- 0:01:57
571000 -- (-979.794) [-977.008] (-977.919) (-995.061) * (-974.272) (-976.339) [-970.327] (-992.550) -- 0:01:57
571500 -- [-985.264] (-979.376) (-995.402) (-984.281) * [-972.111] (-982.738) (-978.589) (-984.084) -- 0:01:57
572000 -- [-980.001] (-982.660) (-982.337) (-982.897) * (-980.284) [-981.435] (-976.224) (-972.243) -- 0:01:57
572500 -- (-973.190) (-979.411) [-972.723] (-980.026) * (-979.868) (-980.157) [-976.536] (-976.515) -- 0:01:57
573000 -- [-970.610] (-986.190) (-977.780) (-982.292) * (-977.503) (-993.902) (-982.788) [-977.458] -- 0:01:56
573500 -- [-967.209] (-983.695) (-975.244) (-983.403) * (-979.884) (-978.149) [-988.055] (-976.955) -- 0:01:56
574000 -- (-974.783) [-977.415] (-976.277) (-974.525) * (-982.370) (-976.675) [-971.760] (-986.437) -- 0:01:56
574500 -- (-972.662) (-977.079) (-966.043) [-970.953] * (-986.083) (-991.714) (-982.335) [-972.344] -- 0:01:56
575000 -- (-992.109) (-987.337) [-972.069] (-977.563) * (-978.106) (-982.321) (-970.785) [-970.863] -- 0:01:56
Average standard deviation of split frequencies: 0.010976
575500 -- (-985.787) (-985.963) [-973.757] (-976.869) * (-984.140) (-997.440) (-982.587) [-972.176] -- 0:01:56
576000 -- (-999.557) [-975.869] (-979.595) (-969.994) * [-969.693] (-989.921) (-993.471) (-969.669) -- 0:01:56
576500 -- (-989.005) [-968.196] (-990.074) (-981.473) * (-980.046) [-976.453] (-976.013) (-968.898) -- 0:01:56
577000 -- (-990.766) (-983.780) [-978.970] (-983.618) * (-983.741) (-988.717) (-975.188) [-981.610] -- 0:01:55
577500 -- (-978.519) [-976.631] (-975.687) (-985.844) * (-983.949) (-980.086) (-973.162) [-973.561] -- 0:01:55
578000 -- (-983.430) (-980.642) [-970.652] (-980.567) * [-974.131] (-989.989) (-979.270) (-973.353) -- 0:01:55
578500 -- (-968.554) (-968.924) (-972.821) [-971.709] * (-989.398) [-995.352] (-976.360) (-977.337) -- 0:01:55
579000 -- (-983.148) (-971.496) (-989.792) [-974.616] * (-986.492) (-991.122) [-978.018] (-974.128) -- 0:01:55
579500 -- [-968.618] (-972.873) (-994.498) (-983.859) * [-971.224] (-979.654) (-987.470) (-975.326) -- 0:01:55
580000 -- (-971.919) [-977.922] (-978.756) (-992.376) * (-977.231) (-975.654) (-984.952) [-972.489] -- 0:01:55
Average standard deviation of split frequencies: 0.011270
580500 -- [-975.618] (-987.535) (-978.338) (-975.343) * [-973.117] (-980.577) (-973.839) (-991.163) -- 0:01:54
581000 -- (-971.472) (-989.871) [-977.763] (-978.748) * [-985.645] (-974.033) (-979.995) (-980.748) -- 0:01:54
581500 -- (-982.608) [-981.831] (-975.363) (-973.783) * (-993.800) [-978.687] (-987.610) (-980.790) -- 0:01:54
582000 -- (-976.863) [-974.816] (-976.786) (-994.973) * (-997.037) (-980.332) (-985.005) [-969.590] -- 0:01:54
582500 -- [-978.679] (-972.881) (-994.915) (-983.482) * [-977.932] (-995.009) (-986.387) (-976.065) -- 0:01:54
583000 -- [-972.986] (-974.530) (-977.471) (-981.352) * (-987.566) (-977.580) (-986.680) [-977.239] -- 0:01:54
583500 -- [-968.383] (-987.778) (-985.462) (-982.750) * (-981.752) (-981.331) (-980.956) [-984.017] -- 0:01:54
584000 -- (-970.256) (-982.807) (-988.414) [-980.382] * (-976.308) (-973.755) (-975.119) [-978.767] -- 0:01:53
584500 -- (-977.951) [-985.344] (-1001.899) (-983.819) * (-990.001) [-978.892] (-985.276) (-987.409) -- 0:01:53
585000 -- (-983.482) (-979.958) (-986.212) [-988.230] * (-974.592) [-969.246] (-989.728) (-974.971) -- 0:01:53
Average standard deviation of split frequencies: 0.011026
585500 -- (-980.908) [-974.746] (-976.891) (-994.402) * (-981.812) [-973.854] (-983.416) (-974.634) -- 0:01:53
586000 -- [-977.166] (-975.968) (-984.462) (-976.551) * (-983.685) (-979.881) [-978.583] (-985.115) -- 0:01:53
586500 -- (-985.347) (-977.039) (-987.361) [-984.094] * (-985.407) [-977.898] (-985.439) (-986.790) -- 0:01:53
587000 -- (-983.696) (-983.626) [-982.711] (-987.516) * (-972.392) (-988.127) (-982.645) [-973.192] -- 0:01:53
587500 -- (-989.607) (-983.983) (-980.346) [-979.215] * (-983.398) (-979.880) (-970.824) [-983.442] -- 0:01:53
588000 -- (-984.817) (-980.665) (-982.799) [-980.898] * [-976.113] (-979.099) (-990.857) (-970.550) -- 0:01:52
588500 -- [-974.122] (-992.553) (-981.026) (-985.866) * (-985.088) (-980.879) [-976.339] (-974.913) -- 0:01:52
589000 -- [-974.327] (-979.470) (-980.859) (-985.789) * (-972.924) (-994.546) (-980.639) [-980.111] -- 0:01:52
589500 -- (-988.243) (-987.260) (-982.169) [-975.001] * [-968.002] (-977.810) (-1000.033) (-982.114) -- 0:01:52
590000 -- (-976.220) [-972.632] (-979.718) (-981.534) * [-975.474] (-1002.853) (-976.604) (-978.202) -- 0:01:52
Average standard deviation of split frequencies: 0.010375
590500 -- (-970.202) (-980.720) (-979.699) [-974.578] * (-974.473) (-1003.095) [-986.249] (-976.268) -- 0:01:52
591000 -- [-968.952] (-996.636) (-980.637) (-979.918) * [-967.562] (-981.083) (-994.008) (-978.683) -- 0:01:52
591500 -- (-990.946) (-979.401) [-972.965] (-983.092) * (-978.761) (-979.395) [-978.185] (-985.374) -- 0:01:51
592000 -- (-981.829) (-984.971) (-989.364) [-978.290] * (-984.297) (-989.852) [-979.106] (-983.235) -- 0:01:51
592500 -- [-979.172] (-982.737) (-990.182) (-983.917) * [-971.824] (-976.849) (-975.616) (-981.035) -- 0:01:51
593000 -- [-977.435] (-977.341) (-974.849) (-982.744) * (-971.711) (-988.664) [-974.150] (-983.871) -- 0:01:51
593500 -- [-974.119] (-976.775) (-989.056) (-974.540) * (-972.049) (-991.297) (-990.339) [-978.205] -- 0:01:51
594000 -- (-978.821) (-979.788) (-974.067) [-977.736] * [-966.958] (-980.456) (-982.913) (-984.667) -- 0:01:51
594500 -- (-968.007) (-985.667) [-974.942] (-987.245) * (-982.702) (-979.513) [-976.238] (-982.956) -- 0:01:51
595000 -- (-977.525) (-982.359) [-974.979] (-976.202) * (-974.756) (-980.933) [-972.067] (-984.958) -- 0:01:50
Average standard deviation of split frequencies: 0.010468
595500 -- [-975.359] (-975.973) (-978.104) (-976.741) * (-979.837) (-984.809) (-985.585) [-986.174] -- 0:01:50
596000 -- (-976.946) (-983.745) [-970.714] (-978.023) * [-971.374] (-979.903) (-984.127) (-986.302) -- 0:01:50
596500 -- (-975.541) (-978.001) [-975.003] (-979.642) * [-976.781] (-977.426) (-988.563) (-987.817) -- 0:01:50
597000 -- (-982.996) (-972.612) (-974.609) [-978.058] * (-978.547) (-995.413) [-975.102] (-979.009) -- 0:01:50
597500 -- [-972.534] (-988.094) (-980.049) (-970.300) * (-977.019) (-991.241) [-983.827] (-989.566) -- 0:01:50
598000 -- (-984.118) (-979.265) (-983.482) [-971.277] * (-982.475) (-988.426) (-978.538) [-981.354] -- 0:01:50
598500 -- (-980.214) (-980.089) [-981.795] (-980.075) * [-980.483] (-983.337) (-984.635) (-994.211) -- 0:01:50
599000 -- (-981.068) [-973.396] (-977.739) (-984.938) * (-988.218) [-976.556] (-976.353) (-981.849) -- 0:01:49
599500 -- [-969.974] (-979.764) (-980.768) (-976.169) * (-982.714) [-978.851] (-982.288) (-975.588) -- 0:01:49
600000 -- (-986.373) (-972.036) (-985.976) [-977.176] * (-991.973) [-991.240] (-979.312) (-982.593) -- 0:01:49
Average standard deviation of split frequencies: 0.010202
600500 -- (-984.368) (-974.973) (-981.261) [-971.626] * [-976.205] (-976.256) (-976.580) (-982.269) -- 0:01:49
601000 -- (-980.733) [-977.433] (-973.030) (-977.429) * (-978.395) (-981.350) (-977.874) [-975.794] -- 0:01:49
601500 -- (-998.392) (-981.206) [-982.448] (-978.036) * (-991.250) (-992.594) [-972.730] (-969.598) -- 0:01:49
602000 -- (-995.250) [-975.767] (-979.107) (-985.977) * (-981.808) [-978.316] (-978.366) (-984.972) -- 0:01:49
602500 -- (-981.063) [-971.715] (-975.753) (-982.508) * (-976.367) (-980.964) (-977.887) [-978.321] -- 0:01:48
603000 -- (-978.687) [-975.676] (-978.265) (-976.267) * (-988.639) (-992.755) (-981.486) [-970.041] -- 0:01:48
603500 -- [-972.182] (-983.718) (-985.117) (-974.777) * (-978.164) (-984.891) [-973.464] (-973.538) -- 0:01:48
604000 -- (-982.610) [-982.290] (-985.920) (-977.686) * (-982.812) (-981.549) (-975.418) [-976.097] -- 0:01:48
604500 -- (-973.874) (-982.551) (-975.114) [-970.549] * (-987.465) [-977.362] (-971.279) (-980.782) -- 0:01:48
605000 -- (-979.950) [-982.568] (-978.386) (-973.137) * (-997.201) [-969.585] (-984.144) (-979.824) -- 0:01:48
Average standard deviation of split frequencies: 0.009975
605500 -- (-975.828) [-976.503] (-974.378) (-977.123) * (-986.991) [-976.154] (-974.750) (-970.563) -- 0:01:48
606000 -- (-980.224) (-1003.155) (-988.521) [-979.093] * (-995.658) (-984.688) [-971.609] (-980.573) -- 0:01:47
606500 -- (-992.498) (-973.713) (-975.020) [-979.663] * (-982.412) (-979.519) [-972.633] (-991.199) -- 0:01:47
607000 -- (-971.262) [-972.906] (-982.172) (-988.865) * (-974.008) (-994.218) (-980.095) [-980.828] -- 0:01:47
607500 -- (-977.325) [-975.799] (-982.971) (-988.201) * [-969.878] (-977.153) (-977.459) (-982.286) -- 0:01:47
608000 -- [-976.664] (-976.972) (-985.667) (-985.035) * [-974.246] (-973.178) (-981.499) (-990.339) -- 0:01:47
608500 -- (-978.384) [-971.116] (-975.436) (-980.219) * (-969.016) [-978.960] (-978.328) (-990.040) -- 0:01:47
609000 -- (-978.807) [-966.444] (-981.654) (-978.830) * (-977.139) (-974.882) [-971.924] (-983.469) -- 0:01:47
609500 -- [-979.208] (-973.130) (-988.940) (-987.679) * (-978.270) [-966.058] (-981.644) (-986.056) -- 0:01:46
610000 -- (-982.401) [-975.589] (-977.376) (-998.990) * (-984.840) (-979.086) [-975.616] (-986.437) -- 0:01:46
Average standard deviation of split frequencies: 0.009854
610500 -- (-983.567) [-982.901] (-990.914) (-992.559) * (-989.363) (-982.894) [-975.286] (-990.464) -- 0:01:46
611000 -- (-981.072) [-980.580] (-982.097) (-980.226) * (-986.932) (-973.788) (-979.033) [-977.151] -- 0:01:46
611500 -- (-989.929) (-989.937) (-986.522) [-980.397] * [-974.851] (-977.054) (-976.019) (-992.048) -- 0:01:46
612000 -- (-982.196) (-976.046) (-978.421) [-978.571] * (-973.904) [-978.568] (-992.765) (-974.060) -- 0:01:46
612500 -- (-979.071) (-988.837) [-979.892] (-986.451) * (-992.357) [-980.131] (-983.652) (-985.402) -- 0:01:46
613000 -- [-977.318] (-990.746) (-977.250) (-982.829) * (-1001.435) (-973.701) (-997.200) [-971.660] -- 0:01:46
613500 -- (-975.600) (-981.928) (-975.479) [-967.521] * [-984.611] (-980.466) (-985.830) (-991.139) -- 0:01:45
614000 -- [-969.435] (-969.642) (-976.287) (-980.301) * [-976.923] (-984.091) (-1004.378) (-975.317) -- 0:01:45
614500 -- (-970.201) (-979.750) [-976.236] (-982.623) * (-973.332) [-968.951] (-988.789) (-985.707) -- 0:01:45
615000 -- (-988.778) [-971.017] (-978.637) (-981.006) * (-976.575) (-982.121) (-994.971) [-976.474] -- 0:01:45
Average standard deviation of split frequencies: 0.010309
615500 -- (-970.252) [-972.563] (-974.410) (-988.096) * [-976.820] (-972.842) (-981.699) (-972.557) -- 0:01:45
616000 -- [-979.419] (-977.965) (-987.239) (-982.755) * [-976.300] (-978.400) (-978.001) (-975.973) -- 0:01:45
616500 -- (-975.622) (-980.035) [-974.666] (-978.520) * (-999.126) [-972.431] (-979.107) (-972.556) -- 0:01:45
617000 -- [-972.714] (-971.994) (-982.469) (-974.962) * (-986.345) (-976.683) (-995.623) [-971.092] -- 0:01:44
617500 -- [-973.270] (-975.716) (-973.284) (-986.072) * [-972.566] (-965.587) (-981.787) (-983.263) -- 0:01:44
618000 -- (-977.963) (-994.951) [-974.233] (-983.687) * [-973.131] (-984.206) (-984.185) (-989.336) -- 0:01:44
618500 -- (-976.086) (-983.905) (-985.447) [-970.607] * [-976.799] (-976.126) (-983.590) (-983.225) -- 0:01:44
619000 -- (-985.542) (-983.081) (-970.047) [-976.230] * (-976.049) (-979.733) (-976.681) [-977.650] -- 0:01:44
619500 -- (-973.241) (-973.542) (-983.919) [-975.332] * (-975.513) (-983.179) (-981.507) [-973.918] -- 0:01:44
620000 -- (-980.225) (-986.709) (-985.069) [-974.131] * (-984.050) (-976.426) (-984.528) [-976.848] -- 0:01:44
Average standard deviation of split frequencies: 0.011266
620500 -- (-980.401) (-974.381) (-978.265) [-975.590] * (-980.414) (-971.093) (-980.701) [-982.248] -- 0:01:43
621000 -- (-1010.238) [-982.096] (-987.871) (-973.856) * (-981.286) [-976.925] (-983.628) (-977.542) -- 0:01:43
621500 -- (-991.800) [-979.873] (-974.959) (-978.342) * (-981.292) [-975.274] (-987.923) (-985.935) -- 0:01:43
622000 -- (-987.014) [-976.519] (-973.324) (-973.052) * (-980.424) (-978.943) (-998.767) [-966.796] -- 0:01:43
622500 -- (-974.570) [-973.697] (-985.161) (-977.425) * (-971.308) (-993.776) (-986.356) [-969.534] -- 0:01:43
623000 -- [-984.408] (-976.444) (-983.853) (-983.514) * (-978.967) [-972.142] (-978.133) (-991.185) -- 0:01:43
623500 -- (-973.626) (-976.193) (-980.471) [-979.719] * (-976.727) [-978.417] (-976.727) (-980.824) -- 0:01:43
624000 -- (-988.680) (-989.111) (-982.427) [-970.184] * (-985.565) [-976.811] (-985.467) (-983.702) -- 0:01:43
624500 -- (-986.748) (-981.495) (-980.533) [-969.222] * (-979.939) (-985.012) (-984.052) [-969.746] -- 0:01:42
625000 -- (-986.033) [-970.196] (-978.520) (-980.356) * [-978.153] (-987.507) (-974.294) (-994.553) -- 0:01:42
Average standard deviation of split frequencies: 0.010710
625500 -- (-977.533) (-982.489) (-990.276) [-977.116] * [-968.697] (-979.049) (-983.143) (-975.389) -- 0:01:42
626000 -- (-980.713) [-976.654] (-987.105) (-972.358) * [-976.876] (-980.263) (-994.381) (-982.941) -- 0:01:42
626500 -- (-987.184) (-975.407) (-977.734) [-971.131] * (-984.467) (-972.274) (-1002.987) [-972.427] -- 0:01:42
627000 -- (-977.270) (-995.889) (-988.042) [-977.998] * (-991.309) (-978.536) (-984.013) [-976.814] -- 0:01:42
627500 -- [-969.462] (-990.180) (-984.409) (-990.365) * [-966.115] (-991.418) (-976.087) (-983.790) -- 0:01:42
628000 -- (-970.511) (-986.463) [-977.587] (-978.885) * [-975.226] (-979.322) (-1000.730) (-975.114) -- 0:01:41
628500 -- (-977.771) (-987.309) [-978.120] (-982.188) * (-976.943) [-982.714] (-977.533) (-992.114) -- 0:01:41
629000 -- (-968.189) (-975.294) [-974.379] (-980.702) * [-974.107] (-986.402) (-984.224) (-988.114) -- 0:01:41
629500 -- (-977.579) [-978.133] (-983.180) (-972.511) * (-984.859) (-981.866) (-978.762) [-977.164] -- 0:01:41
630000 -- [-981.748] (-973.880) (-988.927) (-982.109) * (-969.376) [-971.994] (-974.159) (-973.963) -- 0:01:41
Average standard deviation of split frequencies: 0.011087
630500 -- (-977.059) (-973.436) [-971.827] (-972.485) * [-975.021] (-979.636) (-973.216) (-987.447) -- 0:01:41
631000 -- (-975.696) (-979.736) (-980.924) [-976.424] * (-981.040) [-979.259] (-983.226) (-986.574) -- 0:01:41
631500 -- [-980.471] (-989.795) (-978.031) (-994.231) * (-981.968) (-975.599) (-995.565) [-978.787] -- 0:01:40
632000 -- [-980.683] (-979.928) (-976.523) (-980.163) * (-979.877) (-985.534) (-983.732) [-982.777] -- 0:01:40
632500 -- (-990.249) [-976.586] (-982.938) (-975.445) * (-984.650) (-975.629) [-974.942] (-989.489) -- 0:01:40
633000 -- (-994.458) (-979.807) (-975.626) [-973.962] * (-974.940) (-990.707) (-978.987) [-987.127] -- 0:01:40
633500 -- [-973.089] (-987.689) (-976.072) (-980.726) * (-980.640) (-979.985) [-975.468] (-974.533) -- 0:01:40
634000 -- [-977.422] (-972.669) (-982.710) (-982.815) * (-975.558) (-988.149) [-973.405] (-981.469) -- 0:01:40
634500 -- (-977.144) (-986.891) [-983.840] (-973.559) * (-989.089) (-977.984) [-984.715] (-980.868) -- 0:01:40
635000 -- [-968.540] (-982.573) (-979.787) (-989.889) * (-978.631) (-978.020) (-978.355) [-978.534] -- 0:01:40
Average standard deviation of split frequencies: 0.011406
635500 -- (-973.914) (-986.772) (-987.640) [-977.455] * (-988.601) (-982.925) [-976.407] (-974.100) -- 0:01:39
636000 -- (-985.312) (-982.475) (-975.890) [-970.500] * [-975.985] (-979.426) (-980.444) (-990.979) -- 0:01:39
636500 -- (-985.958) (-983.450) (-974.853) [-965.693] * [-971.545] (-983.957) (-976.581) (-980.027) -- 0:01:39
637000 -- (-981.038) (-980.269) [-974.909] (-971.435) * [-974.553] (-979.407) (-978.870) (-978.157) -- 0:01:39
637500 -- [-978.816] (-987.698) (-991.910) (-982.603) * [-970.077] (-986.867) (-988.137) (-972.322) -- 0:01:39
638000 -- [-981.990] (-977.597) (-984.613) (-982.801) * (-988.847) (-975.330) (-984.571) [-974.841] -- 0:01:39
638500 -- (-987.515) [-975.819] (-982.946) (-974.476) * (-977.631) (-969.776) (-987.253) [-966.287] -- 0:01:39
639000 -- (-978.876) [-980.289] (-995.582) (-974.422) * (-980.474) (-977.978) (-992.320) [-969.764] -- 0:01:38
639500 -- [-979.537] (-980.377) (-974.202) (-980.218) * (-987.745) (-984.101) (-984.267) [-974.887] -- 0:01:38
640000 -- (-976.196) (-977.948) (-978.431) [-974.520] * (-979.402) (-993.495) (-980.945) [-972.205] -- 0:01:38
Average standard deviation of split frequencies: 0.011427
640500 -- (-983.252) (-987.753) (-980.309) [-969.166] * [-982.650] (-999.315) (-985.223) (-975.186) -- 0:01:38
641000 -- (-985.818) (-988.195) (-983.113) [-973.649] * [-979.055] (-981.069) (-976.258) (-971.241) -- 0:01:38
641500 -- (-986.003) [-979.276] (-998.433) (-974.707) * (-966.555) [-982.578] (-986.906) (-993.387) -- 0:01:38
642000 -- (-982.212) (-980.810) (-979.548) [-979.782] * (-974.595) [-977.575] (-989.974) (-975.516) -- 0:01:38
642500 -- (-985.827) (-976.682) [-977.180] (-974.886) * (-977.154) [-973.585] (-976.061) (-974.734) -- 0:01:37
643000 -- [-980.082] (-988.096) (-973.754) (-978.496) * [-982.450] (-973.660) (-984.830) (-977.327) -- 0:01:37
643500 -- (-981.059) [-976.494] (-974.243) (-979.260) * (-979.289) [-985.252] (-990.505) (-987.305) -- 0:01:37
644000 -- (-981.473) (-978.409) (-976.902) [-982.522] * (-990.562) [-981.964] (-988.399) (-972.395) -- 0:01:37
644500 -- [-983.413] (-968.082) (-971.118) (-979.109) * (-980.917) (-983.064) [-975.551] (-989.711) -- 0:01:37
645000 -- (-982.158) [-972.465] (-987.548) (-980.928) * [-970.198] (-975.333) (-978.298) (-983.494) -- 0:01:37
Average standard deviation of split frequencies: 0.011311
645500 -- (-981.412) (-985.782) (-991.960) [-975.904] * (-978.096) [-963.641] (-985.669) (-977.637) -- 0:01:37
646000 -- [-976.473] (-982.137) (-975.558) (-980.497) * (-984.399) (-988.461) [-986.418] (-978.437) -- 0:01:36
646500 -- (-980.611) (-975.758) (-982.250) [-973.037] * [-974.138] (-983.201) (-976.838) (-973.715) -- 0:01:36
647000 -- (-976.790) [-974.602] (-995.367) (-989.077) * (-981.228) (-981.280) [-981.369] (-986.179) -- 0:01:36
647500 -- (-980.333) (-982.881) (-984.434) [-969.098] * [-974.889] (-970.623) (-974.460) (-986.273) -- 0:01:36
648000 -- [-975.202] (-977.858) (-970.227) (-986.791) * (-975.708) (-978.122) (-985.692) [-970.185] -- 0:01:36
648500 -- (-982.869) (-979.623) [-969.168] (-979.994) * (-977.496) [-969.459] (-998.904) (-972.434) -- 0:01:36
649000 -- (-974.210) (-972.432) [-984.632] (-984.374) * (-982.793) (-967.170) (-985.802) [-967.153] -- 0:01:36
649500 -- (-982.035) [-974.332] (-983.413) (-975.470) * [-973.437] (-971.912) (-973.561) (-976.336) -- 0:01:36
650000 -- (-988.165) [-966.694] (-981.186) (-977.948) * [-978.460] (-974.055) (-985.869) (-973.792) -- 0:01:35
Average standard deviation of split frequencies: 0.011592
650500 -- (-972.487) (-972.556) (-989.156) [-982.089] * (-973.539) [-982.303] (-978.101) (-993.072) -- 0:01:35
651000 -- (-980.541) [-969.916] (-978.008) (-979.063) * [-975.523] (-982.356) (-982.638) (-987.113) -- 0:01:35
651500 -- [-970.543] (-982.937) (-978.424) (-981.860) * (-983.755) (-977.581) [-973.596] (-976.539) -- 0:01:35
652000 -- (-986.939) (-971.910) (-989.840) [-976.663] * (-992.199) [-972.728] (-980.811) (-969.065) -- 0:01:35
652500 -- (-989.375) [-971.423] (-970.619) (-987.674) * (-977.396) [-968.486] (-990.853) (-978.225) -- 0:01:35
653000 -- [-983.593] (-973.694) (-970.020) (-988.331) * (-977.319) [-980.535] (-987.759) (-979.555) -- 0:01:35
653500 -- [-975.546] (-995.835) (-981.530) (-982.339) * (-980.543) (-972.533) (-992.186) [-982.712] -- 0:01:34
654000 -- (-991.483) [-981.886] (-981.544) (-982.120) * (-974.127) [-971.918] (-983.634) (-986.223) -- 0:01:34
654500 -- (-977.646) (-977.863) [-971.428] (-978.759) * [-972.876] (-979.893) (-980.187) (-977.641) -- 0:01:34
655000 -- (-983.020) (-988.889) [-977.384] (-990.481) * (-980.755) [-976.865] (-969.716) (-974.655) -- 0:01:34
Average standard deviation of split frequencies: 0.011538
655500 -- (-981.109) (-985.998) [-971.757] (-990.752) * (-991.698) (-973.698) (-980.301) [-979.211] -- 0:01:34
656000 -- [-976.476] (-980.955) (-986.414) (-979.657) * (-974.333) (-990.119) [-971.370] (-981.255) -- 0:01:34
656500 -- [-970.969] (-986.870) (-974.510) (-991.390) * (-976.503) (-986.452) [-971.011] (-980.582) -- 0:01:34
657000 -- [-975.902] (-991.406) (-974.449) (-984.551) * (-977.744) [-978.280] (-982.596) (-984.978) -- 0:01:33
657500 -- [-971.340] (-983.567) (-984.015) (-979.803) * (-973.925) (-991.346) [-978.285] (-975.925) -- 0:01:33
658000 -- (-980.907) (-980.346) (-973.001) [-983.429] * (-990.506) [-976.143] (-973.986) (-983.160) -- 0:01:33
658500 -- [-971.242] (-972.882) (-989.287) (-979.023) * [-978.819] (-979.245) (-971.330) (-990.452) -- 0:01:33
659000 -- [-991.602] (-981.042) (-981.072) (-979.355) * [-979.883] (-998.560) (-976.567) (-975.180) -- 0:01:33
659500 -- (-991.023) [-973.532] (-981.332) (-993.067) * [-979.308] (-985.640) (-980.790) (-980.014) -- 0:01:33
660000 -- [-972.156] (-979.172) (-972.787) (-982.336) * (-996.806) (-976.437) [-967.727] (-972.780) -- 0:01:33
Average standard deviation of split frequencies: 0.011535
660500 -- (-985.913) (-969.167) (-976.990) [-977.312] * (-982.692) (-986.172) [-971.350] (-977.742) -- 0:01:33
661000 -- [-972.005] (-975.641) (-992.808) (-979.038) * (-980.610) (-987.044) (-979.020) [-980.581] -- 0:01:32
661500 -- (-974.703) (-979.188) [-976.691] (-983.258) * (-991.898) (-998.904) (-987.204) [-976.663] -- 0:01:32
662000 -- (-980.956) (-977.358) [-974.065] (-977.460) * (-991.769) (-985.062) (-982.386) [-968.583] -- 0:01:32
662500 -- [-975.870] (-989.598) (-978.728) (-984.522) * (-982.653) [-981.599] (-980.571) (-981.392) -- 0:01:32
663000 -- (-971.850) (-973.758) [-979.432] (-983.416) * (-987.184) (-980.965) [-974.494] (-976.007) -- 0:01:32
663500 -- (-967.634) [-973.979] (-992.216) (-983.333) * (-978.871) (-992.288) (-979.478) [-976.875] -- 0:01:32
664000 -- (-968.077) [-970.497] (-986.662) (-989.781) * (-980.931) [-980.267] (-978.246) (-980.828) -- 0:01:32
664500 -- (-992.289) (-980.229) (-989.217) [-976.094] * [-977.396] (-982.141) (-986.293) (-982.648) -- 0:01:31
665000 -- [-988.044] (-975.928) (-972.520) (-1001.301) * (-987.068) [-980.856] (-984.047) (-978.502) -- 0:01:31
Average standard deviation of split frequencies: 0.011679
665500 -- (-983.871) (-977.264) [-972.960] (-984.376) * (-975.633) (-971.191) (-985.004) [-974.872] -- 0:01:31
666000 -- (-985.288) (-980.000) (-984.188) [-982.843] * [-972.547] (-984.447) (-974.867) (-977.081) -- 0:01:31
666500 -- (-985.279) (-982.090) (-978.581) [-968.136] * [-981.369] (-980.737) (-976.220) (-978.247) -- 0:01:31
667000 -- (-976.410) [-973.179] (-974.496) (-981.232) * (-978.408) (-991.334) (-974.842) [-970.863] -- 0:01:31
667500 -- (-988.912) [-979.478] (-975.704) (-974.631) * (-980.730) (-977.044) [-974.010] (-978.494) -- 0:01:31
668000 -- (-984.300) [-978.376] (-976.527) (-984.510) * (-990.872) (-979.387) [-977.356] (-982.246) -- 0:01:30
668500 -- (-982.081) (-978.755) (-980.246) [-969.495] * (-974.786) (-985.525) (-982.497) [-976.107] -- 0:01:30
669000 -- (-993.708) [-976.064] (-982.618) (-998.831) * (-973.265) (-978.037) [-976.069] (-978.831) -- 0:01:30
669500 -- [-979.070] (-983.507) (-973.470) (-975.139) * (-983.721) (-987.671) [-975.167] (-976.473) -- 0:01:30
670000 -- [-968.006] (-980.369) (-974.102) (-971.937) * (-985.940) (-980.841) [-972.586] (-969.431) -- 0:01:30
Average standard deviation of split frequencies: 0.012156
670500 -- (-980.036) (-993.538) [-975.523] (-975.877) * (-984.632) (-993.426) [-976.114] (-977.697) -- 0:01:30
671000 -- (-985.614) (-989.759) [-973.246] (-970.970) * (-984.098) (-1002.458) [-974.068] (-981.660) -- 0:01:30
671500 -- (-982.583) [-971.099] (-968.288) (-973.220) * [-971.847] (-991.279) (-978.612) (-982.521) -- 0:01:30
672000 -- [-983.257] (-976.119) (-981.776) (-984.854) * (-986.574) (-987.396) [-974.603] (-979.236) -- 0:01:29
672500 -- (-994.588) (-981.683) [-972.365] (-981.857) * (-984.520) (-993.783) [-981.179] (-996.514) -- 0:01:29
673000 -- (-993.182) [-983.363] (-984.693) (-974.492) * (-984.457) (-986.633) [-975.811] (-979.923) -- 0:01:29
673500 -- (-972.392) (-983.468) (-976.328) [-975.585] * [-966.428] (-995.285) (-976.280) (-986.579) -- 0:01:29
674000 -- (-980.870) (-974.646) (-972.528) [-973.438] * (-971.385) (-981.557) [-963.450] (-984.285) -- 0:01:29
674500 -- [-978.576] (-981.327) (-982.133) (-972.412) * (-976.935) (-978.333) [-972.385] (-988.882) -- 0:01:29
675000 -- (-981.753) (-969.411) [-978.981] (-986.487) * [-974.935] (-979.131) (-983.575) (-971.877) -- 0:01:29
Average standard deviation of split frequencies: 0.011773
675500 -- [-981.651] (-975.575) (-994.835) (-978.235) * (-971.769) [-975.846] (-977.036) (-989.614) -- 0:01:28
676000 -- (-975.216) (-986.795) (-980.717) [-972.396] * (-982.539) [-972.648] (-981.653) (-985.071) -- 0:01:28
676500 -- (-988.974) (-978.198) [-977.402] (-981.308) * [-977.316] (-979.831) (-980.844) (-979.253) -- 0:01:28
677000 -- (-983.398) [-972.476] (-985.206) (-978.412) * [-976.285] (-978.484) (-976.279) (-974.757) -- 0:01:28
677500 -- [-975.360] (-973.782) (-986.929) (-977.457) * [-979.511] (-979.072) (-980.157) (-978.104) -- 0:01:28
678000 -- [-980.847] (-980.874) (-978.343) (-983.251) * (-974.450) (-976.013) [-976.765] (-979.603) -- 0:01:28
678500 -- (-977.852) (-978.368) (-983.837) [-978.059] * (-979.584) (-982.281) (-977.561) [-975.646] -- 0:01:28
679000 -- [-975.760] (-968.518) (-985.210) (-981.519) * (-975.778) [-982.785] (-985.767) (-989.267) -- 0:01:27
679500 -- (-977.313) (-974.474) (-984.286) [-970.505] * (-995.755) [-973.007] (-982.256) (-982.761) -- 0:01:27
680000 -- (-979.783) (-984.188) (-979.697) [-965.321] * (-978.289) [-988.294] (-983.395) (-984.877) -- 0:01:27
Average standard deviation of split frequencies: 0.010877
680500 -- (-974.629) (-999.051) (-976.342) [-973.722] * (-974.788) (-975.189) (-1006.539) [-978.896] -- 0:01:27
681000 -- (-974.756) (-978.051) [-986.388] (-981.872) * [-972.718] (-969.538) (-987.349) (-982.490) -- 0:01:27
681500 -- (-990.737) (-982.468) (-980.420) [-978.195] * (-983.345) [-972.541] (-982.075) (-978.966) -- 0:01:27
682000 -- (-986.915) [-978.876] (-976.307) (-974.544) * (-984.005) (-975.937) [-978.053] (-985.420) -- 0:01:27
682500 -- [-969.450] (-988.812) (-971.068) (-989.244) * (-977.194) (-970.940) [-968.197] (-981.784) -- 0:01:26
683000 -- (-981.898) [-976.055] (-976.436) (-981.206) * (-981.572) (-980.872) [-975.985] (-997.160) -- 0:01:26
683500 -- [-973.051] (-985.218) (-995.551) (-989.833) * (-992.724) (-982.733) (-983.724) [-978.792] -- 0:01:26
684000 -- [-971.221] (-974.518) (-980.346) (-979.293) * (-989.022) (-989.571) (-985.295) [-975.496] -- 0:01:26
684500 -- [-972.578] (-982.505) (-979.474) (-980.124) * (-982.335) (-973.676) [-972.429] (-981.794) -- 0:01:26
685000 -- (-964.981) [-972.278] (-985.863) (-986.335) * (-988.916) (-976.477) (-991.472) [-972.369] -- 0:01:26
Average standard deviation of split frequencies: 0.010874
685500 -- (-980.448) (-974.492) [-976.493] (-992.469) * (-980.046) (-989.148) (-975.994) [-969.868] -- 0:01:26
686000 -- [-971.663] (-970.998) (-993.375) (-984.458) * [-973.979] (-988.158) (-975.869) (-980.572) -- 0:01:26
686500 -- (-978.827) [-980.144] (-976.184) (-986.117) * [-974.233] (-978.606) (-982.866) (-999.804) -- 0:01:25
687000 -- (-985.226) [-977.115] (-983.260) (-990.568) * (-977.997) (-981.516) (-981.193) [-984.977] -- 0:01:25
687500 -- (-988.193) [-976.935] (-975.133) (-981.806) * [-971.047] (-980.153) (-980.215) (-977.896) -- 0:01:25
688000 -- (-976.150) (-976.706) [-973.927] (-982.089) * [-972.106] (-976.227) (-984.986) (-983.645) -- 0:01:25
688500 -- (-979.410) [-974.600] (-984.240) (-979.016) * (-977.447) [-973.613] (-976.763) (-985.927) -- 0:01:25
689000 -- (-978.215) (-987.055) (-980.363) [-983.592] * [-971.714] (-974.017) (-983.621) (-979.249) -- 0:01:25
689500 -- (-982.312) (-989.024) [-980.853] (-980.386) * (-977.864) (-980.554) [-980.941] (-974.602) -- 0:01:25
690000 -- (-990.699) (-983.486) (-982.188) [-972.866] * (-971.746) (-994.226) (-982.936) [-975.851] -- 0:01:24
Average standard deviation of split frequencies: 0.010760
690500 -- (-976.792) (-990.367) (-981.204) [-976.779] * [-975.284] (-991.770) (-973.003) (-983.158) -- 0:01:24
691000 -- [-977.716] (-990.490) (-978.082) (-972.125) * (-971.691) (-978.034) (-980.716) [-977.290] -- 0:01:24
691500 -- [-971.608] (-982.783) (-987.762) (-972.250) * (-972.607) (-980.691) (-982.495) [-974.088] -- 0:01:24
692000 -- [-973.960] (-986.180) (-971.685) (-982.182) * (-976.306) (-977.291) (-977.994) [-972.610] -- 0:01:24
692500 -- (-973.078) [-974.750] (-977.193) (-973.055) * (-982.117) (-979.621) [-977.433] (-975.770) -- 0:01:24
693000 -- [-966.152] (-982.035) (-976.479) (-988.554) * (-1004.319) [-973.434] (-985.354) (-973.544) -- 0:01:24
693500 -- (-989.935) (-981.108) [-975.921] (-980.441) * (-982.383) (-980.828) [-990.777] (-970.182) -- 0:01:23
694000 -- (-973.353) [-973.412] (-980.217) (-977.462) * (-976.090) [-972.501] (-977.362) (-978.389) -- 0:01:23
694500 -- (-984.411) (-974.142) (-968.402) [-974.230] * (-990.623) (-975.958) [-971.060] (-971.757) -- 0:01:24
695000 -- (-978.021) (-990.309) (-982.048) [-969.951] * (-980.556) (-978.279) [-976.315] (-979.946) -- 0:01:23
Average standard deviation of split frequencies: 0.010638
695500 -- [-972.102] (-977.940) (-978.206) (-983.700) * (-981.894) [-978.363] (-975.453) (-981.563) -- 0:01:23
696000 -- (-976.860) (-981.203) [-976.977] (-975.081) * (-973.708) (-976.024) [-969.045] (-989.838) -- 0:01:23
696500 -- (-972.579) (-980.854) [-969.731] (-978.312) * [-976.935] (-978.079) (-972.429) (-991.109) -- 0:01:23
697000 -- [-977.923] (-980.225) (-989.262) (-977.090) * (-970.961) (-981.097) [-980.764] (-976.109) -- 0:01:23
697500 -- (-979.910) (-989.589) [-975.660] (-982.188) * [-974.878] (-977.651) (-988.546) (-966.807) -- 0:01:22
698000 -- (-977.511) (-978.782) [-975.320] (-981.785) * [-988.188] (-983.531) (-977.395) (-978.393) -- 0:01:22
698500 -- (-988.967) (-979.353) (-979.386) [-980.408] * (-978.448) (-973.506) (-979.579) [-970.235] -- 0:01:22
699000 -- (-980.611) [-988.952] (-977.084) (-978.562) * (-980.916) (-975.711) [-974.750] (-971.509) -- 0:01:22
699500 -- (-985.421) (-978.141) [-975.964] (-997.923) * (-975.137) (-979.797) (-978.985) [-973.616] -- 0:01:22
700000 -- [-982.267] (-973.570) (-988.138) (-990.418) * [-984.806] (-974.601) (-991.583) (-976.420) -- 0:01:22
Average standard deviation of split frequencies: 0.010646
700500 -- (-979.291) (-990.055) [-976.981] (-991.663) * (-979.496) [-966.252] (-973.513) (-983.025) -- 0:01:22
701000 -- (-975.694) [-965.592] (-977.582) (-990.063) * (-980.937) (-983.136) (-983.343) [-975.909] -- 0:01:21
701500 -- [-973.223] (-970.199) (-981.544) (-996.704) * (-983.859) (-979.113) (-991.888) [-981.396] -- 0:01:21
702000 -- [-970.333] (-993.012) (-996.789) (-985.978) * (-973.150) [-981.957] (-990.975) (-979.152) -- 0:01:21
702500 -- (-974.877) (-984.122) [-972.804] (-990.348) * (-984.546) (-988.480) (-969.748) [-968.076] -- 0:01:21
703000 -- [-974.828] (-973.349) (-987.844) (-992.341) * [-972.104] (-976.181) (-981.384) (-972.647) -- 0:01:21
703500 -- [-968.094] (-973.869) (-973.158) (-989.975) * (-975.432) (-976.900) [-983.547] (-980.834) -- 0:01:21
704000 -- (-977.215) [-974.687] (-972.108) (-978.762) * (-978.681) (-982.060) (-982.580) [-974.501] -- 0:01:21
704500 -- (-974.355) [-978.987] (-974.252) (-985.434) * (-979.131) (-979.512) [-972.858] (-972.493) -- 0:01:20
705000 -- [-973.403] (-994.825) (-978.829) (-991.384) * (-973.923) [-975.657] (-973.833) (-979.171) -- 0:01:20
Average standard deviation of split frequencies: 0.010919
705500 -- (-972.766) (-993.347) [-968.722] (-997.767) * (-978.385) (-982.262) (-982.739) [-968.444] -- 0:01:20
706000 -- [-978.133] (-982.956) (-979.777) (-985.725) * (-986.062) [-973.067] (-975.394) (-981.432) -- 0:01:20
706500 -- [-978.405] (-975.841) (-984.128) (-997.215) * (-979.587) (-983.208) [-974.578] (-991.523) -- 0:01:20
707000 -- (-985.134) (-977.461) [-970.743] (-995.817) * (-992.552) (-975.373) [-968.746] (-981.136) -- 0:01:20
707500 -- (-982.443) (-976.106) [-975.262] (-981.097) * (-980.003) [-974.913] (-977.714) (-979.808) -- 0:01:20
708000 -- [-975.807] (-980.036) (-979.408) (-992.213) * (-979.302) [-972.284] (-981.347) (-980.707) -- 0:01:20
708500 -- (-978.454) [-988.689] (-977.808) (-992.930) * (-989.949) (-984.746) [-974.374] (-991.040) -- 0:01:19
709000 -- (-974.303) (-979.079) [-974.544] (-989.853) * [-969.816] (-976.506) (-992.771) (-991.297) -- 0:01:19
709500 -- [-982.397] (-978.678) (-977.857) (-979.544) * (-980.672) (-977.587) (-995.633) [-975.422] -- 0:01:19
710000 -- [-974.968] (-996.688) (-987.483) (-976.724) * (-981.085) [-980.825] (-993.301) (-978.944) -- 0:01:19
Average standard deviation of split frequencies: 0.010886
710500 -- (-983.977) (-973.983) (-984.742) [-977.055] * [-978.086] (-977.237) (-988.690) (-986.068) -- 0:01:19
711000 -- (-990.009) (-986.693) (-979.978) [-976.639] * (-987.058) (-987.720) (-987.983) [-975.691] -- 0:01:19
711500 -- (-977.541) (-999.336) [-972.128] (-979.796) * (-987.514) (-980.239) (-981.315) [-973.291] -- 0:01:19
712000 -- (-977.062) (-981.538) [-972.213] (-971.211) * [-973.319] (-980.906) (-980.037) (-981.611) -- 0:01:18
712500 -- (-978.346) (-985.182) (-978.043) [-974.491] * (-977.334) (-980.461) [-977.180] (-973.174) -- 0:01:18
713000 -- (-974.926) [-977.913] (-974.605) (-988.854) * [-970.384] (-982.178) (-976.185) (-974.104) -- 0:01:18
713500 -- [-973.054] (-973.057) (-990.616) (-981.172) * (-978.704) [-971.379] (-978.141) (-975.719) -- 0:01:18
714000 -- (-978.244) (-989.478) (-992.510) [-977.728] * [-976.953] (-977.018) (-968.467) (-984.951) -- 0:01:18
714500 -- (-981.869) [-969.677] (-977.798) (-987.799) * (-971.484) (-984.452) [-973.784] (-979.058) -- 0:01:18
715000 -- (-983.749) (-985.013) (-981.425) [-979.406] * (-985.332) (-984.247) (-978.910) [-975.233] -- 0:01:18
Average standard deviation of split frequencies: 0.011270
715500 -- (-981.941) [-968.081] (-988.542) (-974.726) * (-975.573) (-989.809) (-976.287) [-970.908] -- 0:01:17
716000 -- [-976.876] (-988.545) (-979.400) (-983.740) * (-977.113) [-986.469] (-967.206) (-986.178) -- 0:01:17
716500 -- (-997.005) (-980.042) [-971.956] (-987.577) * [-971.970] (-979.796) (-986.733) (-972.364) -- 0:01:17
717000 -- [-984.078] (-982.112) (-974.544) (-971.389) * (-977.240) (-979.101) [-978.715] (-969.789) -- 0:01:17
717500 -- (-978.201) [-976.595] (-976.310) (-976.686) * [-969.213] (-973.595) (-978.350) (-986.865) -- 0:01:17
718000 -- (-978.092) [-974.571] (-983.095) (-1000.517) * (-978.528) (-990.207) [-976.940] (-969.891) -- 0:01:17
718500 -- (-974.170) (-980.505) (-970.994) [-982.492] * (-979.812) (-999.777) [-972.296] (-974.964) -- 0:01:17
719000 -- (-986.175) [-979.108] (-978.824) (-969.667) * (-978.596) (-981.224) (-984.056) [-968.050] -- 0:01:16
719500 -- (-970.148) [-975.621] (-976.799) (-975.335) * (-977.357) (-981.171) (-996.601) [-979.627] -- 0:01:16
720000 -- (-972.808) [-978.902] (-966.579) (-972.024) * (-981.085) [-975.335] (-986.926) (-972.290) -- 0:01:16
Average standard deviation of split frequencies: 0.011159
720500 -- (-980.170) (-980.440) [-975.153] (-976.515) * (-979.217) [-974.641] (-984.363) (-980.539) -- 0:01:16
721000 -- [-980.695] (-967.585) (-986.588) (-985.089) * (-981.859) (-976.151) [-965.426] (-983.363) -- 0:01:16
721500 -- (-986.716) (-978.788) [-983.465] (-979.440) * (-991.463) (-989.522) [-976.644] (-975.843) -- 0:01:16
722000 -- (-975.469) [-981.207] (-988.825) (-976.119) * (-970.392) (-992.936) (-982.478) [-970.591] -- 0:01:16
722500 -- (-986.108) [-980.065] (-974.471) (-984.298) * (-978.046) [-974.606] (-987.836) (-988.419) -- 0:01:16
723000 -- (-982.812) (-976.754) [-976.621] (-985.076) * [-979.080] (-968.850) (-984.727) (-978.833) -- 0:01:15
723500 -- (-979.803) [-974.707] (-984.415) (-976.744) * (-985.955) [-971.820] (-983.450) (-977.060) -- 0:01:15
724000 -- (-971.380) (-982.845) [-968.743] (-995.251) * (-984.031) (-969.360) (-981.482) [-973.944] -- 0:01:15
724500 -- [-972.997] (-980.292) (-976.874) (-978.229) * (-997.318) [-972.556] (-982.583) (-970.380) -- 0:01:15
725000 -- (-976.929) (-998.673) (-976.232) [-973.389] * (-993.291) [-980.176] (-979.455) (-979.919) -- 0:01:15
Average standard deviation of split frequencies: 0.010809
725500 -- [-981.651] (-984.416) (-968.919) (-979.373) * (-986.817) (-974.670) (-982.358) [-971.544] -- 0:01:15
726000 -- (-979.798) [-982.503] (-978.785) (-968.622) * (-995.867) (-987.474) [-974.052] (-971.832) -- 0:01:15
726500 -- (-992.734) (-968.373) (-979.832) [-974.493] * (-980.991) (-974.838) [-972.146] (-974.173) -- 0:01:14
727000 -- (-987.370) (-980.984) (-981.749) [-974.671] * (-991.757) (-989.311) (-977.634) [-973.809] -- 0:01:14
727500 -- (-966.647) (-972.038) (-982.908) [-980.140] * (-984.845) (-986.609) (-989.912) [-973.160] -- 0:01:14
728000 -- (-974.444) (-984.638) (-978.261) [-976.893] * (-987.461) [-977.837] (-978.599) (-981.395) -- 0:01:14
728500 -- [-980.936] (-971.672) (-981.404) (-973.683) * (-984.772) (-991.650) (-971.647) [-968.749] -- 0:01:14
729000 -- (-968.789) (-974.396) (-984.985) [-975.592] * (-989.971) (-972.231) (-979.712) [-973.460] -- 0:01:14
729500 -- (-988.022) (-965.754) [-974.844] (-985.258) * (-993.888) (-977.696) [-975.848] (-972.359) -- 0:01:14
730000 -- (-975.717) [-965.297] (-975.868) (-974.628) * [-974.489] (-988.000) (-987.504) (-973.465) -- 0:01:13
Average standard deviation of split frequencies: 0.010702
730500 -- (-985.657) [-965.371] (-973.091) (-984.207) * (-986.203) (-982.426) (-975.031) [-977.144] -- 0:01:13
731000 -- (-990.841) (-982.787) [-973.738] (-987.266) * (-990.811) (-976.700) (-976.106) [-976.502] -- 0:01:13
731500 -- (-987.002) (-979.679) (-973.476) [-982.860] * (-972.171) [-972.405] (-980.599) (-979.805) -- 0:01:13
732000 -- [-987.020] (-985.915) (-976.898) (-970.055) * (-982.491) (-981.244) [-975.869] (-974.810) -- 0:01:13
732500 -- (-985.899) [-981.128] (-984.419) (-977.288) * (-981.665) (-987.734) (-977.402) [-974.681] -- 0:01:13
733000 -- [-973.462] (-970.790) (-992.153) (-976.858) * (-974.666) (-984.794) [-983.459] (-983.276) -- 0:01:13
733500 -- (-978.579) [-976.996] (-981.258) (-973.665) * (-975.400) [-978.529] (-975.432) (-970.894) -- 0:01:13
734000 -- (-988.645) (-978.935) [-976.895] (-971.174) * (-974.509) [-973.007] (-981.887) (-982.182) -- 0:01:12
734500 -- (-977.830) (-976.021) (-983.074) [-977.067] * (-977.664) (-983.237) [-967.776] (-973.335) -- 0:01:12
735000 -- (-989.647) (-972.827) (-985.156) [-976.833] * [-971.442] (-979.718) (-978.941) (-980.349) -- 0:01:12
Average standard deviation of split frequencies: 0.009683
735500 -- (-982.660) (-977.188) [-975.295] (-987.037) * (-981.231) (-975.281) (-982.472) [-970.116] -- 0:01:12
736000 -- (-982.160) (-986.181) (-994.526) [-970.977] * (-995.004) (-981.706) [-972.347] (-986.407) -- 0:01:12
736500 -- [-981.070] (-991.136) (-974.793) (-978.022) * (-982.608) (-983.996) (-973.480) [-970.122] -- 0:01:12
737000 -- (-975.984) (-980.107) [-979.095] (-969.863) * [-978.244] (-983.139) (-977.313) (-974.535) -- 0:01:12
737500 -- (-977.585) (-986.754) (-1004.818) [-979.373] * (-978.726) (-977.794) (-978.077) [-968.770] -- 0:01:11
738000 -- (-984.553) [-976.125] (-973.575) (-992.267) * (-981.006) [-982.125] (-976.152) (-983.623) -- 0:01:11
738500 -- (-991.146) (-978.585) (-976.699) [-968.761] * (-978.166) [-976.112] (-980.900) (-977.230) -- 0:01:11
739000 -- [-980.008] (-970.104) (-974.209) (-985.061) * (-985.670) (-971.273) (-976.227) [-974.885] -- 0:01:11
739500 -- (-984.614) (-979.370) [-970.614] (-986.439) * (-986.184) [-977.034] (-977.103) (-976.969) -- 0:01:11
740000 -- [-972.119] (-978.741) (-965.274) (-985.323) * (-978.590) (-977.485) (-982.666) [-972.009] -- 0:01:11
Average standard deviation of split frequencies: 0.009921
740500 -- [-971.547] (-984.076) (-984.858) (-976.911) * (-987.342) (-978.068) [-970.247] (-984.783) -- 0:01:11
741000 -- (-974.254) (-976.048) (-966.967) [-975.057] * (-982.717) (-978.212) (-977.278) [-972.517] -- 0:01:10
741500 -- (-979.451) [-977.415] (-990.312) (-979.418) * [-979.793] (-977.883) (-980.626) (-983.568) -- 0:01:10
742000 -- (-979.478) (-973.571) [-988.037] (-975.493) * [-973.541] (-968.188) (-977.284) (-971.426) -- 0:01:10
742500 -- (-982.592) (-985.410) (-984.676) [-986.351] * (-971.168) (-992.216) [-976.548] (-971.466) -- 0:01:10
743000 -- (-974.985) (-988.151) (-985.543) [-980.062] * (-979.764) (-985.866) (-971.717) [-972.751] -- 0:01:10
743500 -- (-979.991) (-997.833) (-979.254) [-967.556] * (-978.413) (-986.630) (-979.982) [-968.712] -- 0:01:10
744000 -- (-982.097) (-986.642) (-976.149) [-985.123] * [-969.750] (-976.252) (-979.906) (-973.563) -- 0:01:10
744500 -- (-977.272) (-975.471) [-985.034] (-975.957) * [-971.120] (-977.222) (-975.305) (-989.951) -- 0:01:10
745000 -- (-977.717) (-991.575) (-985.429) [-973.834] * (-981.125) (-974.237) (-981.437) [-978.244] -- 0:01:09
Average standard deviation of split frequencies: 0.009627
745500 -- (-987.584) (-977.966) [-978.423] (-984.014) * (-985.791) (-983.839) (-979.063) [-971.198] -- 0:01:09
746000 -- [-974.642] (-975.309) (-984.979) (-981.683) * (-984.562) (-983.003) [-976.053] (-975.238) -- 0:01:09
746500 -- (-973.053) (-980.534) (-988.478) [-976.254] * (-991.273) [-974.509] (-982.082) (-970.019) -- 0:01:09
747000 -- (-977.602) [-973.308] (-981.191) (-982.392) * (-984.769) (-987.291) (-980.835) [-973.016] -- 0:01:09
747500 -- (-976.386) [-974.124] (-985.404) (-968.347) * (-975.109) [-977.437] (-984.554) (-981.309) -- 0:01:09
748000 -- [-977.464] (-975.274) (-973.335) (-970.721) * (-982.445) (-991.041) [-970.795] (-978.672) -- 0:01:09
748500 -- (-973.781) (-977.215) (-974.039) [-979.607] * (-986.777) [-971.010] (-978.774) (-997.786) -- 0:01:08
749000 -- (-979.117) (-970.664) (-982.624) [-982.506] * (-982.597) [-980.122] (-978.074) (-979.053) -- 0:01:08
749500 -- (-974.888) (-979.098) (-969.026) [-968.103] * (-985.174) [-977.418] (-978.781) (-974.600) -- 0:01:08
750000 -- (-976.728) (-979.386) (-984.358) [-977.095] * [-974.594] (-976.570) (-977.565) (-979.093) -- 0:01:08
Average standard deviation of split frequencies: 0.009641
750500 -- [-975.088] (-989.215) (-986.180) (-980.168) * [-974.829] (-987.682) (-979.925) (-984.730) -- 0:01:08
751000 -- (-979.697) (-991.470) (-985.978) [-976.529] * (-987.373) (-981.539) (-980.507) [-976.194] -- 0:01:08
751500 -- [-973.251] (-983.283) (-974.651) (-968.335) * (-978.673) (-987.434) [-979.593] (-976.782) -- 0:01:08
752000 -- [-980.923] (-991.272) (-982.919) (-976.556) * (-977.798) (-983.642) (-988.126) [-967.157] -- 0:01:07
752500 -- (-977.764) (-992.314) [-971.888] (-987.077) * [-979.401] (-978.842) (-988.598) (-980.755) -- 0:01:07
753000 -- (-982.224) (-980.233) [-971.922] (-981.217) * [-978.887] (-984.809) (-982.035) (-983.124) -- 0:01:07
753500 -- [-976.463] (-976.868) (-988.380) (-977.928) * (-982.671) (-976.131) (-978.138) [-975.901] -- 0:01:07
754000 -- (-984.816) (-978.861) [-978.294] (-977.925) * (-997.529) (-980.298) [-970.058] (-986.174) -- 0:01:07
754500 -- (-984.043) (-976.920) (-977.605) [-978.233] * (-994.174) (-980.125) (-974.276) [-975.286] -- 0:01:07
755000 -- (-986.413) [-970.939] (-978.213) (-983.101) * (-972.039) (-978.965) [-972.515] (-976.980) -- 0:01:07
Average standard deviation of split frequencies: 0.009610
755500 -- (-993.815) (-976.917) (-983.001) [-970.729] * (-980.164) (-979.391) (-976.472) [-985.170] -- 0:01:06
756000 -- (-980.903) (-979.320) (-983.566) [-975.257] * (-980.917) (-976.645) [-974.381] (-980.213) -- 0:01:06
756500 -- (-978.815) (-982.842) (-979.808) [-973.348] * (-981.305) [-979.897] (-985.284) (-978.598) -- 0:01:06
757000 -- (-984.689) (-987.382) [-969.272] (-985.436) * (-985.947) (-978.600) [-976.385] (-978.168) -- 0:01:06
757500 -- (-985.766) (-974.966) [-983.497] (-973.332) * (-985.632) [-982.584] (-982.916) (-972.887) -- 0:01:06
758000 -- (-973.601) (-992.372) [-978.190] (-975.788) * (-976.037) (-976.662) (-987.890) [-977.944] -- 0:01:06
758500 -- (-978.169) (-982.100) [-976.175] (-971.359) * [-975.707] (-976.995) (-982.409) (-969.954) -- 0:01:06
759000 -- (-986.598) (-983.882) [-976.285] (-975.279) * (-986.832) [-975.960] (-976.191) (-986.127) -- 0:01:06
759500 -- (-981.232) [-974.717] (-970.502) (-969.715) * (-983.241) (-970.814) [-976.377] (-978.955) -- 0:01:05
760000 -- (-985.169) [-974.017] (-972.789) (-971.392) * (-976.064) (-978.225) [-977.115] (-997.114) -- 0:01:05
Average standard deviation of split frequencies: 0.008676
760500 -- [-975.148] (-991.596) (-975.940) (-978.134) * (-981.891) (-983.833) (-979.559) [-975.811] -- 0:01:05
761000 -- (-983.728) (-988.532) (-986.632) [-977.533] * (-981.663) (-968.005) (-972.684) [-976.547] -- 0:01:05
761500 -- (-994.218) (-980.534) (-977.932) [-976.440] * (-975.529) [-980.363] (-972.568) (-973.932) -- 0:01:05
762000 -- (-993.651) (-978.804) (-988.533) [-974.094] * (-983.178) (-972.656) (-996.571) [-975.862] -- 0:01:05
762500 -- (-988.107) [-974.846] (-979.505) (-983.218) * (-975.890) (-974.790) [-989.563] (-982.101) -- 0:01:05
763000 -- (-993.132) (-974.899) [-984.572] (-984.281) * (-974.691) [-975.181] (-979.200) (-985.021) -- 0:01:04
763500 -- (-991.810) (-987.161) (-987.415) [-981.651] * (-977.470) (-968.575) (-981.003) [-973.895] -- 0:01:04
764000 -- (-986.984) [-971.957] (-978.986) (-972.296) * [-972.164] (-984.505) (-977.766) (-971.388) -- 0:01:04
764500 -- (-988.489) [-973.843] (-979.607) (-975.505) * (-979.626) (-989.586) (-975.641) [-971.898] -- 0:01:04
765000 -- (-994.563) [-968.263] (-992.040) (-971.491) * (-983.258) (-981.452) (-981.713) [-981.979] -- 0:01:04
Average standard deviation of split frequencies: 0.008942
765500 -- (-983.011) (-982.553) [-973.113] (-991.869) * (-977.696) (-975.123) [-970.054] (-976.961) -- 0:01:04
766000 -- (-980.562) (-978.805) (-982.039) [-976.309] * [-977.245] (-972.908) (-973.013) (-976.199) -- 0:01:04
766500 -- (-978.259) [-975.877] (-980.467) (-976.273) * [-983.074] (-976.241) (-974.126) (-982.008) -- 0:01:03
767000 -- [-973.863] (-993.422) (-976.283) (-981.866) * [-966.664] (-990.297) (-979.548) (-982.277) -- 0:01:03
767500 -- (-975.278) (-977.925) (-984.801) [-977.424] * [-984.022] (-986.791) (-978.898) (-974.131) -- 0:01:03
768000 -- (-980.565) (-979.522) (-977.112) [-972.388] * (-974.865) (-976.635) (-979.519) [-979.071] -- 0:01:03
768500 -- (-981.322) (-984.680) (-976.425) [-978.310] * (-977.246) [-976.548] (-978.211) (-986.922) -- 0:01:03
769000 -- (-977.203) (-987.050) (-978.925) [-967.456] * (-980.506) [-974.292] (-985.188) (-980.803) -- 0:01:03
769500 -- (-979.137) (-977.346) (-981.840) [-973.893] * (-976.877) [-970.872] (-979.340) (-983.858) -- 0:01:03
770000 -- (-980.162) (-984.566) (-975.373) [-972.569] * (-976.730) [-980.618] (-988.236) (-985.779) -- 0:01:03
Average standard deviation of split frequencies: 0.008815
770500 -- [-985.010] (-985.625) (-974.758) (-983.649) * [-982.944] (-979.727) (-981.998) (-982.727) -- 0:01:02
771000 -- (-982.297) [-979.452] (-976.402) (-979.970) * [-967.405] (-980.289) (-984.660) (-977.464) -- 0:01:02
771500 -- (-986.431) (-979.238) (-990.861) [-981.681] * (-981.691) (-974.375) [-978.718] (-970.887) -- 0:01:02
772000 -- (-991.765) (-983.401) [-971.667] (-986.266) * [-970.192] (-980.782) (-968.376) (-971.459) -- 0:01:02
772500 -- (-983.961) (-983.326) (-980.010) [-978.468] * (-968.562) (-978.046) (-982.588) [-971.245] -- 0:01:02
773000 -- (-980.752) (-986.861) (-971.471) [-969.108] * [-973.907] (-974.316) (-982.642) (-983.044) -- 0:01:02
773500 -- (-972.999) [-978.199] (-974.430) (-986.646) * (-986.704) [-974.427] (-974.337) (-971.370) -- 0:01:02
774000 -- (-971.619) [-971.497] (-977.211) (-988.005) * [-972.665] (-990.053) (-985.195) (-969.957) -- 0:01:01
774500 -- (-973.829) (-976.904) (-988.303) [-977.205] * [-967.899] (-983.367) (-990.512) (-975.409) -- 0:01:02
775000 -- (-989.778) [-973.521] (-983.693) (-981.484) * (-972.467) (-985.692) (-982.778) [-982.228] -- 0:01:01
Average standard deviation of split frequencies: 0.009112
775500 -- (-984.886) (-977.060) [-969.479] (-994.525) * (-976.968) (-1000.157) (-977.421) [-968.948] -- 0:01:01
776000 -- (-991.856) (-981.592) [-973.702] (-971.685) * (-974.426) (-996.438) [-983.587] (-980.439) -- 0:01:01
776500 -- (-977.649) (-982.015) [-974.796] (-978.031) * [-976.699] (-990.850) (-988.593) (-987.849) -- 0:01:01
777000 -- [-975.924] (-977.704) (-979.893) (-974.513) * (-980.005) (-974.701) (-985.219) [-974.982] -- 0:01:01
777500 -- (-976.877) (-995.498) [-981.716] (-974.340) * (-978.730) (-979.507) (-978.152) [-983.121] -- 0:01:00
778000 -- (-974.120) (-1000.965) (-987.559) [-968.034] * (-982.251) (-972.446) [-976.484] (-972.182) -- 0:01:00
778500 -- (-977.614) (-981.372) [-966.121] (-979.543) * (-987.588) (-981.812) (-986.271) [-993.106] -- 0:01:00
779000 -- (-975.847) (-985.441) [-976.840] (-982.971) * (-975.791) (-991.292) (-990.432) [-972.139] -- 0:01:00
779500 -- (-995.253) (-978.409) (-973.612) [-971.682] * (-967.017) (-991.599) [-972.106] (-990.873) -- 0:01:00
780000 -- (-987.781) (-988.004) [-973.852] (-976.765) * [-982.274] (-996.448) (-985.488) (-975.220) -- 0:01:00
Average standard deviation of split frequencies: 0.008560
780500 -- (-982.167) (-993.690) [-972.191] (-977.275) * (-969.442) (-988.223) [-983.599] (-971.570) -- 0:01:00
781000 -- [-970.387] (-986.439) (-992.505) (-970.369) * (-975.058) (-981.226) [-972.018] (-968.719) -- 0:01:00
781500 -- (-979.666) (-989.942) (-972.935) [-973.031] * (-994.639) (-976.169) (-974.926) [-974.968] -- 0:00:59
782000 -- (-986.703) (-998.696) (-993.729) [-972.322] * (-974.030) (-973.817) (-979.591) [-976.086] -- 0:00:59
782500 -- [-970.240] (-978.745) (-987.838) (-968.836) * (-977.817) [-970.670] (-976.206) (-974.481) -- 0:00:59
783000 -- (-974.028) [-973.037] (-993.460) (-978.279) * [-970.124] (-971.198) (-980.912) (-975.482) -- 0:00:59
783500 -- (-982.128) (-982.517) [-977.569] (-981.431) * [-975.084] (-977.306) (-972.107) (-988.292) -- 0:00:59
784000 -- (-969.349) [-969.192] (-975.514) (-997.815) * (-980.715) [-976.989] (-971.775) (-982.032) -- 0:00:59
784500 -- (-988.050) (-971.990) [-978.130] (-974.583) * (-981.285) [-972.818] (-975.378) (-981.495) -- 0:00:59
785000 -- (-975.277) (-981.103) [-973.446] (-973.202) * (-974.754) (-982.105) [-968.447] (-989.267) -- 0:00:58
Average standard deviation of split frequencies: 0.008820
785500 -- (-980.489) (-980.747) (-988.123) [-979.315] * [-976.329] (-983.510) (-975.062) (-984.099) -- 0:00:58
786000 -- (-981.027) (-975.594) (-986.390) [-981.280] * (-978.013) (-975.869) [-976.565] (-973.653) -- 0:00:58
786500 -- (-985.847) (-983.908) (-976.415) [-970.736] * [-977.701] (-976.494) (-980.128) (-976.237) -- 0:00:58
787000 -- (-980.336) [-980.912] (-980.596) (-976.752) * (-984.964) (-979.450) [-971.002] (-992.179) -- 0:00:58
787500 -- (-980.165) (-988.116) [-980.145] (-974.715) * (-997.110) [-970.129] (-980.928) (-980.234) -- 0:00:58
788000 -- (-984.694) (-982.734) (-984.741) [-968.315] * (-985.579) (-974.422) [-975.882] (-989.866) -- 0:00:58
788500 -- (-985.344) (-980.730) (-978.531) [-973.387] * (-973.350) (-976.669) [-973.229] (-977.360) -- 0:00:57
789000 -- (-982.294) (-984.444) [-968.804] (-968.370) * [-974.808] (-980.254) (-973.699) (-979.593) -- 0:00:57
789500 -- (-983.317) (-983.027) [-970.713] (-980.502) * [-969.655] (-977.293) (-982.917) (-980.879) -- 0:00:57
790000 -- (-990.214) (-980.844) [-972.218] (-992.928) * (-967.952) (-989.059) [-976.218] (-990.638) -- 0:00:57
Average standard deviation of split frequencies: 0.009364
790500 -- (-976.680) [-972.474] (-970.283) (-988.739) * (-981.573) (-975.094) [-973.722] (-984.464) -- 0:00:57
791000 -- (-982.048) (-973.265) (-986.549) [-977.912] * (-975.916) [-972.927] (-987.289) (-987.455) -- 0:00:57
791500 -- (-1000.345) (-985.701) [-976.879] (-980.334) * [-974.418] (-977.126) (-994.888) (-985.913) -- 0:00:57
792000 -- [-973.104] (-995.830) (-975.540) (-985.189) * (-980.334) (-973.324) (-988.848) [-978.865] -- 0:00:56
792500 -- (-977.315) (-981.927) (-975.411) [-974.191] * (-979.887) [-982.249] (-992.397) (-977.027) -- 0:00:56
793000 -- (-978.744) (-982.042) (-983.227) [-977.407] * [-977.343] (-973.474) (-977.630) (-974.043) -- 0:00:56
793500 -- (-979.659) [-975.603] (-980.165) (-987.704) * (-977.854) (-991.943) [-987.682] (-970.428) -- 0:00:56
794000 -- [-979.163] (-983.363) (-982.217) (-983.065) * (-981.163) (-986.107) (-975.604) [-978.909] -- 0:00:56
794500 -- (-986.448) (-982.916) (-985.176) [-977.346] * (-980.420) (-979.113) (-973.040) [-982.310] -- 0:00:56
795000 -- (-987.268) (-984.839) (-976.987) [-975.457] * [-972.605] (-986.346) (-983.632) (-977.090) -- 0:00:56
Average standard deviation of split frequencies: 0.009336
795500 -- (-987.537) (-978.578) [-976.317] (-971.823) * (-981.441) (-982.247) (-996.013) [-976.785] -- 0:00:56
796000 -- (-997.287) (-976.978) (-981.048) [-980.641] * (-987.485) [-976.898] (-982.938) (-981.106) -- 0:00:55
796500 -- [-971.255] (-983.299) (-993.622) (-974.562) * (-989.237) (-980.682) (-982.255) [-968.739] -- 0:00:55
797000 -- (-971.021) [-977.747] (-983.489) (-983.622) * (-989.666) (-978.914) (-987.575) [-973.418] -- 0:00:55
797500 -- (-996.532) (-992.180) (-981.644) [-981.890] * (-984.873) (-982.161) (-982.205) [-978.171] -- 0:00:55
798000 -- [-968.269] (-978.846) (-989.597) (-974.809) * (-1003.454) [-983.481] (-981.335) (-975.834) -- 0:00:55
798500 -- (-981.499) [-976.843] (-988.272) (-986.033) * (-974.528) [-972.516] (-983.556) (-981.690) -- 0:00:55
799000 -- [-987.772] (-977.589) (-981.111) (-980.439) * (-978.656) (-977.205) (-979.666) [-973.327] -- 0:00:55
799500 -- (-977.692) [-970.131] (-978.460) (-974.360) * (-982.003) (-973.705) [-977.078] (-979.145) -- 0:00:54
800000 -- (-977.278) (-973.753) [-977.326] (-972.686) * [-974.703] (-972.718) (-980.991) (-985.537) -- 0:00:54
Average standard deviation of split frequencies: 0.009005
800500 -- [-974.342] (-974.103) (-977.170) (-986.567) * [-976.018] (-977.367) (-974.029) (-980.936) -- 0:00:54
801000 -- (-975.333) [-982.251] (-983.962) (-989.212) * [-981.834] (-988.330) (-973.181) (-979.533) -- 0:00:54
801500 -- [-973.585] (-976.631) (-972.444) (-982.324) * (-988.068) (-976.024) [-975.483] (-976.130) -- 0:00:54
802000 -- [-974.202] (-977.949) (-972.482) (-987.866) * (-989.005) (-976.931) [-978.359] (-973.792) -- 0:00:54
802500 -- (-986.001) (-973.119) (-979.215) [-979.584] * (-994.608) (-990.080) [-976.121] (-973.064) -- 0:00:54
803000 -- (-978.563) (-979.899) [-982.484] (-985.453) * [-980.330] (-984.983) (-985.131) (-977.157) -- 0:00:53
803500 -- (-978.357) (-979.159) (-969.984) [-974.605] * (-977.478) (-981.785) (-985.813) [-968.835] -- 0:00:53
804000 -- (-975.064) [-977.802] (-990.871) (-977.068) * (-981.196) (-980.172) (-976.246) [-972.368] -- 0:00:53
804500 -- (-984.103) [-972.806] (-972.650) (-975.695) * (-987.233) (-974.318) [-981.920] (-977.443) -- 0:00:53
805000 -- [-968.489] (-977.706) (-989.819) (-966.408) * (-980.096) (-974.625) [-975.161] (-991.248) -- 0:00:53
Average standard deviation of split frequencies: 0.008945
805500 -- [-967.540] (-990.855) (-979.946) (-978.982) * (-982.071) [-973.372] (-975.456) (-981.377) -- 0:00:53
806000 -- (-979.434) [-979.417] (-979.091) (-975.162) * (-979.462) [-975.560] (-972.351) (-989.062) -- 0:00:53
806500 -- (-976.918) [-972.616] (-980.343) (-985.023) * (-975.619) (-981.729) (-979.190) [-978.020] -- 0:00:53
807000 -- (-973.226) (-981.176) [-975.869] (-988.113) * [-976.810] (-978.378) (-980.457) (-979.682) -- 0:00:52
807500 -- (-989.459) (-972.163) [-972.057] (-985.702) * (-984.115) [-978.859] (-978.069) (-993.542) -- 0:00:52
808000 -- (-980.357) [-979.332] (-983.976) (-994.790) * [-976.655] (-983.328) (-983.265) (-978.588) -- 0:00:52
808500 -- (-971.006) [-973.626] (-980.283) (-991.516) * [-974.296] (-980.637) (-983.262) (-983.179) -- 0:00:52
809000 -- (-978.246) (-982.933) [-968.797] (-983.541) * [-976.495] (-980.839) (-974.798) (-990.214) -- 0:00:52
809500 -- (-987.039) [-975.217] (-984.223) (-980.091) * (-986.097) (-985.593) [-978.904] (-987.294) -- 0:00:52
810000 -- [-973.914] (-969.535) (-975.717) (-972.569) * (-974.708) [-970.759] (-986.733) (-988.238) -- 0:00:52
Average standard deviation of split frequencies: 0.009030
810500 -- (-981.504) (-972.292) [-971.839] (-980.702) * (-977.999) (-979.290) [-974.221] (-997.588) -- 0:00:51
811000 -- (-983.663) (-1000.830) [-983.866] (-982.062) * [-971.862] (-977.307) (-983.368) (-978.745) -- 0:00:51
811500 -- (-981.731) [-982.547] (-971.189) (-974.349) * (-978.061) [-975.055] (-982.736) (-973.459) -- 0:00:51
812000 -- (-982.302) (-984.368) [-983.179] (-970.294) * (-987.585) (-971.329) [-975.235] (-980.436) -- 0:00:51
812500 -- (-995.910) (-978.286) (-972.291) [-970.335] * (-977.630) [-974.060] (-982.422) (-980.286) -- 0:00:51
813000 -- (-996.789) (-974.674) (-973.620) [-978.706] * [-968.040] (-988.114) (-987.259) (-972.761) -- 0:00:51
813500 -- (-979.830) (-976.894) [-980.499] (-985.007) * (-970.977) (-968.478) [-973.076] (-983.047) -- 0:00:51
814000 -- (-987.633) (-975.619) [-979.244] (-979.302) * (-989.875) (-973.268) [-979.199] (-983.175) -- 0:00:50
814500 -- (-992.229) (-985.521) [-968.026] (-983.504) * (-989.708) (-974.546) (-979.477) [-976.528] -- 0:00:50
815000 -- (-973.551) [-975.970] (-975.989) (-984.510) * (-975.601) [-977.322] (-975.556) (-993.093) -- 0:00:50
Average standard deviation of split frequencies: 0.009379
815500 -- (-977.290) (-991.148) (-979.707) [-973.435] * (-992.075) (-980.736) [-970.744] (-987.475) -- 0:00:50
816000 -- (-984.701) (-976.592) [-981.120] (-981.714) * (-985.844) [-970.563] (-987.267) (-978.086) -- 0:00:50
816500 -- (-983.941) (-974.076) (-973.580) [-973.920] * (-986.798) (-977.278) (-979.577) [-975.949] -- 0:00:50
817000 -- (-978.431) (-980.082) (-987.603) [-979.004] * [-976.653] (-978.897) (-982.584) (-983.309) -- 0:00:50
817500 -- [-975.917] (-978.078) (-978.126) (-982.121) * (-978.138) [-978.140] (-978.266) (-991.709) -- 0:00:50
818000 -- (-972.085) (-989.370) [-976.186] (-974.063) * [-975.348] (-977.682) (-982.015) (-976.104) -- 0:00:49
818500 -- [-976.788] (-977.071) (-979.521) (-983.245) * [-977.650] (-994.194) (-981.975) (-970.363) -- 0:00:49
819000 -- (-979.432) (-991.000) (-978.538) [-977.946] * (-984.532) (-979.110) (-975.073) [-972.333] -- 0:00:49
819500 -- (-992.505) (-977.802) [-968.124] (-994.173) * [-987.897] (-979.447) (-998.392) (-975.675) -- 0:00:49
820000 -- (-983.325) (-998.587) [-976.625] (-994.170) * (-987.813) [-972.738] (-973.538) (-978.357) -- 0:00:49
Average standard deviation of split frequencies: 0.009495
820500 -- (-975.045) (-995.362) (-975.083) [-970.529] * (-972.006) (-984.201) (-995.061) [-976.346] -- 0:00:49
821000 -- (-975.081) (-982.678) [-976.659] (-985.945) * (-983.572) [-978.415] (-976.030) (-979.252) -- 0:00:49
821500 -- [-977.795] (-988.451) (-974.994) (-984.729) * (-978.108) [-973.241] (-988.435) (-978.975) -- 0:00:48
822000 -- (-982.559) (-977.891) [-978.204] (-988.650) * (-986.408) [-970.240] (-967.405) (-988.843) -- 0:00:48
822500 -- (-973.151) (-980.820) [-974.853] (-980.429) * (-992.920) [-965.782] (-991.537) (-977.563) -- 0:00:48
823000 -- (-977.572) (-978.403) [-986.968] (-987.459) * (-975.276) [-980.412] (-985.365) (-1006.067) -- 0:00:48
823500 -- [-976.669] (-973.867) (-990.717) (-976.035) * (-993.126) (-975.879) (-978.748) [-973.607] -- 0:00:48
824000 -- (-973.333) (-970.026) (-982.722) [-974.533] * (-984.357) (-979.586) (-987.454) [-979.187] -- 0:00:48
824500 -- (-986.160) (-972.043) (-986.044) [-971.656] * (-981.398) (-987.571) (-979.730) [-971.839] -- 0:00:48
825000 -- (-972.666) [-983.806] (-992.447) (-971.490) * [-978.047] (-979.143) (-977.377) (-979.027) -- 0:00:47
Average standard deviation of split frequencies: 0.009601
825500 -- [-977.791] (-972.699) (-973.910) (-977.713) * (-976.736) (-976.270) [-970.429] (-981.818) -- 0:00:47
826000 -- (-982.079) (-973.037) (-985.156) [-968.434] * (-990.350) [-972.507] (-978.631) (-990.601) -- 0:00:47
826500 -- (-971.371) (-987.755) (-976.815) [-970.061] * (-975.036) [-977.991] (-970.488) (-983.217) -- 0:00:47
827000 -- (-967.111) (-980.393) [-970.297] (-970.831) * (-981.763) (-998.288) [-971.970] (-984.875) -- 0:00:47
827500 -- (-984.095) (-967.576) [-982.297] (-971.958) * (-992.303) [-976.228] (-971.277) (-990.521) -- 0:00:47
828000 -- (-973.459) (-979.338) (-980.462) [-975.711] * (-984.230) [-969.877] (-977.407) (-981.108) -- 0:00:47
828500 -- (-969.812) (-989.056) (-984.972) [-972.728] * (-986.840) (-963.038) (-977.216) [-970.370] -- 0:00:46
829000 -- (-971.358) [-975.487] (-974.417) (-991.523) * (-987.622) (-983.301) [-975.749] (-982.343) -- 0:00:46
829500 -- (-989.008) (-974.172) [-973.302] (-980.799) * (-976.880) (-981.185) [-976.222] (-976.781) -- 0:00:46
830000 -- (-985.314) (-977.760) (-975.268) [-979.115] * (-977.507) [-975.419] (-981.451) (-978.618) -- 0:00:46
Average standard deviation of split frequencies: 0.009247
830500 -- (-990.710) [-977.437] (-981.581) (-976.425) * (-982.661) [-977.324] (-975.834) (-988.589) -- 0:00:46
831000 -- (-971.820) (-982.422) (-991.574) [-969.649] * [-971.490] (-982.220) (-973.889) (-994.161) -- 0:00:46
831500 -- [-978.092] (-979.637) (-988.098) (-976.741) * [-972.838] (-986.733) (-974.888) (-989.112) -- 0:00:46
832000 -- (-969.945) [-973.234] (-980.541) (-989.393) * (-983.876) (-987.750) [-969.130] (-978.588) -- 0:00:46
832500 -- [-980.906] (-965.171) (-978.801) (-976.242) * (-976.412) (-986.048) [-971.642] (-971.154) -- 0:00:45
833000 -- (-978.184) (-970.713) (-989.781) [-974.035] * (-986.539) (-986.613) (-983.805) [-970.683] -- 0:00:45
833500 -- (-969.583) (-984.980) (-980.806) [-969.079] * [-977.162] (-991.278) (-988.413) (-977.641) -- 0:00:45
834000 -- (-1003.403) (-972.017) [-975.165] (-979.763) * (-983.803) (-978.629) [-970.074] (-972.227) -- 0:00:45
834500 -- (-979.435) [-971.094] (-972.687) (-984.862) * (-996.214) (-982.161) [-978.133] (-975.708) -- 0:00:45
835000 -- [-971.844] (-985.601) (-978.843) (-982.567) * (-979.277) [-983.601] (-989.101) (-971.994) -- 0:00:45
Average standard deviation of split frequencies: 0.009354
835500 -- (-978.935) (-982.679) (-987.139) [-980.248] * (-983.796) (-987.201) (-984.878) [-968.773] -- 0:00:45
836000 -- (-970.669) (-978.157) (-984.211) [-974.805] * (-984.940) (-974.249) (-973.418) [-978.081] -- 0:00:44
836500 -- (-978.967) [-986.634] (-980.306) (-984.436) * (-971.690) (-970.524) (-988.675) [-970.265] -- 0:00:44
837000 -- [-981.257] (-988.779) (-984.408) (-984.910) * (-986.776) [-980.462] (-991.239) (-975.962) -- 0:00:44
837500 -- [-972.275] (-976.883) (-975.507) (-987.336) * (-982.791) (-976.426) [-977.699] (-975.577) -- 0:00:44
838000 -- (-967.544) (-978.887) (-987.411) [-970.864] * (-978.568) (-971.584) [-972.827] (-979.270) -- 0:00:44
838500 -- (-981.004) (-997.578) (-980.085) [-975.638] * (-991.542) (-979.203) (-978.314) [-974.054] -- 0:00:44
839000 -- [-978.399] (-979.932) (-978.691) (-984.711) * [-985.623] (-979.719) (-971.018) (-978.267) -- 0:00:44
839500 -- (-981.313) (-983.029) (-987.613) [-983.674] * (-977.536) (-985.559) (-979.313) [-974.255] -- 0:00:43
840000 -- (-983.815) (-975.505) [-974.634] (-989.454) * (-982.897) (-989.045) (-978.923) [-970.355] -- 0:00:43
Average standard deviation of split frequencies: 0.009335
840500 -- [-975.026] (-978.661) (-993.106) (-976.984) * (-984.195) (-983.147) (-988.096) [-975.630] -- 0:00:43
841000 -- (-970.440) [-979.321] (-995.861) (-979.420) * (-981.830) (-981.071) [-971.873] (-983.850) -- 0:00:43
841500 -- (-973.814) (-970.378) (-980.463) [-971.969] * (-985.117) (-980.476) (-989.561) [-980.183] -- 0:00:43
842000 -- (-979.322) [-978.283] (-972.628) (-972.566) * [-979.579] (-982.290) (-980.468) (-978.694) -- 0:00:43
842500 -- (-974.038) (-984.526) [-972.122] (-977.132) * (-979.398) (-978.062) (-971.527) [-972.608] -- 0:00:43
843000 -- (-999.065) (-976.733) [-972.867] (-981.102) * (-982.566) (-975.318) (-990.771) [-973.142] -- 0:00:43
843500 -- (-972.805) (-984.092) [-971.777] (-979.516) * (-984.539) (-974.694) (-973.984) [-977.450] -- 0:00:42
844000 -- (-988.296) (-985.857) [-971.184] (-981.094) * [-974.035] (-975.212) (-979.051) (-968.932) -- 0:00:42
844500 -- (-979.433) [-975.250] (-978.922) (-977.761) * (-983.685) (-977.617) (-982.793) [-980.557] -- 0:00:42
845000 -- (-986.148) [-976.059] (-984.414) (-989.165) * [-974.354] (-981.753) (-979.387) (-979.920) -- 0:00:42
Average standard deviation of split frequencies: 0.009800
845500 -- [-970.964] (-982.138) (-997.182) (-970.712) * (-988.130) (-981.224) (-976.522) [-984.956] -- 0:00:42
846000 -- [-978.581] (-975.775) (-993.876) (-970.679) * [-976.611] (-983.933) (-987.790) (-983.036) -- 0:00:42
846500 -- (-983.151) [-969.070] (-980.694) (-969.459) * (-973.643) (-987.299) (-981.557) [-969.409] -- 0:00:42
847000 -- (-982.758) [-969.112] (-986.947) (-979.330) * (-981.842) (-978.805) (-981.030) [-972.694] -- 0:00:41
847500 -- (-985.499) [-977.878] (-981.999) (-989.397) * (-986.321) (-982.076) (-992.754) [-972.262] -- 0:00:41
848000 -- (-972.760) (-980.753) (-986.480) [-983.558] * [-973.926] (-978.593) (-984.467) (-982.829) -- 0:00:41
848500 -- (-973.266) [-978.277] (-979.797) (-980.722) * (-984.778) [-976.475] (-973.659) (-974.595) -- 0:00:41
849000 -- (-990.583) (-994.994) (-975.227) [-967.614] * (-973.332) (-981.563) (-971.449) [-965.749] -- 0:00:41
849500 -- (-980.475) (-990.562) (-974.169) [-981.198] * (-970.926) (-997.023) [-972.341] (-971.589) -- 0:00:41
850000 -- [-977.671] (-977.633) (-981.307) (-970.205) * (-973.408) (-985.791) (-978.022) [-983.540] -- 0:00:41
Average standard deviation of split frequencies: 0.009714
850500 -- (-982.217) [-977.010] (-976.518) (-982.222) * [-975.082] (-985.140) (-973.499) (-979.349) -- 0:00:40
851000 -- [-973.798] (-976.622) (-981.685) (-972.292) * (-982.473) (-975.992) (-968.846) [-967.387] -- 0:00:40
851500 -- (-974.229) (-979.401) [-972.151] (-967.049) * (-981.089) (-984.911) (-967.623) [-980.548] -- 0:00:40
852000 -- (-993.732) (-983.649) [-975.762] (-986.379) * (-975.928) (-992.822) [-976.534] (-970.746) -- 0:00:40
852500 -- [-972.904] (-977.617) (-976.762) (-976.676) * [-977.319] (-987.716) (-974.842) (-975.261) -- 0:00:40
853000 -- (-974.057) (-980.412) (-984.311) [-978.541] * (-975.797) [-981.354] (-977.337) (-985.749) -- 0:00:40
853500 -- (-974.623) (-983.500) (-987.445) [-970.653] * (-979.480) (-977.084) [-981.395] (-983.185) -- 0:00:40
854000 -- (-981.631) (-966.928) (-975.749) [-979.715] * [-974.740] (-987.860) (-967.795) (-981.305) -- 0:00:40
854500 -- [-972.104] (-987.625) (-987.949) (-977.315) * [-970.854] (-974.504) (-971.604) (-975.144) -- 0:00:39
855000 -- [-984.862] (-985.864) (-976.238) (-981.520) * [-983.139] (-980.372) (-981.444) (-975.609) -- 0:00:39
Average standard deviation of split frequencies: 0.009978
855500 -- (-982.810) (-983.935) [-972.715] (-988.455) * (-982.840) (-972.302) (-983.920) [-976.199] -- 0:00:39
856000 -- (-1002.591) (-981.534) (-970.471) [-973.601] * (-991.152) (-985.576) (-990.109) [-969.705] -- 0:00:39
856500 -- [-975.313] (-973.095) (-975.099) (-984.972) * (-973.646) (-978.215) (-974.191) [-971.904] -- 0:00:39
857000 -- (-990.319) (-974.796) (-980.790) [-978.080] * [-967.839] (-977.097) (-979.951) (-990.148) -- 0:00:39
857500 -- (-973.061) [-976.555] (-974.621) (-975.504) * [-980.181] (-979.653) (-977.321) (-972.095) -- 0:00:39
858000 -- (-975.635) (-979.907) [-968.124] (-983.249) * (-972.005) (-979.532) (-987.936) [-980.002] -- 0:00:38
858500 -- (-988.759) (-978.470) [-970.609] (-982.959) * (-977.722) [-976.880] (-979.620) (-980.987) -- 0:00:38
859000 -- [-979.888] (-986.483) (-977.834) (-973.395) * [-985.856] (-987.247) (-976.285) (-977.645) -- 0:00:38
859500 -- (-983.449) (-978.681) (-983.599) [-973.678] * (-981.388) [-986.261] (-973.540) (-987.137) -- 0:00:38
860000 -- (-992.437) (-988.933) (-980.348) [-974.705] * (-996.981) (-984.000) [-977.799] (-983.461) -- 0:00:38
Average standard deviation of split frequencies: 0.010020
860500 -- [-980.051] (-984.739) (-975.805) (-972.670) * (-978.614) (-985.605) (-971.493) [-973.171] -- 0:00:38
861000 -- (-983.877) (-980.771) (-988.044) [-976.179] * [-977.773] (-984.696) (-970.209) (-972.148) -- 0:00:38
861500 -- (-976.341) (-978.556) (-992.265) [-976.870] * (-978.647) [-977.798] (-975.589) (-985.836) -- 0:00:37
862000 -- [-971.794] (-990.626) (-974.072) (-983.432) * (-978.780) (-994.437) (-974.771) [-977.957] -- 0:00:37
862500 -- (-979.787) (-993.585) [-977.686] (-979.996) * (-984.257) (-985.285) [-971.765] (-989.805) -- 0:00:37
863000 -- [-977.132] (-974.579) (-973.505) (-982.247) * (-985.098) (-981.079) [-974.933] (-990.380) -- 0:00:37
863500 -- (-980.027) (-978.171) [-967.774] (-988.113) * [-979.064] (-979.201) (-978.259) (-989.056) -- 0:00:37
864000 -- (-979.560) [-979.877] (-976.104) (-980.238) * (-976.343) (-972.340) [-973.664] (-990.178) -- 0:00:37
864500 -- (-970.786) (-982.793) (-981.867) [-982.346] * (-981.821) [-974.615] (-977.908) (-989.675) -- 0:00:37
865000 -- (-977.433) (-985.456) [-977.429] (-982.653) * (-987.605) (-976.238) [-979.441] (-985.796) -- 0:00:36
Average standard deviation of split frequencies: 0.010343
865500 -- [-975.143] (-985.989) (-980.301) (-973.841) * (-978.832) (-980.928) (-980.705) [-981.939] -- 0:00:36
866000 -- (-978.113) (-975.654) [-972.241] (-972.018) * (-974.192) (-979.745) [-974.840] (-977.619) -- 0:00:36
866500 -- (-977.978) [-978.706] (-974.492) (-983.007) * (-980.250) (-973.610) (-973.331) [-974.315] -- 0:00:36
867000 -- (-990.455) (-989.488) [-978.109] (-972.991) * (-983.940) (-975.680) [-973.842] (-972.876) -- 0:00:36
867500 -- [-973.331] (-979.859) (-984.459) (-989.601) * (-982.396) (-984.728) [-982.088] (-976.097) -- 0:00:36
868000 -- (-977.470) (-973.596) (-990.170) [-988.280] * (-987.281) (-994.467) (-980.295) [-965.436] -- 0:00:36
868500 -- (-986.309) [-974.829] (-974.272) (-986.143) * [-975.355] (-971.288) (-985.587) (-975.647) -- 0:00:36
869000 -- (-999.075) [-981.635] (-979.804) (-975.784) * (-977.206) (-984.376) (-973.302) [-991.263] -- 0:00:35
869500 -- (-979.495) (-984.406) [-973.306] (-990.676) * (-973.358) [-979.296] (-982.863) (-972.282) -- 0:00:35
870000 -- (-996.332) (-985.510) [-972.179] (-972.883) * (-982.575) [-970.394] (-976.383) (-982.360) -- 0:00:35
Average standard deviation of split frequencies: 0.010287
870500 -- (-989.410) (-979.723) (-977.195) [-981.718] * (-985.235) (-984.047) [-978.982] (-1006.841) -- 0:00:35
871000 -- (-988.603) (-972.066) (-969.010) [-976.990] * (-994.199) [-970.817] (-978.049) (-975.852) -- 0:00:35
871500 -- [-971.401] (-980.777) (-988.749) (-982.409) * (-973.652) (-981.617) (-981.924) [-974.882] -- 0:00:35
872000 -- [-980.118] (-984.394) (-976.297) (-977.805) * (-984.715) (-973.274) (-978.827) [-972.281] -- 0:00:35
872500 -- (-985.915) (-982.173) (-969.843) [-977.041] * [-978.250] (-971.298) (-980.326) (-977.316) -- 0:00:34
873000 -- [-977.381] (-993.603) (-980.364) (-986.314) * (-986.165) (-977.853) [-973.884] (-974.885) -- 0:00:34
873500 -- (-993.305) [-987.152] (-977.075) (-977.447) * [-984.591] (-974.317) (-985.954) (-985.007) -- 0:00:34
874000 -- [-985.983] (-977.907) (-965.725) (-982.764) * (-986.107) (-970.760) [-982.131] (-981.840) -- 0:00:34
874500 -- (-985.030) (-971.177) [-974.234] (-992.463) * (-971.755) [-980.500] (-986.168) (-976.269) -- 0:00:34
875000 -- (-973.230) (-987.775) (-972.419) [-982.444] * (-986.383) (-993.639) (-979.923) [-970.852] -- 0:00:34
Average standard deviation of split frequencies: 0.009971
875500 -- (-979.828) [-977.127] (-978.034) (-976.206) * (-977.196) (-988.503) (-975.722) [-967.467] -- 0:00:34
876000 -- (-969.754) [-978.164] (-983.435) (-998.485) * [-974.455] (-983.660) (-978.402) (-981.219) -- 0:00:33
876500 -- (-963.182) (-985.597) (-974.225) [-972.367] * [-973.547] (-987.921) (-981.896) (-982.022) -- 0:00:33
877000 -- [-971.127] (-984.303) (-966.679) (-981.535) * (-975.465) (-985.197) (-984.792) [-979.042] -- 0:00:33
877500 -- (-980.035) (-990.468) (-972.604) [-987.196] * (-977.827) (-999.619) [-971.275] (-973.833) -- 0:00:33
878000 -- [-973.697] (-972.354) (-978.035) (-977.984) * [-976.792] (-976.400) (-977.708) (-989.811) -- 0:00:33
878500 -- (-974.779) (-983.720) [-970.424] (-969.994) * (-986.010) [-978.857] (-975.471) (-982.187) -- 0:00:33
879000 -- [-971.601] (-993.899) (-974.196) (-971.991) * [-974.060] (-987.379) (-977.856) (-978.020) -- 0:00:33
879500 -- (-978.834) (-980.754) [-973.439] (-978.577) * (-979.579) (-989.599) [-977.210] (-984.452) -- 0:00:33
880000 -- (-976.044) (-984.359) [-974.151] (-987.413) * (-972.542) (-972.713) [-973.393] (-985.590) -- 0:00:32
Average standard deviation of split frequencies: 0.010328
880500 -- (-984.803) (-984.064) (-979.858) [-973.955] * [-984.840] (-975.003) (-984.575) (-980.146) -- 0:00:32
881000 -- (-979.118) (-980.620) (-991.666) [-976.823] * (-986.628) (-980.714) [-980.027] (-989.592) -- 0:00:32
881500 -- (-988.877) [-973.373] (-978.842) (-976.750) * [-976.548] (-987.799) (-983.484) (-986.267) -- 0:00:32
882000 -- (-985.984) (-980.642) (-969.853) [-967.823] * (-977.987) (-982.980) [-968.409] (-982.992) -- 0:00:32
882500 -- (-984.176) [-982.703] (-980.788) (-974.252) * (-981.723) [-977.436] (-975.400) (-983.706) -- 0:00:32
883000 -- (-991.909) (-976.845) (-976.642) [-973.282] * (-981.233) [-965.295] (-970.203) (-982.230) -- 0:00:32
883500 -- (-984.149) [-969.487] (-983.358) (-976.693) * (-981.424) (-990.086) [-989.380] (-982.129) -- 0:00:31
884000 -- (-996.961) [-979.439] (-985.143) (-978.734) * (-984.384) [-970.703] (-988.724) (-987.153) -- 0:00:31
884500 -- [-972.396] (-982.086) (-990.997) (-967.755) * [-981.871] (-973.026) (-987.823) (-985.001) -- 0:00:31
885000 -- (-974.414) [-975.730] (-975.691) (-974.065) * (-976.495) (-975.940) (-988.454) [-971.993] -- 0:00:31
Average standard deviation of split frequencies: 0.010140
885500 -- (-978.107) (-988.421) [-972.583] (-981.061) * [-983.156] (-984.188) (-979.242) (-984.479) -- 0:00:31
886000 -- [-977.674] (-982.710) (-984.498) (-970.283) * (-974.609) [-977.866] (-973.696) (-977.593) -- 0:00:31
886500 -- (-975.812) (-976.266) (-983.175) [-979.355] * (-973.545) [-973.952] (-972.999) (-985.204) -- 0:00:31
887000 -- (-982.424) [-994.352] (-976.200) (-977.888) * [-974.336] (-980.285) (-975.015) (-990.418) -- 0:00:30
887500 -- (-989.750) (-979.259) (-987.057) [-970.974] * (-986.275) (-973.448) [-977.411] (-989.391) -- 0:00:30
888000 -- (-977.855) [-976.019] (-977.801) (-978.580) * [-976.855] (-983.776) (-980.208) (-994.949) -- 0:00:30
888500 -- (-983.558) (-981.501) [-975.155] (-991.539) * (-977.867) [-968.937] (-989.135) (-977.856) -- 0:00:30
889000 -- (-984.538) (-971.194) (-983.625) [-979.683] * (-974.313) (-977.109) [-984.082] (-989.497) -- 0:00:30
889500 -- (-981.555) [-972.143] (-987.877) (-974.554) * (-983.933) [-980.810] (-980.816) (-976.978) -- 0:00:30
890000 -- (-972.761) (-973.766) [-975.254] (-979.849) * (-984.948) (-981.025) [-974.143] (-982.721) -- 0:00:30
Average standard deviation of split frequencies: 0.010181
890500 -- (-987.329) (-973.865) (-977.668) [-967.550] * (-977.532) (-980.281) [-983.515] (-979.489) -- 0:00:30
891000 -- (-979.577) (-972.877) [-974.920] (-990.746) * [-978.535] (-980.093) (-985.918) (-977.421) -- 0:00:29
891500 -- [-983.006] (-975.753) (-973.872) (-979.465) * (-984.276) (-976.977) (-979.804) [-980.132] -- 0:00:29
892000 -- [-976.681] (-977.062) (-978.073) (-975.875) * [-973.798] (-978.311) (-987.298) (-991.880) -- 0:00:29
892500 -- (-975.807) [-986.411] (-984.883) (-976.703) * (-978.098) (-984.244) [-974.025] (-984.348) -- 0:00:29
893000 -- (-979.364) (-977.001) [-968.313] (-995.953) * (-978.434) (-991.310) [-975.967] (-985.753) -- 0:00:29
893500 -- (-984.059) (-978.500) [-979.150] (-996.552) * (-973.106) [-971.948] (-982.433) (-978.729) -- 0:00:29
894000 -- (-978.604) (-971.695) [-978.362] (-975.407) * [-973.596] (-977.330) (-998.479) (-990.996) -- 0:00:29
894500 -- (-988.470) (-971.035) [-978.180] (-978.325) * (-977.301) [-967.509] (-979.313) (-980.490) -- 0:00:28
895000 -- (-990.039) [-979.001] (-984.188) (-985.280) * (-977.446) (-971.132) [-977.494] (-977.746) -- 0:00:28
Average standard deviation of split frequencies: 0.010801
895500 -- (-981.248) (-980.440) (-979.096) [-985.096] * [-972.988] (-978.050) (-982.549) (-982.806) -- 0:00:28
896000 -- (-974.746) [-985.701] (-981.866) (-977.229) * (-980.133) [-973.115] (-974.623) (-982.757) -- 0:00:28
896500 -- [-974.706] (-985.416) (-982.341) (-983.179) * (-982.460) (-989.253) (-971.703) [-973.873] -- 0:00:28
897000 -- [-972.476] (-980.434) (-995.253) (-982.668) * (-979.816) [-984.217] (-980.762) (-973.249) -- 0:00:28
897500 -- (-978.767) (-978.320) [-978.459] (-980.074) * [-975.483] (-975.732) (-983.587) (-972.119) -- 0:00:28
898000 -- [-980.267] (-978.581) (-977.974) (-982.321) * [-975.165] (-983.880) (-971.097) (-972.218) -- 0:00:27
898500 -- (-974.224) (-987.160) (-984.234) [-976.199] * (-987.076) (-977.942) (-988.369) [-976.948] -- 0:00:27
899000 -- (-977.732) (-979.925) (-989.890) [-980.235] * (-984.878) (-975.019) [-968.276] (-982.711) -- 0:00:27
899500 -- [-972.584] (-974.502) (-976.694) (-980.972) * (-973.143) (-978.823) [-973.657] (-979.348) -- 0:00:27
900000 -- (-978.415) (-982.990) (-978.534) [-978.973] * (-977.156) (-986.163) [-972.472] (-976.443) -- 0:00:27
Average standard deviation of split frequencies: 0.010899
900500 -- (-988.836) [-978.721] (-975.623) (-977.128) * [-973.870] (-981.146) (-981.986) (-976.140) -- 0:00:27
901000 -- (-978.934) (-986.923) (-987.134) [-976.163] * (-983.174) (-966.892) (-980.394) [-984.026] -- 0:00:27
901500 -- (-976.229) (-967.911) (-980.429) [-982.625] * (-974.039) (-985.072) [-974.100] (-984.752) -- 0:00:26
902000 -- (-974.146) (-981.748) [-977.665] (-989.351) * (-984.468) (-977.676) [-975.798] (-983.706) -- 0:00:26
902500 -- (-976.804) (-979.640) [-979.132] (-983.098) * (-987.050) [-978.854] (-981.846) (-981.562) -- 0:00:26
903000 -- (-982.013) (-987.445) (-994.972) [-978.287] * (-1001.623) (-972.803) [-970.016] (-977.128) -- 0:00:26
903500 -- (-979.909) (-983.231) [-973.970] (-968.216) * (-983.081) [-976.621] (-975.122) (-981.246) -- 0:00:26
904000 -- [-977.340] (-979.281) (-984.032) (-984.369) * (-983.889) [-989.402] (-978.025) (-983.875) -- 0:00:26
904500 -- (-980.919) (-984.712) [-981.784] (-979.855) * [-979.966] (-967.301) (-987.931) (-975.952) -- 0:00:26
905000 -- (-980.331) [-974.438] (-984.709) (-971.874) * [-973.274] (-981.968) (-984.657) (-981.989) -- 0:00:26
Average standard deviation of split frequencies: 0.011080
905500 -- (-984.264) (-976.735) [-972.580] (-986.348) * (-978.721) (-974.360) [-974.054] (-995.461) -- 0:00:25
906000 -- (-977.048) [-974.448] (-982.830) (-990.590) * (-981.375) [-972.680] (-976.541) (-983.128) -- 0:00:25
906500 -- (-976.375) (-979.887) (-976.110) [-970.442] * (-973.098) [-968.495] (-983.104) (-989.220) -- 0:00:25
907000 -- (-983.689) [-986.615] (-989.575) (-973.499) * [-971.019] (-981.764) (-988.390) (-989.118) -- 0:00:25
907500 -- (-980.045) (-976.081) (-979.853) [-970.949] * (-982.444) [-968.791] (-985.148) (-987.956) -- 0:00:25
908000 -- (-1001.837) (-985.381) [-974.784] (-987.139) * (-996.310) (-991.618) [-983.453] (-973.797) -- 0:00:25
908500 -- (-984.652) (-988.174) (-977.142) [-973.183] * (-983.166) [-977.242] (-981.532) (-985.588) -- 0:00:25
909000 -- (-984.561) (-991.485) (-977.444) [-977.867] * (-975.944) (-976.592) [-978.751] (-981.772) -- 0:00:24
909500 -- (-997.981) [-977.188] (-983.226) (-981.789) * (-989.136) (-990.172) (-971.670) [-972.311] -- 0:00:24
910000 -- (-986.264) (-979.732) (-975.773) [-978.509] * (-986.391) (-972.343) [-975.778] (-988.866) -- 0:00:24
Average standard deviation of split frequencies: 0.010840
910500 -- (-980.295) [-980.739] (-988.589) (-974.086) * (-992.367) (-978.999) (-973.084) [-980.514] -- 0:00:24
911000 -- (-977.901) (-979.771) (-987.772) [-977.827] * (-987.299) [-971.411] (-985.664) (-977.860) -- 0:00:24
911500 -- (-980.406) (-992.347) (-978.941) [-970.047] * (-975.874) (-979.167) [-979.170] (-977.384) -- 0:00:24
912000 -- (-984.108) (-981.019) [-971.590] (-981.129) * (-976.150) [-967.510] (-988.469) (-974.509) -- 0:00:24
912500 -- (-980.890) (-983.853) [-969.176] (-983.322) * (-989.362) (-985.243) (-989.675) [-972.583] -- 0:00:23
913000 -- (-983.428) [-978.152] (-978.542) (-983.110) * [-976.386] (-976.454) (-987.101) (-996.195) -- 0:00:23
913500 -- (-990.104) (-982.714) [-976.583] (-972.592) * (-982.951) [-975.497] (-983.177) (-976.584) -- 0:00:23
914000 -- (-975.382) [-978.805] (-982.498) (-982.992) * (-981.212) (-980.885) (-974.140) [-965.892] -- 0:00:23
914500 -- (-985.737) (-975.040) [-979.694] (-975.580) * [-974.667] (-981.379) (-975.538) (-984.758) -- 0:00:23
915000 -- (-985.785) [-976.049] (-985.401) (-975.836) * [-968.849] (-995.462) (-985.964) (-974.998) -- 0:00:23
Average standard deviation of split frequencies: 0.010656
915500 -- (-988.294) (-980.030) [-976.509] (-984.499) * [-974.278] (-970.023) (-998.110) (-989.861) -- 0:00:23
916000 -- (-985.791) [-969.640] (-982.953) (-979.514) * (-970.758) [-969.853] (-989.608) (-971.025) -- 0:00:23
916500 -- (-980.013) (-974.945) (-985.825) [-976.686] * (-975.649) [-971.517] (-988.193) (-985.384) -- 0:00:22
917000 -- (-993.341) (-982.877) [-981.606] (-985.797) * [-975.487] (-974.691) (-986.973) (-995.718) -- 0:00:22
917500 -- (-993.511) (-981.640) (-977.248) [-984.946] * [-971.154] (-977.874) (-977.455) (-973.655) -- 0:00:22
918000 -- (-983.713) (-981.158) [-970.651] (-986.914) * (-979.824) (-979.493) [-973.942] (-972.194) -- 0:00:22
918500 -- (-980.564) (-976.397) (-979.610) [-976.465] * (-974.500) (-977.506) [-969.155] (-983.293) -- 0:00:22
919000 -- (-983.734) (-986.022) (-977.274) [-971.221] * (-979.369) (-985.706) [-973.669] (-984.534) -- 0:00:22
919500 -- [-979.415] (-988.573) (-978.526) (-976.501) * (-990.567) [-976.912] (-986.070) (-982.656) -- 0:00:22
920000 -- (-998.073) [-986.886] (-975.913) (-975.277) * [-967.996] (-973.780) (-1002.297) (-986.940) -- 0:00:21
Average standard deviation of split frequencies: 0.010542
920500 -- (-998.288) (-971.148) [-969.654] (-966.656) * (-979.017) [-971.596] (-986.387) (-984.159) -- 0:00:21
921000 -- (-979.790) (-992.722) [-973.646] (-987.308) * (-983.008) (-970.169) [-972.110] (-972.942) -- 0:00:21
921500 -- [-974.686] (-976.240) (-986.951) (-994.464) * (-981.178) [-979.524] (-981.797) (-975.880) -- 0:00:21
922000 -- (-979.244) [-983.923] (-985.778) (-989.367) * (-966.809) (-991.059) [-975.213] (-983.778) -- 0:00:21
922500 -- (-987.670) (-975.366) [-971.220] (-991.602) * (-986.190) (-979.139) [-968.759] (-980.414) -- 0:00:21
923000 -- [-974.191] (-986.782) (-988.816) (-985.626) * (-973.844) (-986.785) [-975.618] (-981.808) -- 0:00:21
923500 -- (-983.110) [-969.896] (-976.979) (-995.360) * [-977.945] (-974.218) (-979.260) (-974.455) -- 0:00:20
924000 -- [-976.037] (-975.471) (-982.780) (-979.308) * [-977.069] (-991.131) (-984.520) (-981.234) -- 0:00:20
924500 -- (-985.473) (-988.726) (-981.629) [-986.371] * [-970.622] (-986.082) (-969.383) (-979.535) -- 0:00:20
925000 -- (-976.726) (-984.851) [-972.146] (-983.902) * (-983.438) (-980.859) [-974.993] (-978.742) -- 0:00:20
Average standard deviation of split frequencies: 0.010721
925500 -- (-982.231) [-975.803] (-976.943) (-984.738) * [-974.921] (-982.005) (-985.394) (-977.618) -- 0:00:20
926000 -- (-998.603) (-975.026) [-980.871] (-983.848) * (-983.943) [-979.996] (-1005.825) (-976.721) -- 0:00:20
926500 -- (-987.752) [-969.156] (-978.649) (-987.664) * (-984.462) (-974.753) (-986.389) [-976.987] -- 0:00:20
927000 -- (-983.571) [-984.045] (-975.912) (-983.842) * [-975.618] (-979.696) (-991.012) (-977.549) -- 0:00:20
927500 -- (-987.736) [-973.513] (-977.091) (-983.908) * [-972.075] (-976.158) (-981.141) (-974.845) -- 0:00:19
928000 -- (-985.609) [-969.688] (-983.435) (-982.572) * (-971.512) (-986.685) (-985.661) [-979.988] -- 0:00:19
928500 -- [-976.701] (-980.001) (-978.697) (-975.862) * (-979.169) (-973.605) (-977.109) [-980.684] -- 0:00:19
929000 -- (-975.639) (-986.518) [-976.734] (-982.069) * [-978.744] (-976.375) (-991.808) (-973.057) -- 0:00:19
929500 -- (-972.143) (-982.177) [-980.142] (-979.340) * (-974.377) [-982.485] (-981.135) (-966.856) -- 0:00:19
930000 -- (-987.719) (-989.919) (-985.143) [-980.279] * (-972.274) (-995.412) [-978.253] (-977.205) -- 0:00:19
Average standard deviation of split frequencies: 0.010101
930500 -- (-970.318) (-991.572) (-990.736) [-972.910] * [-969.216] (-978.727) (-973.355) (-979.966) -- 0:00:19
931000 -- (-984.137) [-973.869] (-975.586) (-979.907) * [-977.316] (-984.824) (-982.397) (-982.263) -- 0:00:18
931500 -- (-984.623) (-979.743) (-981.164) [-983.097] * (-985.960) (-995.406) [-968.083] (-974.410) -- 0:00:18
932000 -- [-975.482] (-979.436) (-993.628) (-974.660) * (-977.268) (-983.932) [-971.556] (-980.438) -- 0:00:18
932500 -- (-981.147) (-979.710) (-980.041) [-983.729] * (-986.215) (-984.792) [-975.565] (-989.441) -- 0:00:18
933000 -- [-973.253] (-989.094) (-979.399) (-973.129) * (-977.622) (-984.629) [-975.547] (-979.402) -- 0:00:18
933500 -- (-968.996) (-988.956) [-979.997] (-977.041) * (-981.241) [-977.779] (-976.941) (-978.443) -- 0:00:18
934000 -- (-978.316) (-979.211) [-978.759] (-978.140) * (-992.910) [-974.439] (-973.430) (-981.164) -- 0:00:18
934500 -- (-978.028) [-975.781] (-970.554) (-973.929) * (-983.420) [-975.156] (-970.401) (-977.559) -- 0:00:17
935000 -- (-986.653) (-984.232) [-969.416] (-970.625) * [-976.901] (-977.114) (-986.257) (-965.656) -- 0:00:17
Average standard deviation of split frequencies: 0.009836
935500 -- [-989.822] (-990.240) (-972.926) (-968.668) * (-981.078) (-977.311) (-987.258) [-973.902] -- 0:00:17
936000 -- (-982.375) (-989.466) (-977.673) [-974.776] * (-987.945) (-976.272) (-977.915) [-974.160] -- 0:00:17
936500 -- [-976.093] (-992.863) (-972.972) (-977.496) * (-975.763) [-977.450] (-971.122) (-979.668) -- 0:00:17
937000 -- (-978.214) (-981.208) [-986.955] (-974.767) * (-965.520) (-987.487) [-974.866] (-970.163) -- 0:00:17
937500 -- (-986.870) (-990.428) (-994.977) [-979.086] * [-970.611] (-980.705) (-988.632) (-980.005) -- 0:00:17
938000 -- [-981.682] (-981.211) (-988.846) (-980.512) * (-981.794) (-977.157) (-983.882) [-968.540] -- 0:00:16
938500 -- [-988.327] (-985.204) (-977.795) (-978.879) * (-991.365) [-973.498] (-972.111) (-981.554) -- 0:00:16
939000 -- [-979.445] (-989.327) (-983.226) (-975.214) * [-973.459] (-985.652) (-973.453) (-970.780) -- 0:00:16
939500 -- (-988.937) (-988.149) (-986.570) [-968.160] * (-976.687) [-965.761] (-975.090) (-977.260) -- 0:00:16
940000 -- (-989.011) (-994.462) (-977.444) [-973.606] * (-984.979) [-967.464] (-983.797) (-976.670) -- 0:00:16
Average standard deviation of split frequencies: 0.009816
940500 -- (-988.575) (-980.342) (-978.760) [-975.143] * (-968.367) (-973.970) (-994.004) [-968.159] -- 0:00:16
941000 -- (-973.896) (-992.531) (-981.698) [-980.646] * (-978.338) [-974.933] (-978.490) (-978.373) -- 0:00:16
941500 -- [-977.310] (-980.994) (-974.509) (-983.586) * [-983.248] (-971.685) (-987.976) (-982.690) -- 0:00:16
942000 -- [-975.287] (-980.289) (-975.114) (-985.912) * (-974.497) (-979.989) [-982.036] (-980.088) -- 0:00:15
942500 -- (-985.343) [-974.463] (-982.143) (-979.938) * (-974.000) (-987.626) [-979.001] (-985.455) -- 0:00:15
943000 -- (-975.216) (-983.445) [-974.102] (-993.682) * (-984.078) [-972.911] (-978.006) (-973.669) -- 0:00:15
943500 -- [-979.400] (-985.879) (-971.770) (-973.418) * [-971.495] (-972.201) (-984.814) (-978.365) -- 0:00:15
944000 -- [-981.534] (-983.825) (-980.788) (-981.594) * (-976.858) (-981.121) (-986.800) [-972.874] -- 0:00:15
944500 -- (-980.595) [-990.882] (-979.283) (-981.435) * [-972.550] (-980.011) (-978.734) (-979.905) -- 0:00:15
945000 -- (-996.629) (-984.962) [-979.009] (-970.672) * (-979.485) [-971.673] (-979.704) (-983.267) -- 0:00:15
Average standard deviation of split frequencies: 0.010025
945500 -- (-990.705) (-985.525) [-970.963] (-970.815) * (-991.141) (-977.042) [-984.764] (-987.468) -- 0:00:14
946000 -- [-967.529] (-986.439) (-981.386) (-986.133) * [-977.280] (-986.494) (-972.034) (-988.659) -- 0:00:14
946500 -- (-974.994) [-967.637] (-986.173) (-980.536) * [-970.830] (-978.007) (-987.361) (-987.220) -- 0:00:14
947000 -- [-980.046] (-973.454) (-983.303) (-984.482) * (-976.688) (-978.193) (-976.906) [-969.905] -- 0:00:14
947500 -- [-973.604] (-983.606) (-978.114) (-977.258) * (-983.004) [-968.349] (-982.579) (-984.701) -- 0:00:14
948000 -- [-978.418] (-980.308) (-991.521) (-972.223) * (-976.108) [-970.755] (-980.856) (-968.564) -- 0:00:14
948500 -- (-971.360) (-978.321) [-976.904] (-980.774) * (-985.979) (-989.937) (-974.267) [-979.928] -- 0:00:14
949000 -- (-980.391) (-981.838) [-983.825] (-989.029) * (-980.223) [-977.600] (-975.618) (-974.967) -- 0:00:13
949500 -- (-984.038) (-984.353) (-986.429) [-980.124] * (-982.084) (-968.300) [-984.630] (-994.408) -- 0:00:13
950000 -- (-974.288) [-975.472] (-987.585) (-989.860) * (-971.621) [-966.237] (-981.159) (-979.727) -- 0:00:13
Average standard deviation of split frequencies: 0.010413
950500 -- (-983.868) [-976.060] (-985.940) (-984.649) * [-968.685] (-978.297) (-980.751) (-988.851) -- 0:00:13
951000 -- (-982.979) [-969.846] (-996.452) (-967.457) * (-980.657) (-982.767) (-976.698) [-978.833] -- 0:00:13
951500 -- (-979.406) (-974.892) (-981.686) [-982.893] * (-976.171) (-990.011) [-971.453] (-990.129) -- 0:00:13
952000 -- (-980.859) (-978.750) (-985.298) [-984.412] * (-983.618) (-978.782) (-980.364) [-974.956] -- 0:00:13
952500 -- [-986.627] (-991.983) (-986.076) (-978.871) * [-976.073] (-964.421) (-981.936) (-982.939) -- 0:00:13
953000 -- (-987.540) (-994.135) (-983.973) [-972.627] * (-970.244) [-970.080] (-986.735) (-981.261) -- 0:00:12
953500 -- (-994.641) (-992.938) (-979.636) [-977.038] * (-972.360) (-981.100) [-974.817] (-978.249) -- 0:00:12
954000 -- (-992.503) [-984.835] (-983.702) (-968.086) * (-993.174) (-990.971) [-972.521] (-981.613) -- 0:00:12
954500 -- [-982.025] (-996.732) (-986.428) (-965.719) * (-991.312) (-987.512) [-969.864] (-975.184) -- 0:00:12
955000 -- (-980.477) [-983.715] (-986.360) (-972.029) * (-981.733) [-974.184] (-989.900) (-975.136) -- 0:00:12
Average standard deviation of split frequencies: 0.011080
955500 -- (-986.484) (-988.754) [-976.940] (-983.275) * (-983.326) [-977.277] (-980.577) (-978.622) -- 0:00:12
956000 -- [-970.377] (-986.272) (-977.018) (-978.871) * (-967.714) (-980.448) [-976.958] (-976.280) -- 0:00:12
956500 -- [-973.689] (-979.469) (-973.753) (-982.019) * (-977.976) (-983.355) (-984.971) [-980.585] -- 0:00:11
957000 -- (-972.587) (-987.296) [-968.889] (-983.439) * (-982.000) (-980.384) (-987.656) [-973.298] -- 0:00:11
957500 -- (-986.484) (-998.153) (-967.641) [-966.957] * (-968.525) (-981.848) (-975.319) [-970.058] -- 0:00:11
958000 -- (-993.750) [-973.490] (-975.428) (-989.355) * (-979.020) (-975.750) (-976.141) [-973.560] -- 0:00:11
958500 -- (-995.845) (-980.251) [-966.626] (-986.113) * [-977.671] (-982.431) (-979.299) (-984.012) -- 0:00:11
959000 -- (-990.079) [-977.349] (-981.692) (-983.746) * (-988.848) (-979.930) (-975.860) [-978.967] -- 0:00:11
959500 -- [-970.790] (-979.916) (-989.527) (-985.097) * [-975.348] (-989.028) (-982.100) (-978.997) -- 0:00:11
960000 -- (-980.235) [-982.037] (-974.499) (-985.773) * (-974.491) (-980.451) [-971.845] (-975.606) -- 0:00:10
Average standard deviation of split frequencies: 0.011026
960500 -- (-972.764) [-972.943] (-981.519) (-988.416) * (-983.668) [-969.804] (-987.172) (-981.999) -- 0:00:10
961000 -- [-969.722] (-983.547) (-977.601) (-978.249) * (-986.819) (-985.106) [-977.072] (-981.591) -- 0:00:10
961500 -- (-974.660) (-977.866) (-974.969) [-980.151] * (-978.188) [-975.683] (-972.134) (-985.050) -- 0:00:10
962000 -- [-976.703] (-977.945) (-975.333) (-972.125) * [-973.509] (-996.310) (-986.215) (-982.039) -- 0:00:10
962500 -- (-985.264) (-968.137) (-984.825) [-977.349] * (-979.014) [-973.811] (-975.654) (-984.659) -- 0:00:10
963000 -- (-986.302) [-968.769] (-983.562) (-978.686) * (-982.735) [-976.455] (-976.581) (-989.509) -- 0:00:10
963500 -- (-986.618) (-979.625) [-980.746] (-974.571) * (-985.190) (-979.435) [-974.844] (-987.187) -- 0:00:10
964000 -- (-971.989) (-978.776) (-998.042) [-972.635] * [-976.055] (-979.364) (-970.189) (-978.543) -- 0:00:09
964500 -- (-975.435) (-972.987) [-971.895] (-973.897) * [-981.761] (-976.105) (-980.441) (-974.229) -- 0:00:09
965000 -- (-975.155) [-970.614] (-976.652) (-973.404) * [-977.315] (-988.311) (-983.810) (-980.511) -- 0:00:09
Average standard deviation of split frequencies: 0.010851
965500 -- [-974.922] (-989.948) (-978.337) (-987.769) * (-977.602) (-976.400) (-977.548) [-980.339] -- 0:00:09
966000 -- (-985.875) (-978.520) [-968.874] (-982.220) * [-979.600] (-981.400) (-976.549) (-977.628) -- 0:00:09
966500 -- (-981.596) (-980.139) (-990.491) [-975.968] * (-983.443) (-981.205) [-982.868] (-981.031) -- 0:00:09
967000 -- (-976.710) (-985.194) (-979.162) [-981.632] * [-977.429] (-989.417) (-972.804) (-977.476) -- 0:00:09
967500 -- (-987.139) (-976.639) (-978.908) [-967.587] * (-986.141) (-988.225) [-966.119] (-967.485) -- 0:00:08
968000 -- (-981.437) (-977.867) (-978.988) [-968.998] * (-983.549) (-986.424) (-973.524) [-979.286] -- 0:00:08
968500 -- [-979.434] (-984.706) (-978.280) (-980.217) * (-987.090) [-980.672] (-974.228) (-978.297) -- 0:00:08
969000 -- (-978.188) [-982.818] (-973.620) (-994.741) * [-985.053] (-978.328) (-988.024) (-977.118) -- 0:00:08
969500 -- (-980.380) (-994.525) [-971.434] (-987.632) * [-976.772] (-978.539) (-981.454) (-978.243) -- 0:00:08
970000 -- (-979.655) (-988.592) [-977.663] (-983.197) * (-980.832) (-976.653) (-982.558) [-980.549] -- 0:00:08
Average standard deviation of split frequencies: 0.010010
970500 -- (-982.559) (-981.618) [-973.529] (-986.087) * (-968.669) (-974.958) (-983.739) [-970.141] -- 0:00:08
971000 -- (-984.216) (-978.783) [-966.556] (-980.810) * (-977.539) [-972.572] (-980.279) (-976.659) -- 0:00:07
971500 -- (-988.621) [-978.877] (-967.209) (-972.196) * (-989.706) (-984.351) (-981.401) [-971.485] -- 0:00:07
972000 -- (-984.022) [-979.427] (-982.462) (-978.777) * (-981.128) (-986.117) (-972.223) [-977.320] -- 0:00:07
972500 -- (-978.819) (-975.958) [-968.689] (-986.344) * (-974.121) (-987.973) [-978.328] (-983.253) -- 0:00:07
973000 -- [-983.039] (-989.800) (-980.186) (-988.589) * [-979.754] (-978.382) (-977.134) (-975.926) -- 0:00:07
973500 -- (-990.010) [-975.191] (-981.950) (-979.690) * (-1001.380) [-968.460] (-980.123) (-975.993) -- 0:00:07
974000 -- (-987.608) [-969.987] (-973.642) (-980.363) * (-973.955) (-981.515) (-976.619) [-968.832] -- 0:00:07
974500 -- [-971.357] (-975.378) (-980.224) (-979.413) * [-971.283] (-981.413) (-991.441) (-986.501) -- 0:00:06
975000 -- [-983.855] (-975.447) (-990.045) (-979.938) * (-972.814) (-973.084) (-981.259) [-976.591] -- 0:00:06
Average standard deviation of split frequencies: 0.010455
975500 -- [-974.657] (-977.390) (-978.453) (-978.981) * (-978.809) [-976.954] (-990.713) (-977.945) -- 0:00:06
976000 -- (-975.810) (-982.402) (-974.825) [-980.119] * [-981.571] (-977.158) (-971.508) (-982.177) -- 0:00:06
976500 -- (-978.488) (-977.408) [-970.527] (-978.773) * (-981.074) [-968.798] (-975.696) (-992.900) -- 0:00:06
977000 -- (-981.364) (-976.422) (-974.928) [-984.123] * (-989.633) (-983.055) (-972.055) [-986.699] -- 0:00:06
977500 -- (-974.200) (-972.141) [-970.857] (-988.404) * (-987.854) (-980.765) [-974.755] (-975.068) -- 0:00:06
978000 -- [-970.933] (-982.785) (-984.496) (-978.468) * [-974.274] (-974.929) (-976.490) (-983.294) -- 0:00:06
978500 -- (-975.910) (-987.176) [-976.853] (-974.196) * (-979.241) (-981.446) (-974.471) [-981.155] -- 0:00:05
979000 -- [-983.948] (-990.552) (-979.148) (-973.825) * (-986.733) (-977.604) [-969.278] (-976.668) -- 0:00:05
979500 -- (-979.879) (-983.442) [-972.398] (-980.571) * (-990.337) (-970.070) (-976.651) [-973.774] -- 0:00:05
980000 -- (-988.413) [-974.827] (-985.861) (-988.030) * (-981.808) (-989.561) [-978.840] (-982.364) -- 0:00:05
Average standard deviation of split frequencies: 0.010519
980500 -- (-977.466) (-988.334) [-977.401] (-979.298) * [-969.200] (-980.158) (-975.182) (-982.844) -- 0:00:05
981000 -- (-975.140) (-980.015) (-987.904) [-981.686] * (-985.101) (-975.034) (-981.594) [-985.846] -- 0:00:05
981500 -- (-977.384) (-979.486) (-978.288) [-978.081] * (-979.647) (-968.990) (-984.940) [-971.411] -- 0:00:05
982000 -- (-971.852) [-975.168] (-980.393) (-993.057) * (-987.763) (-979.709) (-976.392) [-970.816] -- 0:00:04
982500 -- (-977.061) (-975.773) [-972.776] (-986.412) * (-999.523) [-971.979] (-973.524) (-989.494) -- 0:00:04
983000 -- (-980.501) [-976.935] (-978.287) (-980.422) * (-991.843) [-972.197] (-982.376) (-984.891) -- 0:00:04
983500 -- [-976.280] (-988.473) (-986.675) (-976.603) * (-985.429) (-988.849) [-969.367] (-983.408) -- 0:00:04
984000 -- (-971.360) (-975.279) [-975.806] (-987.029) * (-987.994) [-986.575] (-978.875) (-989.507) -- 0:00:04
984500 -- (-980.941) (-976.234) (-978.400) [-983.973] * (-990.363) (-980.745) [-971.738] (-989.867) -- 0:00:04
985000 -- (-972.864) (-980.365) [-982.150] (-978.872) * (-979.713) (-989.345) (-983.229) [-983.472] -- 0:00:04
Average standard deviation of split frequencies: 0.009990
985500 -- (-972.832) (-981.302) (-978.289) [-968.444] * (-990.384) [-969.846] (-989.313) (-976.665) -- 0:00:03
986000 -- (-975.904) (-990.418) [-984.108] (-978.438) * (-1000.228) (-969.531) (-985.816) [-973.819] -- 0:00:03
986500 -- (-1003.385) (-988.530) [-969.580] (-987.045) * (-985.933) [-980.663] (-987.880) (-975.328) -- 0:00:03
987000 -- [-979.229] (-978.768) (-969.756) (-980.555) * (-975.011) (-982.844) [-977.312] (-975.298) -- 0:00:03
987500 -- (-968.463) [-970.853] (-972.228) (-971.212) * [-971.265] (-980.385) (-979.923) (-989.831) -- 0:00:03
988000 -- (-978.286) [-977.249] (-978.904) (-983.036) * (-991.578) [-969.841] (-975.195) (-975.216) -- 0:00:03
988500 -- (-978.302) (-971.247) [-983.445] (-972.685) * (-980.046) (-970.147) [-981.491] (-984.373) -- 0:00:03
989000 -- (-977.413) (-969.430) [-980.070] (-982.844) * (-977.542) (-995.997) (-978.816) [-978.661] -- 0:00:03
989500 -- (-982.597) (-982.938) [-975.440] (-987.949) * (-980.678) (-978.555) [-975.423] (-974.966) -- 0:00:02
990000 -- (-977.707) (-988.936) (-984.619) [-977.052] * (-975.787) (-974.167) [-981.756] (-974.206) -- 0:00:02
Average standard deviation of split frequencies: 0.009742
990500 -- [-975.957] (-989.081) (-986.204) (-977.066) * (-973.295) (-984.987) (-975.348) [-971.635] -- 0:00:02
991000 -- (-984.048) (-985.207) (-996.843) [-979.814] * (-978.569) (-980.520) (-982.292) [-976.814] -- 0:00:02
991500 -- (-980.773) (-992.119) (-974.840) [-979.122] * (-986.178) (-982.020) (-976.014) [-972.193] -- 0:00:02
992000 -- (-976.152) (-987.198) (-978.031) [-989.111] * (-977.549) (-987.941) [-974.030] (-977.870) -- 0:00:02
992500 -- [-969.688] (-979.942) (-981.029) (-979.454) * (-973.599) [-979.183] (-969.740) (-989.781) -- 0:00:02
993000 -- [-973.210] (-982.508) (-983.684) (-981.725) * [-973.763] (-978.526) (-982.155) (-987.377) -- 0:00:01
993500 -- [-970.749] (-979.613) (-980.454) (-988.139) * (-986.538) (-973.360) (-984.343) [-981.138] -- 0:00:01
994000 -- [-983.115] (-997.528) (-983.244) (-972.019) * (-982.871) [-977.775] (-986.190) (-984.875) -- 0:00:01
994500 -- (-984.419) (-976.713) [-981.989] (-991.139) * (-983.454) (-997.718) (-981.536) [-974.927] -- 0:00:01
995000 -- (-988.418) (-969.373) [-982.732] (-973.219) * (-981.672) (-984.491) [-979.546] (-977.171) -- 0:00:01
Average standard deviation of split frequencies: 0.009640
995500 -- (-980.186) [-970.630] (-978.821) (-980.929) * [-979.133] (-985.798) (-984.022) (-974.928) -- 0:00:01
996000 -- (-981.404) (-983.431) [-981.103] (-975.678) * (-974.894) (-970.058) (-983.025) [-968.912] -- 0:00:01
996500 -- (-971.336) [-969.075] (-982.192) (-978.565) * [-968.475] (-967.749) (-989.679) (-983.398) -- 0:00:00
997000 -- (-979.777) (-971.805) (-977.650) [-975.373] * (-966.615) (-980.284) [-983.567] (-981.355) -- 0:00:00
997500 -- (-969.562) [-973.165] (-999.321) (-983.694) * [-972.931] (-974.829) (-978.186) (-994.642) -- 0:00:00
998000 -- (-977.034) [-973.202] (-978.930) (-979.430) * (-979.627) (-986.956) [-973.362] (-1009.547) -- 0:00:00
998500 -- (-975.222) (-981.764) [-974.809] (-974.605) * (-977.868) (-975.361) [-976.650] (-983.824) -- 0:00:00
999000 -- (-975.779) (-980.025) (-980.113) [-968.673] * (-985.177) (-991.387) [-971.592] (-987.976) -- 0:00:00
999500 -- (-979.227) (-977.979) [-972.375] (-984.283) * [-972.745] (-974.995) (-991.212) (-981.315) -- 0:00:00
1000000 -- (-973.100) (-982.328) (-974.577) [-977.564] * (-988.438) (-986.905) (-978.182) [-979.797] -- 0:00:00
Average standard deviation of split frequencies: 0.010128
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -973.099722 -- 25.079146
Chain 1 -- -973.099722 -- 25.079146
Chain 2 -- -982.328359 -- 23.980933
Chain 2 -- -982.328364 -- 23.980933
Chain 3 -- -974.577406 -- 23.576568
Chain 3 -- -974.577413 -- 23.576568
Chain 4 -- -977.564074 -- 22.049513
Chain 4 -- -977.564067 -- 22.049513
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -988.437503 -- 17.027615
Chain 1 -- -988.437511 -- 17.027615
Chain 2 -- -986.905413 -- 22.670878
Chain 2 -- -986.905417 -- 22.670878
Chain 3 -- -978.181833 -- 23.456326
Chain 3 -- -978.181830 -- 23.456326
Chain 4 -- -979.796765 -- 23.070570
Chain 4 -- -979.796762 -- 23.070570
Analysis completed in 4 mins 33 seconds
Analysis used 273.63 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -959.29
Likelihood of best state for "cold" chain of run 2 was -959.73
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
50.1 % ( 34 %) Dirichlet(Revmat{all})
70.8 % ( 70 %) Slider(Revmat{all})
31.4 % ( 29 %) Dirichlet(Pi{all})
33.0 % ( 24 %) Slider(Pi{all})
37.8 % ( 21 %) Multiplier(Alpha{1,2})
48.3 % ( 24 %) Multiplier(Alpha{3})
55.7 % ( 26 %) Slider(Pinvar{all})
30.0 % ( 25 %) ExtSPR(Tau{all},V{all})
10.8 % ( 13 %) ExtTBR(Tau{all},V{all})
35.3 % ( 30 %) NNI(Tau{all},V{all})
26.6 % ( 15 %) ParsSPR(Tau{all},V{all})
27.1 % ( 24 %) Multiplier(V{all})
57.6 % ( 53 %) Nodeslider(V{all})
26.6 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
50.5 % ( 49 %) Dirichlet(Revmat{all})
70.7 % ( 58 %) Slider(Revmat{all})
31.0 % ( 26 %) Dirichlet(Pi{all})
33.1 % ( 31 %) Slider(Pi{all})
37.7 % ( 28 %) Multiplier(Alpha{1,2})
47.8 % ( 28 %) Multiplier(Alpha{3})
55.2 % ( 16 %) Slider(Pinvar{all})
29.9 % ( 31 %) ExtSPR(Tau{all},V{all})
10.4 % ( 14 %) ExtTBR(Tau{all},V{all})
35.1 % ( 33 %) NNI(Tau{all},V{all})
26.5 % ( 23 %) ParsSPR(Tau{all},V{all})
27.0 % ( 28 %) Multiplier(V{all})
57.5 % ( 55 %) Nodeslider(V{all})
26.3 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.71 0.47 0.29
2 | 166596 0.72 0.49
3 | 167104 166834 0.74
4 | 166336 166750 166380
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.70 0.46 0.29
2 | 166559 0.72 0.49
3 | 166610 165916 0.74
4 | 166888 166699 167328
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -973.05
| 2 |
| |
| 2 1 1 2 |
| 1 2 222 2 2 1 |
| 1 |
| 11 1 1 * * 2 1 |
|1 2 2 1 1 1 2 12121 12 1 21 |
| 2 11 2 2 1 22 2 22 2 * 1 1 222 2|
|2 1 11 2 2 2 12 2*1 1 2 1 2 |
| 2 2 1 1 1 1 * 2 2 1 2 1|
| 1 12 1 21 1 11 2 2 1 |
| 2 1 * 2 2 1 1 1 |
| 2 1 2 11 |
| 2 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -978.24
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -969.39 -987.45
2 -969.03 -988.25
--------------------------------------
TOTAL -969.19 -987.93
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.695592 0.023976 0.425104 1.001214 0.678674 1196.33 1270.14 1.003
r(A<->C){all} 0.097825 0.001858 0.021265 0.179078 0.092203 525.29 551.58 1.000
r(A<->G){all} 0.085291 0.001196 0.025600 0.155678 0.079259 463.45 631.47 1.000
r(A<->T){all} 0.067149 0.001678 0.002127 0.144203 0.059835 482.75 543.21 1.001
r(C<->G){all} 0.013185 0.000105 0.000015 0.033233 0.010930 1011.43 1073.58 1.004
r(C<->T){all} 0.695144 0.006196 0.540112 0.835992 0.699291 428.59 582.66 1.001
r(G<->T){all} 0.041406 0.000447 0.007015 0.084773 0.038550 765.14 849.37 1.000
pi(A){all} 0.262543 0.000485 0.214116 0.300988 0.261924 1083.16 1096.83 1.001
pi(C){all} 0.248842 0.000410 0.211620 0.291137 0.247969 847.74 1069.80 1.001
pi(G){all} 0.334985 0.000544 0.292332 0.382182 0.334261 1294.93 1383.26 1.001
pi(T){all} 0.153630 0.000282 0.122186 0.188062 0.153169 1077.46 1160.27 1.002
alpha{1,2} 0.099275 0.000701 0.053755 0.156543 0.097082 1175.86 1233.26 1.000
alpha{3} 1.950980 0.541881 0.771828 3.443655 1.826272 1444.66 1448.48 1.000
pinvar{all} 0.537197 0.004690 0.396338 0.666097 0.541929 1338.10 1364.28 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
Key to taxon bipartitions (saved to file "/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------------
1 -- .**********
2 -- .*.........
3 -- ..*........
4 -- ...*.......
5 -- ....*......
6 -- .....*.....
7 -- ......*....
8 -- .......*...
9 -- ........*..
10 -- .........*.
11 -- ..........*
12 -- ...********
13 -- .**........
14 -- ...**......
15 -- .....******
16 -- .....**....
17 -- .....**.*..
18 -- .......*.*.
19 -- .......*..*
20 -- .....*****.
21 -- ......*.*..
22 -- .....****..
23 -- .....*..*..
24 -- .......*.**
25 -- ...**.....*
26 -- .....****.*
27 -- ........*.*
28 -- .........**
29 -- .....***...
-----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
12 2921 0.973018 0.004240 0.970020 0.976016 2
13 2829 0.942372 0.006124 0.938041 0.946702 2
14 2694 0.897402 0.008480 0.891406 0.903398 2
15 2188 0.728847 0.021670 0.713524 0.744171 2
16 1185 0.394737 0.010835 0.387075 0.402398 2
17 1039 0.346103 0.015546 0.335110 0.357095 2
18 1003 0.334111 0.012719 0.325117 0.343105 2
19 793 0.264157 0.005182 0.260493 0.267821 2
20 705 0.234843 0.015546 0.223851 0.245836 2
21 541 0.180213 0.015546 0.169221 0.191206 2
22 515 0.171552 0.007066 0.166556 0.176549 2
23 422 0.140573 0.016959 0.128581 0.152565 2
24 403 0.134244 0.000471 0.133911 0.134577 2
25 392 0.130580 0.011306 0.122585 0.138574 2
26 367 0.122252 0.003298 0.119920 0.124584 2
27 365 0.121586 0.008951 0.115256 0.127915 2
28 339 0.112925 0.011777 0.104597 0.121252 2
29 292 0.097268 0.006595 0.092605 0.101932 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.034947 0.000317 0.007319 0.071639 0.032066 1.000 2
length{all}[2] 0.012149 0.000098 0.000003 0.030940 0.009774 1.000 2
length{all}[3] 0.016216 0.000123 0.000205 0.037789 0.013809 1.000 2
length{all}[4] 0.028836 0.000318 0.003535 0.063927 0.024703 1.000 2
length{all}[5] 0.028008 0.000306 0.002292 0.061180 0.024276 1.002 2
length{all}[6] 0.037096 0.000325 0.007913 0.073380 0.033893 1.000 2
length{all}[7] 0.009767 0.000072 0.000004 0.026693 0.007483 1.000 2
length{all}[8] 0.061794 0.000828 0.016064 0.118575 0.056858 1.001 2
length{all}[9] 0.173318 0.003967 0.075662 0.299401 0.162690 1.002 2
length{all}[10] 0.066895 0.000819 0.020163 0.122266 0.062185 1.000 2
length{all}[11] 0.069932 0.000924 0.020600 0.131141 0.065054 1.000 2
length{all}[12] 0.027738 0.000331 0.001385 0.064398 0.023817 1.000 2
length{all}[13] 0.017110 0.000166 0.000013 0.042724 0.013893 1.002 2
length{all}[14] 0.030080 0.000439 0.000057 0.069871 0.025314 1.000 2
length{all}[15] 0.030824 0.000409 0.000024 0.069851 0.027278 1.000 2
length{all}[16] 0.012442 0.000135 0.000003 0.036101 0.009146 0.999 2
length{all}[17] 0.015082 0.000168 0.000006 0.038699 0.011796 0.999 2
length{all}[18] 0.021861 0.000271 0.000239 0.054153 0.017844 1.002 2
length{all}[19] 0.022796 0.000288 0.000222 0.054719 0.019219 1.002 2
length{all}[20] 0.019228 0.000266 0.000001 0.052066 0.015088 0.999 2
length{all}[21] 0.008524 0.000085 0.000032 0.026602 0.005192 1.009 2
length{all}[22] 0.018116 0.000181 0.000130 0.043853 0.015623 0.998 2
length{all}[23] 0.008157 0.000076 0.000044 0.026058 0.005803 0.999 2
length{all}[24] 0.013563 0.000179 0.000010 0.040404 0.009681 1.000 2
length{all}[25] 0.024604 0.000347 0.000117 0.061746 0.020758 0.998 2
length{all}[26] 0.012546 0.000158 0.000024 0.036905 0.008732 0.998 2
length{all}[27] 0.020422 0.000303 0.000013 0.053519 0.016456 0.998 2
length{all}[28] 0.017458 0.000253 0.000028 0.049224 0.012075 0.998 2
length{all}[29] 0.016655 0.000253 0.000045 0.046667 0.013000 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.010128
Maximum standard deviation of split frequencies = 0.021670
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
| /----------------------- C4 (4)
| /-----------90----------+
| | \----------------------- C5 (5)
| |
| | /----------------------- C6 (6)
|----------97----------+ |
| | |----------------------- C7 (7)
| | |
+ | |----------------------- C8 (8)
| \-----------73----------+
| |----------------------- C9 (9)
| |
| |----------------------- C10 (10)
| |
| \----------------------- C11 (11)
|
| /----------------------- C2 (2)
\----------------------94----------------------+
\----------------------- C3 (3)
Phylogram (based on average branch lengths):
/----------- C1 (1)
|
| /-------- C4 (4)
| /--------+
| | \-------- C5 (5)
| |
| | /------------ C6 (6)
|-------+ |
| | |--- C7 (7)
| | |
+ | |------------------- C8 (8)
| \--------+
| |------------------------------------------------------- C9 (9)
| |
| |--------------------- C10 (10)
| |
| \---------------------- C11 (11)
|
| /--- C2 (2)
\----+
\---- C3 (3)
|---------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (1251 trees sampled):
50 % credible set contains 144 trees
90 % credible set contains 951 trees
95 % credible set contains 1101 trees
99 % credible set contains 1221 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 11 ls = 405
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Sequences read..
Counting site patterns.. 0:00
77 patterns at 135 / 135 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11
440 bytes for distance
75152 bytes for conP
10472 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 81
187880 bytes for conP, adjusted
0.034919 0.016834 0.022476 0.022940 0.022908 0.029430 0.054470 0.018630 0.060868 0.146650 0.074550 0.058486 0.012536 0.013087 0.009632 0.300000 1.300000
ntime & nrate & np: 15 2 17
Bounds (np=17):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 17
lnL0 = -1117.762343
Iterating by ming2
Initial: fx= 1117.762343
x= 0.03492 0.01683 0.02248 0.02294 0.02291 0.02943 0.05447 0.01863 0.06087 0.14665 0.07455 0.05849 0.01254 0.01309 0.00963 0.30000 1.30000
1 h-m-p 0.0000 0.0002 203.1997 ++YYCYYCCC 1112.878090 7 0.0002 35 | 0/17
2 h-m-p 0.0000 0.0001 819.8692 +YYYYCCCC 1107.267042 7 0.0001 66 | 0/17
3 h-m-p 0.0000 0.0001 2252.6924 +YCCC 1101.949094 3 0.0001 92 | 0/17
4 h-m-p 0.0001 0.0004 1494.4706 CYYCC 1097.314304 4 0.0001 118 | 0/17
5 h-m-p 0.0002 0.0010 393.6979 +YYYCYCCCC 1072.801067 8 0.0009 151 | 0/17
6 h-m-p 0.0000 0.0001 1019.3243 +YYCCCC 1070.522863 5 0.0000 180 | 0/17
7 h-m-p 0.0001 0.0004 355.3877 +YYCCCC 1065.027220 5 0.0003 209 | 0/17
8 h-m-p 0.0001 0.0003 831.8682 +YCYCCC 1056.688567 5 0.0002 238 | 0/17
9 h-m-p 0.0002 0.0010 161.6181 YCYCCC 1053.795283 5 0.0004 266 | 0/17
10 h-m-p 0.0002 0.0012 195.0907 YCYCCC 1049.480883 5 0.0006 294 | 0/17
11 h-m-p 0.0001 0.0005 794.0054 +YYYCCCC 1038.269211 6 0.0004 324 | 0/17
12 h-m-p 0.0000 0.0001 5456.4472 +YYYYCYCYCC 1011.631515 10 0.0001 359 | 0/17
13 h-m-p 0.0001 0.0006 102.0545 YC 1011.521063 1 0.0000 380 | 0/17
14 h-m-p 0.0000 0.0006 138.1218 YCCC 1011.324997 3 0.0001 405 | 0/17
15 h-m-p 0.0004 0.0047 21.7906 CCC 1011.202200 2 0.0004 429 | 0/17
16 h-m-p 0.0006 0.0060 13.5338 YC 1010.859442 1 0.0011 450 | 0/17
17 h-m-p 0.0006 0.0034 23.0544 CCCC 1010.422816 3 0.0006 476 | 0/17
18 h-m-p 0.0005 0.0027 23.1066 CCCC 1010.202356 3 0.0006 502 | 0/17
19 h-m-p 0.0648 0.6854 0.2031 +CYCCCC 986.853020 5 0.5422 533 | 0/17
20 h-m-p 0.1511 0.7555 0.5673 YCC 973.715095 2 0.3015 573 | 0/17
21 h-m-p 0.2750 1.3748 0.1411 YCCC 969.831596 3 0.4739 615 | 0/17
22 h-m-p 0.1874 0.9368 0.1002 +YYCYCC 967.367484 5 0.6453 660 | 0/17
23 h-m-p 0.3956 2.1632 0.1634 +YYYCC 962.379375 4 1.4803 703 | 0/17
24 h-m-p 0.4798 2.3991 0.1594 YCCCCC 959.628909 5 1.0394 749 | 0/17
25 h-m-p 0.9584 4.7921 0.0747 YCCCCC 957.549758 5 2.2468 795 | 0/17
26 h-m-p 1.2052 8.0000 0.1392 YCCC 956.286628 3 1.8860 837 | 0/17
27 h-m-p 1.1089 5.5446 0.1178 CYCCC 955.363169 4 1.8320 881 | 0/17
28 h-m-p 1.6000 8.0000 0.0709 YCC 954.338381 2 3.1001 921 | 0/17
29 h-m-p 1.6000 8.0000 0.0794 CCCC 953.574848 3 2.3955 964 | 0/17
30 h-m-p 1.6000 8.0000 0.0218 CCCC 953.205264 3 2.5084 1007 | 0/17
31 h-m-p 1.6000 8.0000 0.0255 CCC 952.972526 2 2.2791 1048 | 0/17
32 h-m-p 1.6000 8.0000 0.0059 YCCC 952.740431 3 3.0101 1090 | 0/17
33 h-m-p 0.2604 8.0000 0.0682 ++YC 952.505675 1 2.7370 1130 | 0/17
34 h-m-p 1.6000 8.0000 0.0168 YCCC 952.297235 3 2.9512 1172 | 0/17
35 h-m-p 1.6000 8.0000 0.0122 +YCC 951.936331 2 4.8377 1213 | 0/17
36 h-m-p 1.6000 8.0000 0.0181 CCCC 951.664780 3 2.2907 1256 | 0/17
37 h-m-p 1.6000 8.0000 0.0256 CC 951.514318 1 2.4556 1295 | 0/17
38 h-m-p 1.6000 8.0000 0.0069 CCC 951.449674 2 1.8749 1336 | 0/17
39 h-m-p 1.6000 8.0000 0.0053 YC 951.410670 1 2.7799 1374 | 0/17
40 h-m-p 1.6000 8.0000 0.0088 CCC 951.396384 2 1.7503 1415 | 0/17
41 h-m-p 1.5898 8.0000 0.0096 +YC 951.355350 1 4.7151 1454 | 0/17
42 h-m-p 0.6810 8.0000 0.0668 +YCCC 951.183504 3 4.8029 1497 | 0/17
43 h-m-p 1.6000 8.0000 0.0280 CCC 951.127879 2 1.9632 1538 | 0/17
44 h-m-p 1.6000 8.0000 0.0231 CCC 951.091853 2 2.2084 1579 | 0/17
45 h-m-p 1.6000 8.0000 0.0061 CC 951.083560 1 1.8082 1618 | 0/17
46 h-m-p 1.6000 8.0000 0.0017 C 951.082476 0 1.6284 1655 | 0/17
47 h-m-p 1.6000 8.0000 0.0015 YC 951.082436 1 1.0346 1693 | 0/17
48 h-m-p 1.6000 8.0000 0.0003 Y 951.082436 0 0.9385 1730 | 0/17
49 h-m-p 1.6000 8.0000 0.0000 Y 951.082436 0 1.0090 1767 | 0/17
50 h-m-p 1.6000 8.0000 0.0000 C 951.082436 0 1.6000 1804 | 0/17
51 h-m-p 1.6000 8.0000 0.0000 C 951.082436 0 0.4000 1841 | 0/17
52 h-m-p 0.3623 8.0000 0.0000 C 951.082436 0 0.3877 1878 | 0/17
53 h-m-p 0.5386 8.0000 0.0000 Y 951.082436 0 0.3716 1915 | 0/17
54 h-m-p 0.6915 8.0000 0.0000 Y 951.082436 0 0.4640 1952 | 0/17
55 h-m-p 1.5305 8.0000 0.0000 C 951.082436 0 0.3826 1989 | 0/17
56 h-m-p 1.6000 8.0000 0.0000 Y 951.082436 0 0.4000 2026
Out..
lnL = -951.082436
2027 lfun, 2027 eigenQcodon, 30405 P(t)
Time used: 0:09
Model 1: NearlyNeutral
TREE # 1
(1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 81
0.034919 0.016834 0.022476 0.022940 0.022908 0.029430 0.054470 0.018630 0.060868 0.146650 0.074550 0.058486 0.012536 0.013087 0.009632 2.702903 0.579915 0.172397
ntime & nrate & np: 15 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 5.159698
np = 18
lnL0 = -993.690427
Iterating by ming2
Initial: fx= 993.690427
x= 0.03492 0.01683 0.02248 0.02294 0.02291 0.02943 0.05447 0.01863 0.06087 0.14665 0.07455 0.05849 0.01254 0.01309 0.00963 2.70290 0.57992 0.17240
1 h-m-p 0.0000 0.0004 181.1125 ++YCYYCC 988.681312 5 0.0003 33 | 0/18
2 h-m-p 0.0001 0.0004 759.9516 ++ 968.896921 m 0.0004 54 | 1/18
3 h-m-p 0.0004 0.0019 157.8872 CCCC 966.402431 3 0.0004 81 | 0/18
4 h-m-p 0.0001 0.0003 696.4835 CCC 966.105235 2 0.0000 106 | 0/18
5 h-m-p 0.0001 0.0006 209.3858 +CYYCCC 962.946765 5 0.0004 137 | 0/18
6 h-m-p 0.0005 0.0026 36.9869 CYCCC 962.457188 4 0.0008 165 | 0/18
7 h-m-p 0.0001 0.0006 64.9405 CCCC 962.299724 3 0.0002 192 | 0/18
8 h-m-p 0.0002 0.0029 50.1918 +CCCCC 961.585801 4 0.0012 222 | 0/18
9 h-m-p 0.0005 0.0027 106.5641 CCC 961.069619 2 0.0005 247 | 0/18
10 h-m-p 0.0005 0.0025 69.6892 YCYCCC 960.142244 5 0.0013 276 | 0/18
11 h-m-p 0.0015 0.0075 14.4059 YCC 960.013964 2 0.0011 300 | 0/18
12 h-m-p 0.0017 0.0135 9.3235 CCCC 959.764054 3 0.0025 327 | 0/18
13 h-m-p 0.0015 0.0224 15.6082 +YYYYCCCCC 958.320657 8 0.0064 361 | 0/18
14 h-m-p 0.0006 0.0031 67.9221 +YYCCC 955.972914 4 0.0020 389 | 0/18
15 h-m-p 0.0003 0.0017 115.0292 YCYCCC 954.013280 5 0.0009 418 | 0/18
16 h-m-p 0.0002 0.0010 101.8442 +CC 952.517808 1 0.0008 442 | 0/18
17 h-m-p 0.0001 0.0004 375.9070 CCCCC 952.034893 4 0.0001 471 | 0/18
18 h-m-p 0.0002 0.0009 133.5049 CYCCC 951.423059 4 0.0003 499 | 0/18
19 h-m-p 0.0230 0.1536 1.9653 +YYYCCC 946.889649 5 0.0843 528 | 0/18
20 h-m-p 0.1609 0.8043 0.1943 CCCCC 944.428079 4 0.2836 557 | 0/18
21 h-m-p 0.2334 1.1670 0.2232 CCCC 942.046631 3 0.3269 602 | 0/18
22 h-m-p 0.1899 0.9493 0.3433 +YYYCCC 938.721125 5 0.7199 649 | 0/18
23 h-m-p 0.0801 0.4005 0.4749 +YCYCCC 938.166802 5 0.2311 697 | 0/18
24 h-m-p 0.1024 2.3312 1.0715 +CCCCC 937.162319 4 0.4467 745 | 0/18
25 h-m-p 0.4625 2.3127 0.4073 CCCC 936.878982 3 0.4927 772 | 0/18
26 h-m-p 1.2423 6.2116 0.0510 YYC 936.759550 2 0.9602 813 | 0/18
27 h-m-p 1.3935 6.9675 0.0324 YCC 936.727276 2 0.7800 855 | 0/18
28 h-m-p 1.6000 8.0000 0.0133 YC 936.714434 1 1.0082 895 | 0/18
29 h-m-p 0.9267 8.0000 0.0145 CC 936.706188 1 0.9692 936 | 0/18
30 h-m-p 1.6000 8.0000 0.0020 CC 936.697000 1 1.4193 977 | 0/18
31 h-m-p 0.1254 8.0000 0.0229 +YC 936.691648 1 0.8139 1018 | 0/18
32 h-m-p 1.6000 8.0000 0.0024 YC 936.691075 1 0.7194 1058 | 0/18
33 h-m-p 0.7503 8.0000 0.0023 C 936.690992 0 0.7751 1097 | 0/18
34 h-m-p 1.6000 8.0000 0.0003 Y 936.690958 0 1.2235 1136 | 0/18
35 h-m-p 0.8113 8.0000 0.0004 Y 936.690942 0 1.5706 1175 | 0/18
36 h-m-p 0.6579 8.0000 0.0009 C 936.690940 0 0.6921 1214 | 0/18
37 h-m-p 1.6000 8.0000 0.0001 Y 936.690939 0 0.7445 1253 | 0/18
38 h-m-p 1.6000 8.0000 0.0000 Y 936.690939 0 0.7057 1292 | 0/18
39 h-m-p 1.1298 8.0000 0.0000 C 936.690939 0 1.1298 1331 | 0/18
40 h-m-p 1.6000 8.0000 0.0000 C 936.690939 0 1.6000 1370 | 0/18
41 h-m-p 1.6000 8.0000 0.0000 C 936.690939 0 0.3801 1409 | 0/18
42 h-m-p 0.5101 8.0000 0.0000 ---Y 936.690939 0 0.0020 1451
Out..
lnL = -936.690939
1452 lfun, 4356 eigenQcodon, 43560 P(t)
Time used: 0:20
Model 2: PositiveSelection
TREE # 1
(1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 81
initial w for M2:NSpselection reset.
0.034919 0.016834 0.022476 0.022940 0.022908 0.029430 0.054470 0.018630 0.060868 0.146650 0.074550 0.058486 0.012536 0.013087 0.009632 2.625147 1.265673 0.374565 0.422161 2.960589
ntime & nrate & np: 15 3 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.340767
np = 20
lnL0 = -1020.319798
Iterating by ming2
Initial: fx= 1020.319798
x= 0.03492 0.01683 0.02248 0.02294 0.02291 0.02943 0.05447 0.01863 0.06087 0.14665 0.07455 0.05849 0.01254 0.01309 0.00963 2.62515 1.26567 0.37456 0.42216 2.96059
1 h-m-p 0.0000 0.0004 174.1889 ++YCYCCC 1016.821060 5 0.0003 35 | 0/20
2 h-m-p 0.0003 0.0044 198.0527 YYYCC 1015.113353 4 0.0003 63 | 0/20
3 h-m-p 0.0002 0.0011 164.8579 +YYCYCYC 1005.489193 6 0.0010 96 | 0/20
4 h-m-p 0.0001 0.0006 519.3808 ++ 983.752773 m 0.0006 119 | 1/20
5 h-m-p 0.0010 0.0048 16.1257 CCC 982.956951 2 0.0011 146 | 1/20
6 h-m-p 0.0001 0.0006 267.8965 YCCC 981.916067 3 0.0001 174 | 1/20
7 h-m-p 0.0005 0.0028 65.7757 +YCCC 979.923543 3 0.0014 203 | 1/20
8 h-m-p 0.0002 0.0012 222.6937 YCCCC 978.581456 4 0.0006 233 | 1/20
9 h-m-p 0.0002 0.0008 181.8786 CCCCC 978.194483 4 0.0002 264 | 1/20
10 h-m-p 0.0004 0.0022 79.2025 YCCCC 976.908466 4 0.0011 294 | 1/20
11 h-m-p 0.0001 0.0007 283.6190 CCCC 976.360963 3 0.0002 323 | 1/20
12 h-m-p 0.0007 0.0063 65.8525 +YCCCC 974.442137 4 0.0021 354 | 1/20
13 h-m-p 0.0001 0.0007 146.6835 YCCC 974.029770 3 0.0003 382 | 1/20
14 h-m-p 0.0002 0.0015 245.7726 +YYYC 972.163186 3 0.0006 409 | 1/20
15 h-m-p 0.0005 0.0026 215.4274 CCCC 970.375554 3 0.0007 438 | 1/20
16 h-m-p 0.0007 0.0036 195.5100 CYCCC 966.539684 4 0.0014 468 | 1/20
17 h-m-p 0.0010 0.0049 87.3881 +CYYCYCCC 957.210285 7 0.0045 503 | 1/20
18 h-m-p 0.0004 0.0029 945.8671 YCCCC 949.405453 4 0.0007 533 | 1/20
19 h-m-p 0.2312 1.1559 1.3638 YCYCCC 945.596727 5 0.5559 564 | 0/20
20 h-m-p 0.0004 0.0019 490.1602 -CYC 945.299287 2 0.0000 591 | 0/20
21 h-m-p 0.0053 1.0003 1.6073 +++CYCCC 942.249487 4 0.5259 624 | 0/20
22 h-m-p 0.1689 0.8445 0.8868 +YCYCCC 941.157245 5 0.4767 656 | 0/20
23 h-m-p 0.6898 3.4564 0.6129 CCCC 940.122413 3 1.1849 705 | 0/20
24 h-m-p 0.9447 4.7236 0.3858 CCC 939.538490 2 1.3166 752 | 0/20
25 h-m-p 1.1565 6.4074 0.4392 CCCC 938.856367 3 1.3701 801 | 0/20
26 h-m-p 1.6000 8.0000 0.2802 YCC 938.483646 2 1.3024 847 | 0/20
27 h-m-p 0.5125 2.5625 0.6300 YCCCC 938.022492 4 1.0442 897 | 0/20
28 h-m-p 1.1612 8.0000 0.5665 CCCC 937.545179 3 1.6316 946 | 0/20
29 h-m-p 1.0579 8.0000 0.8738 YCCC 936.843075 3 2.1918 994 | 0/20
30 h-m-p 1.2101 8.0000 1.5827 CYC 936.352948 2 1.3709 1040 | 0/20
31 h-m-p 0.6875 3.4373 1.4858 CCCC 936.112833 3 1.0334 1069 | 0/20
32 h-m-p 1.6000 8.0000 0.8331 CC 935.976608 1 1.6113 1094 | 0/20
33 h-m-p 1.6000 8.0000 0.7287 CYC 935.888288 2 1.5279 1140 | 0/20
34 h-m-p 1.6000 8.0000 0.3021 CC 935.872972 1 1.4900 1185 | 0/20
35 h-m-p 1.6000 8.0000 0.1813 C 935.868040 0 1.5593 1228 | 0/20
36 h-m-p 1.6000 8.0000 0.1139 YC 935.866750 1 0.9212 1272 | 0/20
37 h-m-p 1.6000 8.0000 0.0315 YC 935.866493 1 1.0254 1316 | 0/20
38 h-m-p 1.6000 8.0000 0.0058 C 935.866468 0 1.4658 1359 | 0/20
39 h-m-p 1.6000 8.0000 0.0032 C 935.866465 0 1.3696 1402 | 0/20
40 h-m-p 1.6000 8.0000 0.0010 Y 935.866464 0 1.1897 1445 | 0/20
41 h-m-p 1.6000 8.0000 0.0001 Y 935.866464 0 1.1933 1488 | 0/20
42 h-m-p 1.4388 8.0000 0.0001 C 935.866464 0 1.3062 1531 | 0/20
43 h-m-p 1.6000 8.0000 0.0000 C 935.866464 0 2.1984 1574 | 0/20
44 h-m-p 1.6000 8.0000 0.0000 C 935.866464 0 1.6000 1617 | 0/20
45 h-m-p 0.6587 8.0000 0.0000 ++ 935.866464 m 8.0000 1660 | 0/20
46 h-m-p 1.6000 8.0000 0.0000 ++ 935.866464 m 8.0000 1703 | 0/20
47 h-m-p 0.1939 8.0000 0.0006 ++C 935.866464 0 3.1031 1748 | 0/20
48 h-m-p 1.6000 8.0000 0.0012 ++ 935.866464 m 8.0000 1791 | 0/20
49 h-m-p 0.0160 8.0000 0.7043 +++Y 935.866462 0 2.2027 1837 | 0/20
50 h-m-p 1.6000 8.0000 0.1119 C 935.866461 0 2.4468 1880 | 0/20
51 h-m-p 0.8684 8.0000 0.3154 ++ 935.866461 m 8.0000 1923 | 0/20
52 h-m-p 1.6000 8.0000 0.1146 Y 935.866460 0 1.2219 1966 | 0/20
53 h-m-p 0.7396 8.0000 0.1893 ++ 935.866460 m 8.0000 2009 | 0/20
54 h-m-p 1.6000 8.0000 0.3826 C 935.866460 0 1.8226 2052 | 0/20
55 h-m-p 1.6000 8.0000 0.2350 C 935.866460 0 2.0842 2095 | 0/20
56 h-m-p 1.5884 8.0000 0.3084 +Y 935.866460 0 4.0475 2139 | 0/20
57 h-m-p 1.6000 8.0000 0.2767 C 935.866460 0 1.7486 2182 | 0/20
58 h-m-p 0.7602 8.0000 0.6364 +C 935.866460 0 3.0410 2226 | 0/20
59 h-m-p 1.6000 8.0000 0.0259 C 935.866460 0 1.2843 2269 | 0/20
60 h-m-p 0.0992 8.0000 0.3356 C 935.866460 0 0.0315 2312 | 0/20
61 h-m-p 1.5028 8.0000 0.0070 -Y 935.866460 0 0.0939 2356 | 0/20
62 h-m-p 1.0723 8.0000 0.0006 --------C 935.866460 0 0.0000 2407
Out..
lnL = -935.866460
2408 lfun, 9632 eigenQcodon, 108360 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -953.012148 S = -926.914644 -18.174644
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 77 patterns 0:48
did 20 / 77 patterns 0:48
did 30 / 77 patterns 0:48
did 40 / 77 patterns 0:48
did 50 / 77 patterns 0:48
did 60 / 77 patterns 0:48
did 70 / 77 patterns 0:48
did 77 / 77 patterns 0:48
Time used: 0:48
Model 3: discrete
TREE # 1
(1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 81
0.034919 0.016834 0.022476 0.022940 0.022908 0.029430 0.054470 0.018630 0.060868 0.146650 0.074550 0.058486 0.012536 0.013087 0.009632 2.733658 0.296071 0.323761 0.019068 0.048981 0.078538
ntime & nrate & np: 15 4 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 12.213934
np = 21
lnL0 = -951.422777
Iterating by ming2
Initial: fx= 951.422777
x= 0.03492 0.01683 0.02248 0.02294 0.02291 0.02943 0.05447 0.01863 0.06087 0.14665 0.07455 0.05849 0.01254 0.01309 0.00963 2.73366 0.29607 0.32376 0.01907 0.04898 0.07854
1 h-m-p 0.0000 0.0003 142.6969 ++CYYCCC 949.249189 5 0.0002 36 | 0/21
2 h-m-p 0.0000 0.0000 260.9716 ++ 948.348411 m 0.0000 60 | 1/21
3 h-m-p 0.0000 0.0003 209.8795 ++ 945.391788 m 0.0003 84 | 2/21
4 h-m-p 0.0001 0.0006 65.3174 YCCCC 945.095753 4 0.0002 115 | 2/21
5 h-m-p 0.0003 0.0036 52.4034 CYCC 944.841233 3 0.0004 144 | 2/21
6 h-m-p 0.0007 0.0064 30.5367 YCCC 944.749225 3 0.0004 173 | 2/21
7 h-m-p 0.0003 0.0017 23.8289 YYC 944.711090 2 0.0003 199 | 2/21
8 h-m-p 0.0005 0.0090 12.1042 CC 944.686872 1 0.0004 225 | 2/21
9 h-m-p 0.0009 0.0198 5.7270 CCC 944.662191 2 0.0011 253 | 2/21
10 h-m-p 0.0005 0.0132 13.2547 +CCC 944.545056 2 0.0020 282 | 2/21
11 h-m-p 0.0006 0.0051 44.1758 CC 944.435739 1 0.0006 308 | 2/21
12 h-m-p 0.0004 0.0020 32.1821 YCCC 944.406572 3 0.0002 337 | 2/21
13 h-m-p 0.0007 0.0232 10.5822 CC 944.378203 1 0.0012 363 | 2/21
14 h-m-p 0.0013 0.0503 9.2407 CCC 944.350236 2 0.0018 391 | 2/21
15 h-m-p 0.0008 0.0091 21.0454 CC 944.328858 1 0.0007 417 | 2/21
16 h-m-p 0.0004 0.0215 35.7701 +YCCC 944.144153 3 0.0034 447 | 2/21
17 h-m-p 0.0005 0.0113 229.8427 +YYC 943.495604 2 0.0020 474 | 2/21
18 h-m-p 0.0005 0.0111 823.5021 +CCC 940.719701 2 0.0022 503 | 2/21
19 h-m-p 1.0291 5.1457 0.4452 CCC 939.730771 2 1.2412 531 | 1/21
20 h-m-p 0.0043 0.0214 87.2382 --YYCC 939.675632 3 0.0001 580 | 1/21
21 h-m-p 0.0178 2.9533 0.5004 +++YYC 939.226439 2 0.9194 609 | 0/21
22 h-m-p 0.3014 5.9991 1.5263 ----CC 939.226121 1 0.0002 659 | 0/21
23 h-m-p 0.0160 8.0000 0.6836 +++YCCC 938.134335 3 1.8692 691 | 0/21
24 h-m-p 1.2389 6.1943 0.2464 CCCC 937.676035 3 1.3136 742 | 0/21
25 h-m-p 0.8354 8.0000 0.3874 YCCC 937.105177 3 1.3533 792 | 0/21
26 h-m-p 0.6915 3.4576 0.2283 +YCCC 936.407165 3 2.2039 843 | 0/21
27 h-m-p 0.3859 1.9295 0.2472 CCCC 936.159196 3 0.7124 894 | 0/21
28 h-m-p 0.4938 2.6102 0.3566 YCCC 935.978153 3 0.8743 944 | 0/21
29 h-m-p 0.2060 1.0302 0.1784 ++ 935.903971 m 1.0302 989 | 1/21
30 h-m-p 0.7833 8.0000 0.2347 CC 935.876399 1 0.8607 1036 | 0/21
31 h-m-p 0.0015 0.0386 136.4685 -C 935.876290 0 0.0001 1081 | 0/21
32 h-m-p 0.1692 8.0000 0.0784 +CC 935.871036 1 0.8985 1108 | 0/21
33 h-m-p 1.6000 8.0000 0.0148 YC 935.870280 1 0.9590 1154 | 0/21
34 h-m-p 1.6000 8.0000 0.0044 CC 935.870126 1 2.3264 1201 | 0/21
35 h-m-p 1.6000 8.0000 0.0053 ++ 935.869006 m 8.0000 1246 | 0/21
36 h-m-p 0.6283 8.0000 0.0673 YC 935.867477 1 1.5250 1292 | 0/21
37 h-m-p 1.6000 8.0000 0.0218 CY 935.866648 1 1.8998 1339 | 0/21
38 h-m-p 1.4754 8.0000 0.0281 YC 935.866488 1 1.0807 1385 | 0/21
39 h-m-p 1.6000 8.0000 0.0035 Y 935.866462 0 1.2724 1430 | 0/21
40 h-m-p 1.6000 8.0000 0.0025 Y 935.866461 0 1.2327 1475 | 0/21
41 h-m-p 1.6000 8.0000 0.0003 C 935.866460 0 1.5003 1520 | 0/21
42 h-m-p 1.6000 8.0000 0.0002 C 935.866460 0 1.2984 1565 | 0/21
43 h-m-p 1.6000 8.0000 0.0000 C 935.866460 0 0.4000 1610 | 0/21
44 h-m-p 0.6803 8.0000 0.0000 C 935.866460 0 0.1701 1655 | 0/21
45 h-m-p 0.2483 8.0000 0.0000 C 935.866460 0 0.0621 1700 | 0/21
46 h-m-p 0.0724 8.0000 0.0000 Y 935.866460 0 0.0501 1745 | 0/21
47 h-m-p 0.0504 8.0000 0.0000 ---------C 935.866460 0 0.0000 1799
Out..
lnL = -935.866460
1800 lfun, 7200 eigenQcodon, 81000 P(t)
Time used: 1:09
Model 7: beta
TREE # 1
(1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 81
0.034919 0.016834 0.022476 0.022940 0.022908 0.029430 0.054470 0.018630 0.060868 0.146650 0.074550 0.058486 0.012536 0.013087 0.009632 2.733659 0.646685 1.067456
ntime & nrate & np: 15 1 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 6.217949
np = 18
lnL0 = -982.228032
Iterating by ming2
Initial: fx= 982.228032
x= 0.03492 0.01683 0.02248 0.02294 0.02291 0.02943 0.05447 0.01863 0.06087 0.14665 0.07455 0.05849 0.01254 0.01309 0.00963 2.73366 0.64668 1.06746
1 h-m-p 0.0000 0.0003 145.1177 ++CYCCC 980.330498 4 0.0002 32 | 0/18
2 h-m-p 0.0002 0.0038 139.3452 YYCCC 979.058609 4 0.0003 59 | 0/18
3 h-m-p 0.0001 0.0007 150.5597 +YYCYCC 976.349020 5 0.0004 88 | 0/18
4 h-m-p 0.0002 0.0011 167.5850 +YYYCCC 971.591956 5 0.0008 117 | 0/18
5 h-m-p 0.0001 0.0003 1037.7970 +YYYYCCC 962.123397 6 0.0002 147 | 0/18
6 h-m-p 0.0000 0.0001 3071.2103 +YYCYCCC 955.407042 6 0.0001 178 | 0/18
7 h-m-p 0.0000 0.0002 223.1058 CYC 955.232106 2 0.0000 202 | 0/18
8 h-m-p 0.0001 0.0003 56.9981 CCCC 955.164027 3 0.0001 229 | 0/18
9 h-m-p 0.0001 0.0015 45.0672 YC 955.068934 1 0.0002 251 | 0/18
10 h-m-p 0.0002 0.0028 52.3742 +YYC 954.814927 2 0.0005 275 | 0/18
11 h-m-p 0.0001 0.0005 335.7004 CYC 954.576831 2 0.0001 299 | 0/18
12 h-m-p 0.0001 0.0008 171.3582 YCCCC 954.134939 4 0.0003 327 | 0/18
13 h-m-p 0.0003 0.0028 154.6036 +YCCC 953.054652 3 0.0009 354 | 0/18
14 h-m-p 0.0006 0.0033 213.0657 CYC 952.755719 2 0.0002 378 | 0/18
15 h-m-p 0.0004 0.0081 99.8252 +CCCC 951.300277 3 0.0020 406 | 0/18
16 h-m-p 0.0019 0.0096 78.3235 CYCCCC 949.265015 5 0.0032 436 | 0/18
17 h-m-p 0.0020 0.0101 43.3464 YCC 948.924558 2 0.0013 460 | 0/18
18 h-m-p 0.2405 1.2023 0.2192 YCYCCC 944.852535 5 0.6009 489 | 0/18
19 h-m-p 0.1970 1.6244 0.6684 +YYCCC 942.785092 4 0.5969 535 | 0/18
20 h-m-p 1.1696 5.8482 0.1180 YYC 942.514183 2 0.9449 576 | 0/18
21 h-m-p 1.6000 8.0000 0.0685 YCC 942.291837 2 1.1346 618 | 0/18
22 h-m-p 0.6378 7.5094 0.1219 YCCC 942.072645 3 1.3166 662 | 0/18
23 h-m-p 1.1586 5.7931 0.1107 CCCC 941.758375 3 1.6251 707 | 0/18
24 h-m-p 1.1284 8.0000 0.1595 +YCC 941.235320 2 3.2249 750 | 0/18
25 h-m-p 0.7816 3.9081 0.4115 CYYCCC 940.587258 5 1.8165 798 | 0/18
26 h-m-p 0.0971 0.4855 1.7609 YCYCYCCC 940.359778 7 0.1754 848 | 0/18
27 h-m-p 0.1043 0.5217 1.0915 YCCCC 939.978203 4 0.2349 876 | 0/18
28 h-m-p 0.2827 1.4134 0.1278 YYYYYC 939.698213 5 0.2782 902 | 0/18
29 h-m-p 0.0731 3.4003 0.4866 +YC 939.505539 1 0.7250 943 | 0/18
30 h-m-p 1.0232 5.1162 0.0679 YCYCCCC 939.342184 6 1.5518 992 | 0/18
31 h-m-p 0.8200 6.2828 0.1285 YCCC 939.267746 3 0.4376 1036 | 0/18
32 h-m-p 1.5067 7.5336 0.0161 YYC 939.173548 2 1.3071 1077 | 0/18
33 h-m-p 0.9842 8.0000 0.0214 CCC 939.139773 2 1.3570 1120 | 0/18
34 h-m-p 1.2607 6.6011 0.0231 CCC 939.118875 2 1.7465 1163 | 0/18
35 h-m-p 1.6000 8.0000 0.0141 YYC 939.113069 2 1.3244 1204 | 0/18
36 h-m-p 1.6000 8.0000 0.0048 YC 939.112312 1 0.7516 1244 | 0/18
37 h-m-p 0.5320 8.0000 0.0068 YC 939.111415 1 1.1283 1284 | 0/18
38 h-m-p 1.6000 8.0000 0.0018 CC 939.110871 1 1.8800 1325 | 0/18
39 h-m-p 1.6000 8.0000 0.0005 C 939.110802 0 1.3147 1364 | 0/18
40 h-m-p 1.6000 8.0000 0.0002 C 939.110785 0 1.9230 1403 | 0/18
41 h-m-p 1.6000 8.0000 0.0002 C 939.110778 0 2.0297 1442 | 0/18
42 h-m-p 1.6000 8.0000 0.0001 Y 939.110777 0 1.0744 1481 | 0/18
43 h-m-p 0.9722 8.0000 0.0001 ++ 939.110768 m 8.0000 1520 | 0/18
44 h-m-p 1.5551 8.0000 0.0006 -------------C 939.110768 0 0.0000 1572
Out..
lnL = -939.110768
1573 lfun, 17303 eigenQcodon, 235950 P(t)
Time used: 2:10
Model 8: beta&w>1
TREE # 1
(1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 81
initial w for M8:NSbetaw>1 reset.
0.034919 0.016834 0.022476 0.022940 0.022908 0.029430 0.054470 0.018630 0.060868 0.146650 0.074550 0.058486 0.012536 0.013087 0.009632 2.675548 0.900000 0.424862 1.004508 2.363541
ntime & nrate & np: 15 2 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.302265
np = 20
lnL0 = -984.349857
Iterating by ming2
Initial: fx= 984.349857
x= 0.03492 0.01683 0.02248 0.02294 0.02291 0.02943 0.05447 0.01863 0.06087 0.14665 0.07455 0.05849 0.01254 0.01309 0.00963 2.67555 0.90000 0.42486 1.00451 2.36354
1 h-m-p 0.0000 0.0006 236.4691 +++ 974.689145 m 0.0006 26 | 0/20
2 h-m-p 0.0000 0.0000 5599.8591 +YCCCC 973.648655 4 0.0000 57 | 0/20
3 h-m-p 0.0000 0.0001 128.4625 ++ 972.034029 m 0.0001 80 | 1/20
4 h-m-p 0.0000 0.0005 382.6785 ++ 959.502154 m 0.0005 103 | 1/20
5 h-m-p 0.0000 0.0000 327.7859
h-m-p: 3.58584300e-20 1.79292150e-19 3.27785922e+02 959.502154
.. | 1/20
6 h-m-p 0.0000 0.0006 3465.1512 CCYYYC 956.913035 5 0.0000 153 | 1/20
7 h-m-p 0.0001 0.0005 154.2638 +CYYCC 952.029448 4 0.0004 184 | 1/20
8 h-m-p 0.0002 0.0008 142.3684 +CYYYCC 945.096386 5 0.0007 215 | 0/20
9 h-m-p 0.0000 0.0000 4974.1119 +YYCCC 941.998965 4 0.0000 245 | 0/20
10 h-m-p 0.0000 0.0000 3180.4026 CYYCCC 940.793041 5 0.0000 277 | 0/20
11 h-m-p 0.0002 0.0009 51.4833 YYCC 940.652560 3 0.0001 304 | 0/20
12 h-m-p 0.0001 0.0011 45.6464 YCCC 940.487412 3 0.0003 332 | 0/20
13 h-m-p 0.0002 0.0022 56.5591 YCCC 940.412885 3 0.0001 360 | 0/20
14 h-m-p 0.0003 0.0137 21.8346 CYC 940.356597 2 0.0004 386 | 0/20
15 h-m-p 0.0003 0.0156 27.9940 +CCCC 940.073856 3 0.0018 416 | 0/20
16 h-m-p 0.0006 0.0050 81.2362 CCCC 939.638938 3 0.0010 445 | 0/20
17 h-m-p 0.0005 0.0023 101.9838 YCYCCC 938.976935 5 0.0011 476 | 0/20
18 h-m-p 0.0002 0.0008 376.6093 YCYCCC 938.039856 5 0.0004 507 | 0/20
19 h-m-p 0.0004 0.0019 198.7657 CCCC 937.640900 3 0.0004 536 | 0/20
20 h-m-p 0.0006 0.0031 76.1958 YYC 937.456198 2 0.0005 561 | 0/20
21 h-m-p 0.0014 0.0072 8.9752 CC 937.448476 1 0.0003 586 | 0/20
22 h-m-p 0.0014 0.0516 1.8295 YC 937.446006 1 0.0008 610 | 0/20
23 h-m-p 0.0011 0.0877 1.3671 +YC 937.433948 1 0.0030 635 | 0/20
24 h-m-p 0.0005 0.0665 8.7979 +++YYCC 936.625568 3 0.0243 665 | 0/20
25 h-m-p 0.9756 8.0000 0.2194 CYCC 936.297072 3 1.3326 693 | 0/20
26 h-m-p 1.6000 8.0000 0.1594 CYC 936.117834 2 1.5501 739 | 0/20
27 h-m-p 1.6000 8.0000 0.0673 CCC 936.069349 2 1.3498 786 | 0/20
28 h-m-p 1.6000 8.0000 0.0430 CC 936.060954 1 1.4846 831 | 0/20
29 h-m-p 1.3022 8.0000 0.0491 YC 936.057417 1 0.9508 875 | 0/20
30 h-m-p 1.6000 8.0000 0.0098 CC 936.053385 1 2.2417 920 | 0/20
31 h-m-p 1.6000 8.0000 0.0072 YC 936.047221 1 2.6614 964 | 0/20
32 h-m-p 1.6000 8.0000 0.0053 CC 936.044944 1 2.3240 1009 | 0/20
33 h-m-p 1.2152 8.0000 0.0102 YC 936.044225 1 2.4390 1053 | 0/20
34 h-m-p 1.6000 8.0000 0.0071 YC 936.043243 1 3.6110 1097 | 0/20
35 h-m-p 1.6000 8.0000 0.0054 C 936.042951 0 1.4462 1140 | 0/20
36 h-m-p 1.2799 8.0000 0.0061 YC 936.042766 1 2.8763 1184 | 0/20
37 h-m-p 1.6000 8.0000 0.0080 +C 936.042160 0 6.1669 1228 | 0/20
38 h-m-p 1.6000 8.0000 0.0170 YC 936.041352 1 3.1997 1272 | 0/20
39 h-m-p 1.6000 8.0000 0.0120 YC 936.041010 1 3.3973 1316 | 0/20
40 h-m-p 1.6000 8.0000 0.0168 ++ 936.039050 m 8.0000 1359 | 0/20
41 h-m-p 0.3168 8.0000 0.4248 +YC 936.030844 1 2.6758 1404 | 0/20
42 h-m-p 1.6000 8.0000 0.5326 ++ 935.983478 m 8.0000 1447 | 0/20
43 h-m-p 1.4635 8.0000 2.9117 +YC 935.953258 1 3.6617 1492 | 0/20
44 h-m-p 1.6000 8.0000 2.4930 CCC 935.940463 2 1.8281 1519 | 0/20
45 h-m-p 1.4501 8.0000 3.1429 +CY 935.927826 1 6.1224 1545 | 0/20
46 h-m-p 1.6000 8.0000 6.7675 CC 935.921336 1 1.8812 1570 | 0/20
47 h-m-p 1.0968 5.4839 7.9777 +YC 935.916889 1 3.0262 1595 | 0/20
48 h-m-p 0.2980 1.4901 13.1582 ++ 935.913660 m 1.4901 1618 | 1/20
49 h-m-p 0.2979 8.0000 0.7703 ---------------.. | 1/20
50 h-m-p 0.0001 0.0353 0.9265 YC 935.913591 1 0.0002 1697 | 1/20
51 h-m-p 0.0003 0.0696 0.5919 YC 935.913531 1 0.0005 1740 | 1/20
52 h-m-p 0.0002 0.0440 1.4573 YC 935.913429 1 0.0004 1783 | 1/20
53 h-m-p 0.0002 0.1053 2.3269 YC 935.913363 1 0.0002 1807 | 1/20
54 h-m-p 0.0002 0.0953 1.8517 +YC 935.913202 1 0.0005 1832 | 1/20
55 h-m-p 0.0002 0.0776 4.7038 +YC 935.912724 1 0.0006 1857 | 1/20
56 h-m-p 0.0002 0.0635 13.9095 +C 935.910812 0 0.0009 1881 | 1/20
57 h-m-p 0.0004 0.0324 35.4930 +CC 935.903612 1 0.0013 1907 | 1/20
58 h-m-p 0.0003 0.0077 143.0225 CC 935.895637 1 0.0004 1932 | 1/20
59 h-m-p 0.0007 0.0139 75.4675 YC 935.889917 1 0.0005 1956 | 1/20
60 h-m-p 0.0010 0.0110 37.6848 CC 935.888190 1 0.0003 1981 | 1/20
61 h-m-p 0.0005 0.0436 21.9447 YC 935.887168 1 0.0003 2005 | 1/20
62 h-m-p 0.0008 0.0725 8.9450 CC 935.886020 1 0.0009 2030 | 1/20
63 h-m-p 0.0027 0.0840 2.8918 -YC 935.885889 1 0.0003 2055 | 1/20
64 h-m-p 0.0018 0.2585 0.5204 C 935.885864 0 0.0004 2078 | 1/20
65 h-m-p 0.0017 0.8624 0.2252 C 935.885854 0 0.0006 2120 | 1/20
66 h-m-p 0.0157 7.8690 0.0732 +YC 935.885747 1 0.0446 2164 | 1/20
67 h-m-p 0.0004 0.1477 7.7652 ++CC 935.883707 1 0.0080 2210 | 1/20
68 h-m-p 1.6000 8.0000 0.0104 C 935.883679 0 0.5104 2233 | 1/20
69 h-m-p 1.6000 8.0000 0.0010 Y 935.883677 0 0.9226 2275 | 1/20
70 h-m-p 1.6000 8.0000 0.0001 Y 935.883677 0 0.9355 2317 | 1/20
71 h-m-p 1.6000 8.0000 0.0000 C 935.883677 0 0.4000 2359
Out..
lnL = -935.883677
2360 lfun, 28320 eigenQcodon, 389400 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -956.643523 S = -926.911659 -22.208241
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 77 patterns 3:53
did 20 / 77 patterns 3:53
did 30 / 77 patterns 3:53
did 40 / 77 patterns 3:54
did 50 / 77 patterns 3:54
did 60 / 77 patterns 3:54
did 70 / 77 patterns 3:54
did 77 / 77 patterns 3:54
Time used: 3:54
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=135
D_melanogaster_nSyb-PI MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
D_sechellia_nSyb-PI MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
D_simulans_nSyb-PI MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
D_yakuba_nSyb-PI MGKKDKNKEPADAAPAGDAPPNAGAPTGEGGDGEIVGGPHNPQQIAAQKR
D_erecta_nSyb-PI MGKKDKNKEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
D_biarmipes_nSyb-PI MGKKDKNMEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
D_suzukii_nSyb-PI MGKKDKNKEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
D_eugracilis_nSyb-PI MGKKDKNKEPADAAPAGDAPPNAGAPTGEGGDGEIVGGPHNPQQIAAQKR
D_ficusphila_nSyb-PI MGKKDKNKEAADAAPAGDAPPTAGPPAGEGGDGEIVGGPHNPQQIAAQKR
D_rhopaloa_nSyb-PI MGKKDKNKESADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR
D_elegans_nSyb-PI MGKKDKNKESADAAPAGDAPPNAGAPSGEGGDGEIVGGPHNPQQIAAQKR
******* * ***********.**.*:***********************
D_melanogaster_nSyb-PI LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
D_sechellia_nSyb-PI LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
D_simulans_nSyb-PI LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
D_yakuba_nSyb-PI LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
D_erecta_nSyb-PI LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
D_biarmipes_nSyb-PI LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
D_suzukii_nSyb-PI LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
D_eugracilis_nSyb-PI LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
D_ficusphila_nSyb-PI LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
D_rhopaloa_nSyb-PI LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
D_elegans_nSyb-PI LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA
**************************************************
D_melanogaster_nSyb-PI GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
D_sechellia_nSyb-PI GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
D_simulans_nSyb-PI GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
D_yakuba_nSyb-PI GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
D_erecta_nSyb-PI GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
D_biarmipes_nSyb-PI GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
D_suzukii_nSyb-PI GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
D_eugracilis_nSyb-PI GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
D_ficusphila_nSyb-PI GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
D_rhopaloa_nSyb-PI GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
D_elegans_nSyb-PI GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
***********************************
>D_melanogaster_nSyb-PI ATGGGAAAGAAAGACAAGAACAAGGAACAGGCGGACGCTGCACCAGCTGG CGATGCACCACCCAATGCCGGAGCCCCGGCCGGAGAGGGCGGCGATGGCG AGATTGTGGGCGGACCACACAATCCGCAGCAGATCGCGGCACAGAAGCGT CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC GAACGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTGGACG ACCGTGCCGATGCCTTGCAGCAGGGTGCCTCGCAGTTTGAGCAGCAGGCG GGCAAGCTCAAGAGGAAATTCTGGCTTCAGAACTTAAAGATGATGATCAT CATGGGCGTGATTGGCCTGGTTGTCGTGGGCATTATTGCAAAGAAAGACG AAGAA >D_sechellia_nSyb-PI ATGGGCAAGAAAGACAAGAACAAGGAACAGGCGGACGCTGCACCAGCTGG CGATGCACCACCCAATGCCGGAGCCCCGGCCGGAGAGGGCGGCGATGGTG AGATTGTGGGCGGACCACACAATCCGCAGCAGATTGCGGCACAGAAGCGT CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC GAACGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTGGACG ACCGTGCCGATGCCTTGCAGCAGGGTGCCTCGCAGTTCGAGCAGCAGGCG GGCAAGCTCAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT CATGGGCGTGATTGGCCTTGTTGTCGTGGGCATTATTGCAAAGAAAGACG AAGAA >D_simulans_nSyb-PI ATGGGCAAGAAAGACAAGAACAAGGAACAGGCGGACGCTGCACCAGCTGG CGATGCACCACCCAATGCCGGAGCTCCGGCCGGAGAGGGCGGCGATGGCG AGATTGTGGGCGGACCACACAATCCGCAGCAGATTGCGGCACAGAAGCGT CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC GAACGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTGGACG ACCGTGCCGATGCCTTGCAGCAGGGTGCCTCGCAGTTCGAGCAGCAGGCG GGCAAACTCAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT CATGGGCGTGATTGGCCTTGTTGTCGTGGGCATTATTGCAAAGAAAGACG AAGAA >D_yakuba_nSyb-PI ATGGGCAAGAAAGACAAGAACAAGGAACCGGCGGACGCTGCACCAGCTGG CGATGCACCACCAAACGCCGGAGCCCCGACCGGAGAGGGCGGCGATGGCG AGATTGTGGGCGGACCACACAATCCGCAGCAGATTGCGGCACAGAAGCGT CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC GAACGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTGGACG ACCGTGCCGATGCACTGCAGCAGGGCGCCTCGCAGTTCGAGCAGCAGGCG GGCAAGCTCAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT CATGGGCGTGATTGGTCTGGTTGTCGTGGGCATTATTGCAAAGAAAGACG AAGAA >D_erecta_nSyb-PI ATGGGCAAGAAAGACAAGAACAAGGAACCGGCGGACGCTGCACCAGCTGG CGATGCACCACCAAACGCCGGAGCCCCGGCCGGAGAGGGCGGCGATGGCG AGATTGTGGGCGGACCACACAACCCGCAGCAGATTGCGGCACAGAAGCGT CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC GAACGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTGGACG ACCGCGCCGATGCCTTGCAGCAGGGCGCCTCGCAGTTCGAGCAGCAGGCG GGCAAGCTCAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT CATGGGCGTGATTGGTCTGGTAGTCGTGGGCATTATTGCAAAGAAAGACG AAGAA >D_biarmipes_nSyb-PI ATGGGCAAGAAAGACAAAAACATGGAACCGGCGGACGCTGCACCAGCTGG CGATGCACCACCAAATGCCGGAGCTCCGGCCGGAGAGGGCGGCGATGGCG AGATTGTGGGCGGACCACACAATCCGCAGCAGATTGCGGCACAGAAGCGT CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC GAATGTGGAGAAGGTGCTGGAGCGTGACAGCAAGTTGTCGGAGCTGGACG ATCGTGCCGATGCCTTACAGCAGGGTGCCTCGCAGTTTGAGCAACAGGCG GGCAAGCTTAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT CATGGGCGTGATTGGCCTGGTTGTCGTGGGCATTATTGCAAAGAAAGACG AAGAA >D_suzukii_nSyb-PI ATGGGCAAGAAAGACAAGAACAAGGAACCGGCGGACGCTGCACCAGCTGG TGATGCACCACCAAATGCCGGAGCTCCGGCCGGAGAGGGCGGCGATGGCG AGATTGTGGGCGGACCACACAATCCGCAGCAGATTGCGGCACAGAAGCGT CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC GAATGTGGAGAAGGTGCTGGAGCGTGACAGCAAGCTGTCGGAGCTGGACG ATCGTGCCGATGCCTTGCAGCAGGGTGCCTCGCAGTTTGAGCAGCAGGCG GGCAAGCTTAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT CATGGGCGTGATTGGCCTGGTTGTCGTGGGCATTATTGCAAAGAAAGACG AAGAA >D_eugracilis_nSyb-PI ATGGGCAAGAAAGACAAGAACAAGGAACCGGCGGACGCTGCACCAGCTGG CGATGCACCACCAAATGCCGGAGCTCCGACCGGAGAGGGCGGCGATGGCG AGATTGTGGGCGGACCACACAACCCGCAGCAGATTGCCGCACAGAAGCGT CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC GAATGTGGAGAAGGTGCTGGAGCGCGACAGCAAGCTGTCGGAGCTGGACG ATCGTGCCGATGCATTGCAGCAGGGTGCCTCGCAGTTTGAGCAGCAAGCG GGCAAGCTTAAGAGGAAATTCTGGCTGCAGAACTTGAAGATGATGATTAT CATGGGCGTGATTGGCCTGGTTGTCGTGGGCATCATTGCAAAGAAAGACG AAGAA >D_ficusphila_nSyb-PI ATGGGCAAGAAAGACAAGAACAAGGAAGCGGCGGACGCTGCACCAGCTGG AGATGCACCACCAACTGCCGGCCCTCCGGCCGGAGAGGGCGGCGATGGCG AGATTGTGGGCGGACCACACAACCCGCAGCAGATTGCGGCACAAAAACGT CTGCAGCAAACTCAGGCGCAGGTCGATGAGGTCGTAGACATCATGCGCAC GAATGTGGAAAAGGTGCTGGAGCGTGACAGCAAGCTGTCGGAGCTGGACG ATCGTGCAGATGCCTTGCAGCAGGGCGCCTCGCAGTTTGAGCAGCAGGCG GGCAAGTTAAAGAGGAAATTCTGGCTCCAGAACTTAAAGATGATGATCAT CATGGGCGTGATTGGCCTGGTTGTCGTGGGCATTATCGCAAAGAAAGACG AAGAA >D_rhopaloa_nSyb-PI ATGGGCAAGAAAGACAAGAACAAGGAATCGGCGGACGCTGCACCAGCTGG CGATGCACCACCAAATGCCGGAGCTCCGGCCGGAGAGGGCGGTGATGGCG AGATTGTGGGCGGACCGCACAATCCGCAGCAGATTGCGGCACAGAAGCGT CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC GAACGTGGAGAAGGTGCTGGAACGCGACAGCAAGCTGTCGGAGCTGGACG ATCGTGCTGATGCCTTGCAGCAGGGCGCCTCGCAGTTTGAGCAGCAAGCG GGCAAGCTTAAGAGGAAATTCTGGCTCCAGAACTTGAAGATGATGATCAT CATGGGCGTTATTGGCCTGGTTGTCGTTGGCATCATTGCAAAGAAAGACG AAGAA >D_elegans_nSyb-PI ATGGGCAAGAAAGACAAGAACAAGGAATCGGCGGACGCTGCACCAGCTGG CGATGCACCACCAAACGCCGGAGCTCCGTCCGGAGAGGGCGGCGATGGCG AGATTGTGGGCGGACCACACAATCCGCAGCAGATTGCGGCACAGAAGCGT CTGCAGCAGACGCAGGCGCAGGTCGATGAGGTCGTGGACATCATGCGCAC GAACGTGGAGAAGGTGCTGGAGCGCGACAGTAAGCTGTCGGAGCTGGACG ATCGCGCTGATGCCTTGCAGCAGGGCGCCTCGCAGTTTGAGCAGCAGGCG GGAAAGCTAAAGAGGAAATTCTGGCTGCAGAACTTGAAGATGATGATCAT CATGGGCGTGATTGGCCTGGTTGTCGTGGGCATTATTGCAAAGAAAGACG AAGAA
>D_melanogaster_nSyb-PI MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE >D_sechellia_nSyb-PI MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE >D_simulans_nSyb-PI MGKKDKNKEQADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE >D_yakuba_nSyb-PI MGKKDKNKEPADAAPAGDAPPNAGAPTGEGGDGEIVGGPHNPQQIAAQKR LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE >D_erecta_nSyb-PI MGKKDKNKEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE >D_biarmipes_nSyb-PI MGKKDKNMEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE >D_suzukii_nSyb-PI MGKKDKNKEPADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE >D_eugracilis_nSyb-PI MGKKDKNKEPADAAPAGDAPPNAGAPTGEGGDGEIVGGPHNPQQIAAQKR LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE >D_ficusphila_nSyb-PI MGKKDKNKEAADAAPAGDAPPTAGPPAGEGGDGEIVGGPHNPQQIAAQKR LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE >D_rhopaloa_nSyb-PI MGKKDKNKESADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKR LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE >D_elegans_nSyb-PI MGKKDKNKESADAAPAGDAPPNAGAPSGEGGDGEIVGGPHNPQQIAAQKR LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA GKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKKDEE
#NEXUS
[ID: 0169864148]
begin taxa;
dimensions ntax=11;
taxlabels
D_melanogaster_nSyb-PI
D_sechellia_nSyb-PI
D_simulans_nSyb-PI
D_yakuba_nSyb-PI
D_erecta_nSyb-PI
D_biarmipes_nSyb-PI
D_suzukii_nSyb-PI
D_eugracilis_nSyb-PI
D_ficusphila_nSyb-PI
D_rhopaloa_nSyb-PI
D_elegans_nSyb-PI
;
end;
begin trees;
translate
1 D_melanogaster_nSyb-PI,
2 D_sechellia_nSyb-PI,
3 D_simulans_nSyb-PI,
4 D_yakuba_nSyb-PI,
5 D_erecta_nSyb-PI,
6 D_biarmipes_nSyb-PI,
7 D_suzukii_nSyb-PI,
8 D_eugracilis_nSyb-PI,
9 D_ficusphila_nSyb-PI,
10 D_rhopaloa_nSyb-PI,
11 D_elegans_nSyb-PI
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.03206568,((4:0.0247034,5:0.02427591)0.897:0.02531403,(6:0.0338934,7:0.007483411,8:0.05685834,9:0.1626899,10:0.06218491,11:0.06505359)0.729:0.02727808)0.973:0.02381695,(2:0.009774342,3:0.01380927)0.942:0.01389252);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.03206568,((4:0.0247034,5:0.02427591):0.02531403,(6:0.0338934,7:0.007483411,8:0.05685834,9:0.1626899,10:0.06218491,11:0.06505359):0.02727808):0.02381695,(2:0.009774342,3:0.01380927):0.01389252);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -969.39 -987.45
2 -969.03 -988.25
--------------------------------------
TOTAL -969.19 -987.93
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/330/nSyb-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.695592 0.023976 0.425104 1.001214 0.678674 1196.33 1270.14 1.003
r(A<->C){all} 0.097825 0.001858 0.021265 0.179078 0.092203 525.29 551.58 1.000
r(A<->G){all} 0.085291 0.001196 0.025600 0.155678 0.079259 463.45 631.47 1.000
r(A<->T){all} 0.067149 0.001678 0.002127 0.144203 0.059835 482.75 543.21 1.001
r(C<->G){all} 0.013185 0.000105 0.000015 0.033233 0.010930 1011.43 1073.58 1.004
r(C<->T){all} 0.695144 0.006196 0.540112 0.835992 0.699291 428.59 582.66 1.001
r(G<->T){all} 0.041406 0.000447 0.007015 0.084773 0.038550 765.14 849.37 1.000
pi(A){all} 0.262543 0.000485 0.214116 0.300988 0.261924 1083.16 1096.83 1.001
pi(C){all} 0.248842 0.000410 0.211620 0.291137 0.247969 847.74 1069.80 1.001
pi(G){all} 0.334985 0.000544 0.292332 0.382182 0.334261 1294.93 1383.26 1.001
pi(T){all} 0.153630 0.000282 0.122186 0.188062 0.153169 1077.46 1160.27 1.002
alpha{1,2} 0.099275 0.000701 0.053755 0.156543 0.097082 1175.86 1233.26 1.000
alpha{3} 1.950980 0.541881 0.771828 3.443655 1.826272 1444.66 1448.48 1.000
pinvar{all} 0.537197 0.004690 0.396338 0.666097 0.541929 1338.10 1364.28 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/330/nSyb-PI/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 11 ls = 135
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 0 0 0 0 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 1 2 2 2 2 1 | TCC 0 0 0 0 0 0 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 1 0 0 0 0 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 2 2 1 2 2 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 0 0 1 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 2 2 2 2 1 3
CTC 1 2 2 2 2 1 | CCC 1 1 1 0 0 0 | CAC 1 1 1 1 1 1 | CGC 2 2 2 2 3 1
CTA 0 0 0 0 0 0 | CCA 3 3 3 4 4 4 | Gln CAA 0 0 0 0 0 1 | CGA 0 0 0 0 0 0
CTG 5 4 4 6 5 4 | CCG 2 2 2 3 3 3 | CAG 14 14 14 13 13 12 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 5 5 5 5 5 | Thr ACT 0 0 0 0 0 0 | Asn AAT 2 2 2 1 0 3 | Ser AGT 0 0 0 0 0 0
ATC 4 3 3 3 3 3 | ACC 0 0 0 1 0 0 | AAC 3 3 3 4 5 2 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 4 3 3 4 | Arg AGA 0 0 0 0 0 0
Met ATG 5 5 5 5 5 6 | ACG 2 2 2 2 2 2 | AAG 10 10 9 10 10 8 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 0 1 | Ala GCT 2 2 3 2 2 3 | Asp GAT 4 4 4 4 4 5 | Gly GGT 1 2 1 1 1 1
GTC 3 3 3 3 3 3 | GCC 6 6 5 4 6 5 | GAC 7 7 7 7 7 6 | GGC 9 9 10 10 10 10
GTA 0 0 0 0 1 0 | GCA 4 4 4 5 4 4 | Glu GAA 3 3 3 3 3 3 | GGA 4 3 3 3 3 3
GTG 6 6 6 6 6 6 | GCG 4 4 4 4 4 4 | GAG 7 7 7 7 7 7 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 | Ser TCT 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 | Cys TGT 0 0 0 0 0
TTC 1 1 1 1 1 | TCC 0 0 0 0 1 | TAC 0 0 0 0 0 | TGC 0 0 0 0 0
Leu TTA 0 0 2 0 0 | TCA 0 0 0 0 0 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 2 2 1 2 2 | TCG 2 2 2 3 3 | TAG 0 0 0 0 0 | Trp TGG 1 1 1 1 1
----------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 0 1 0 | Pro CCT 0 0 1 0 0 | His CAT 0 0 0 0 0 | Arg CGT 3 2 3 2 1
CTC 1 0 1 1 0 | CCC 0 0 0 0 0 | CAC 1 1 1 1 1 | CGC 1 2 1 2 3
CTA 0 0 0 0 1 | CCA 4 4 4 3 4 | Gln CAA 0 1 2 1 0 | CGA 0 0 0 0 0
CTG 5 6 5 5 6 | CCG 3 3 2 3 2 | CAG 13 12 11 12 13 | CGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 4 4 5 | Thr ACT 0 0 2 0 0 | Asn AAT 3 2 1 2 1 | Ser AGT 0 0 0 0 1
ATC 3 3 4 4 3 | ACC 0 1 0 0 0 | AAC 2 3 3 3 4 | AGC 1 1 1 1 0
ATA 0 0 0 0 0 | ACA 0 0 0 0 0 | Lys AAA 3 3 4 3 3 | Arg AGA 0 0 0 0 0
Met ATG 5 5 5 5 5 | ACG 2 2 1 2 2 | AAG 10 10 9 10 10 | AGG 1 1 1 1 1
----------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 3 1 | Ala GCT 3 3 2 4 4 | Asp GAT 5 5 5 5 5 | Gly GGT 2 1 0 1 0
GTC 3 3 3 3 3 | GCC 5 4 4 4 3 | GAC 6 6 6 6 6 | GGC 9 10 11 10 10
GTA 0 0 1 0 0 | GCA 4 5 5 4 4 | Glu GAA 3 3 4 4 3 | GGA 3 3 3 3 4
GTG 6 6 5 4 6 | GCG 4 3 5 4 4 | GAG 7 7 6 6 7 | GGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_nSyb-PI
position 1: T:0.05185 C:0.23704 A:0.25926 G:0.45185
position 2: T:0.25185 C:0.19259 A:0.40000 G:0.15556
position 3: T:0.13333 C:0.28889 A:0.13333 G:0.44444
Average T:0.14568 C:0.23951 A:0.26420 G:0.35062
#2: D_sechellia_nSyb-PI
position 1: T:0.05185 C:0.23704 A:0.25926 G:0.45185
position 2: T:0.25185 C:0.19259 A:0.40000 G:0.15556
position 3: T:0.14074 C:0.29630 A:0.11852 G:0.44444
Average T:0.14815 C:0.24198 A:0.25926 G:0.35062
#3: D_simulans_nSyb-PI
position 1: T:0.05185 C:0.23704 A:0.25926 G:0.45185
position 2: T:0.25185 C:0.19259 A:0.40000 G:0.15556
position 3: T:0.14074 C:0.29630 A:0.12593 G:0.43704
Average T:0.14815 C:0.24198 A:0.26173 G:0.34815
#4: D_yakuba_nSyb-PI
position 1: T:0.04444 C:0.24444 A:0.26667 G:0.44444
position 2: T:0.25185 C:0.20000 A:0.39259 G:0.15556
position 3: T:0.11852 C:0.29630 A:0.13333 G:0.45185
Average T:0.13827 C:0.24691 A:0.26420 G:0.35062
#5: D_erecta_nSyb-PI
position 1: T:0.05185 C:0.23704 A:0.25926 G:0.45185
position 2: T:0.25185 C:0.20000 A:0.39259 G:0.15556
position 3: T:0.09630 C:0.31852 A:0.13333 G:0.45185
Average T:0.13333 C:0.25185 A:0.26173 G:0.35309
#6: D_biarmipes_nSyb-PI
position 1: T:0.05926 C:0.22963 A:0.25926 G:0.45185
position 2: T:0.25926 C:0.20000 A:0.38519 G:0.15556
position 3: T:0.17037 C:0.25185 A:0.14815 G:0.42963
Average T:0.16296 C:0.22716 A:0.26420 G:0.34568
#7: D_suzukii_nSyb-PI
position 1: T:0.05185 C:0.23704 A:0.25926 G:0.45185
position 2: T:0.25185 C:0.20000 A:0.39259 G:0.15556
position 3: T:0.17778 C:0.24444 A:0.12593 G:0.45185
Average T:0.16049 C:0.22716 A:0.25926 G:0.35309
#8: D_eugracilis_nSyb-PI
position 1: T:0.05185 C:0.23704 A:0.26667 G:0.44444
position 2: T:0.25185 C:0.20000 A:0.39259 G:0.15556
position 3: T:0.15556 C:0.25926 A:0.14074 G:0.44444
Average T:0.15309 C:0.23210 A:0.26667 G:0.34815
#9: D_ficusphila_nSyb-PI
position 1: T:0.05926 C:0.22963 A:0.25926 G:0.45185
position 2: T:0.25185 C:0.20741 A:0.38519 G:0.15556
position 3: T:0.14815 C:0.26667 A:0.18519 G:0.40000
Average T:0.15309 C:0.23457 A:0.27654 G:0.33580
#10: D_rhopaloa_nSyb-PI
position 1: T:0.05926 C:0.22963 A:0.25926 G:0.45185
position 2: T:0.25185 C:0.20000 A:0.39259 G:0.15556
position 3: T:0.17037 C:0.26667 A:0.13333 G:0.42963
Average T:0.16049 C:0.23210 A:0.26173 G:0.34568
#11: D_elegans_nSyb-PI
position 1: T:0.06667 C:0.22963 A:0.25926 G:0.44444
position 2: T:0.25185 C:0.20000 A:0.39259 G:0.15556
position 3: T:0.14074 C:0.25926 A:0.14074 G:0.45926
Average T:0.15309 C:0.22963 A:0.26420 G:0.35309
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 7 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 15 | TCC 1 | TAC 0 | TGC 0
Leu L TTA 4 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 19 | TCG 24 | TAG 0 | Trp W TGG 11
------------------------------------------------------------------------------
Leu L CTT 7 | Pro P CCT 1 | His H CAT 0 | Arg R CGT 23
CTC 13 | CCC 3 | CAC 11 | CGC 21
CTA 1 | CCA 40 | Gln Q CAA 5 | CGA 0
CTG 55 | CCG 28 | CAG 141 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 52 | Thr T ACT 2 | Asn N AAT 19 | Ser S AGT 1
ATC 36 | ACC 2 | AAC 35 | AGC 10
ATA 0 | ACA 0 | Lys K AAA 36 | Arg R AGA 0
Met M ATG 56 | ACG 21 | AAG 106 | AGG 11
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 30 | Asp D GAT 50 | Gly G GGT 11
GTC 33 | GCC 52 | GAC 71 | GGC 108
GTA 2 | GCA 47 | Glu E GAA 35 | GGA 35
GTG 63 | GCG 44 | GAG 75 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.05455 C:0.23502 A:0.26061 G:0.44983
position 2: T:0.25253 C:0.19865 A:0.39327 G:0.15556
position 3: T:0.14478 C:0.27677 A:0.13805 G:0.44040
Average T:0.15062 C:0.23681 A:0.26397 G:0.34860
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_nSyb-PI
D_sechellia_nSyb-PI -1.0000 (0.0000 0.0799)
D_simulans_nSyb-PI -1.0000 (0.0000 0.0920)-1.0000 (0.0000 0.0333)
D_yakuba_nSyb-PI 0.0502 (0.0064 0.1284) 0.0704 (0.0064 0.0914) 0.0621 (0.0064 0.1037)
D_erecta_nSyb-PI 0.0226 (0.0032 0.1418) 0.0308 (0.0032 0.1040) 0.0275 (0.0032 0.1166) 0.0579 (0.0032 0.0555)
D_biarmipes_nSyb-PI 0.0380 (0.0064 0.1692) 0.0411 (0.0064 0.1563) 0.0449 (0.0064 0.1430) 0.0354 (0.0064 0.1817) 0.0163 (0.0032 0.1963)
D_suzukii_nSyb-PI 0.0249 (0.0032 0.1289) 0.0275 (0.0032 0.1166) 0.0308 (0.0032 0.1040) 0.0228 (0.0032 0.1409)-1.0000 (0.0000 0.1545) 0.0573 (0.0032 0.0560)
D_eugracilis_nSyb-PI 0.0355 (0.0064 0.1815) 0.0353 (0.0064 0.1820) 0.0382 (0.0064 0.1684)-1.0000 (0.0000 0.1803) 0.0165 (0.0032 0.1947) 0.0453 (0.0064 0.1419) 0.0311 (0.0032 0.1033)
D_ficusphila_nSyb-PI 0.0605 (0.0162 0.2680) 0.0569 (0.0162 0.2845) 0.0602 (0.0162 0.2689) 0.0577 (0.0162 0.2816) 0.0485 (0.0129 0.2672) 0.0723 (0.0162 0.2241) 0.0774 (0.0129 0.1672) 0.0645 (0.0162 0.2516)
D_rhopaloa_nSyb-PI 0.0307 (0.0064 0.2097) 0.0328 (0.0064 0.1962) 0.0353 (0.0064 0.1823) 0.0332 (0.0064 0.1943) 0.0154 (0.0032 0.2091) 0.0353 (0.0064 0.1823) 0.0227 (0.0032 0.1413) 0.0418 (0.0064 0.1541) 0.0458 (0.0130 0.2825)
D_elegans_nSyb-PI 0.0579 (0.0097 0.1674) 0.0576 (0.0097 0.1679) 0.0626 (0.0097 0.1546) 0.0460 (0.0065 0.1402) 0.0504 (0.0064 0.1279) 0.0576 (0.0097 0.1679) 0.0504 (0.0064 0.1279) 0.0387 (0.0065 0.1666) 0.0517 (0.0130 0.2508) 0.0209 (0.0032 0.1536)
Model 0: one-ratio
TREE # 1: (1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 81
lnL(ntime: 15 np: 17): -951.082436 +0.000000
12..1 12..13 13..14 14..4 14..5 13..15 15..6 15..7 15..8 15..9 15..10 15..11 12..16 16..2 16..3
0.037880 0.016307 0.025454 0.023898 0.023876 0.038431 0.044748 0.013615 0.065179 0.159521 0.089890 0.091702 0.009694 0.007830 0.015208 2.702903 0.038136
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.66323
(1: 0.037880, ((4: 0.023898, 5: 0.023876): 0.025454, (6: 0.044748, 7: 0.013615, 8: 0.065179, 9: 0.159521, 10: 0.089890, 11: 0.091702): 0.038431): 0.016307, (2: 0.007830, 3: 0.015208): 0.009694);
(D_melanogaster_nSyb-PI: 0.037880, ((D_yakuba_nSyb-PI: 0.023898, D_erecta_nSyb-PI: 0.023876): 0.025454, (D_biarmipes_nSyb-PI: 0.044748, D_suzukii_nSyb-PI: 0.013615, D_eugracilis_nSyb-PI: 0.065179, D_ficusphila_nSyb-PI: 0.159521, D_rhopaloa_nSyb-PI: 0.089890, D_elegans_nSyb-PI: 0.091702): 0.038431): 0.016307, (D_sechellia_nSyb-PI: 0.007830, D_simulans_nSyb-PI: 0.015208): 0.009694);
Detailed output identifying parameters
kappa (ts/tv) = 2.70290
omega (dN/dS) = 0.03814
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.038 312.5 92.5 0.0381 0.0019 0.0490 0.6 4.5
12..13 0.016 312.5 92.5 0.0381 0.0008 0.0211 0.3 2.0
13..14 0.025 312.5 92.5 0.0381 0.0013 0.0329 0.4 3.0
14..4 0.024 312.5 92.5 0.0381 0.0012 0.0309 0.4 2.9
14..5 0.024 312.5 92.5 0.0381 0.0012 0.0309 0.4 2.9
13..15 0.038 312.5 92.5 0.0381 0.0019 0.0497 0.6 4.6
15..6 0.045 312.5 92.5 0.0381 0.0022 0.0579 0.7 5.4
15..7 0.014 312.5 92.5 0.0381 0.0007 0.0176 0.2 1.6
15..8 0.065 312.5 92.5 0.0381 0.0032 0.0843 1.0 7.8
15..9 0.160 312.5 92.5 0.0381 0.0079 0.2063 2.5 19.1
15..10 0.090 312.5 92.5 0.0381 0.0044 0.1163 1.4 10.7
15..11 0.092 312.5 92.5 0.0381 0.0045 0.1186 1.4 11.0
12..16 0.010 312.5 92.5 0.0381 0.0005 0.0125 0.1 1.2
16..2 0.008 312.5 92.5 0.0381 0.0004 0.0101 0.1 0.9
16..3 0.015 312.5 92.5 0.0381 0.0008 0.0197 0.2 1.8
tree length for dN: 0.0327
tree length for dS: 0.8578
Time used: 0:09
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 81
lnL(ntime: 15 np: 18): -936.690939 +0.000000
12..1 12..13 13..14 14..4 14..5 13..15 15..6 15..7 15..8 15..9 15..10 15..11 12..16 16..2 16..3
0.038397 0.016366 0.026150 0.023996 0.024300 0.039298 0.045654 0.013827 0.066831 0.165176 0.092474 0.095280 0.009897 0.007909 0.015369 2.625147 0.969852 0.006376
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.68092
(1: 0.038397, ((4: 0.023996, 5: 0.024300): 0.026150, (6: 0.045654, 7: 0.013827, 8: 0.066831, 9: 0.165176, 10: 0.092474, 11: 0.095280): 0.039298): 0.016366, (2: 0.007909, 3: 0.015369): 0.009897);
(D_melanogaster_nSyb-PI: 0.038397, ((D_yakuba_nSyb-PI: 0.023996, D_erecta_nSyb-PI: 0.024300): 0.026150, (D_biarmipes_nSyb-PI: 0.045654, D_suzukii_nSyb-PI: 0.013827, D_eugracilis_nSyb-PI: 0.066831, D_ficusphila_nSyb-PI: 0.165176, D_rhopaloa_nSyb-PI: 0.092474, D_elegans_nSyb-PI: 0.095280): 0.039298): 0.016366, (D_sechellia_nSyb-PI: 0.007909, D_simulans_nSyb-PI: 0.015369): 0.009897);
Detailed output identifying parameters
kappa (ts/tv) = 2.62515
dN/dS (w) for site classes (K=2)
p: 0.96985 0.03015
w: 0.00638 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.038 313.0 92.0 0.0363 0.0018 0.0501 0.6 4.6
12..13 0.016 313.0 92.0 0.0363 0.0008 0.0214 0.2 2.0
13..14 0.026 313.0 92.0 0.0363 0.0012 0.0341 0.4 3.1
14..4 0.024 313.0 92.0 0.0363 0.0011 0.0313 0.4 2.9
14..5 0.024 313.0 92.0 0.0363 0.0012 0.0317 0.4 2.9
13..15 0.039 313.0 92.0 0.0363 0.0019 0.0513 0.6 4.7
15..6 0.046 313.0 92.0 0.0363 0.0022 0.0596 0.7 5.5
15..7 0.014 313.0 92.0 0.0363 0.0007 0.0181 0.2 1.7
15..8 0.067 313.0 92.0 0.0363 0.0032 0.0873 1.0 8.0
15..9 0.165 313.0 92.0 0.0363 0.0078 0.2157 2.5 19.8
15..10 0.092 313.0 92.0 0.0363 0.0044 0.1207 1.4 11.1
15..11 0.095 313.0 92.0 0.0363 0.0045 0.1244 1.4 11.4
12..16 0.010 313.0 92.0 0.0363 0.0005 0.0129 0.1 1.2
16..2 0.008 313.0 92.0 0.0363 0.0004 0.0103 0.1 1.0
16..3 0.015 313.0 92.0 0.0363 0.0007 0.0201 0.2 1.8
Time used: 0:20
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 81
lnL(ntime: 15 np: 20): -935.866460 +0.000000
12..1 12..13 13..14 14..4 14..5 13..15 15..6 15..7 15..8 15..9 15..10 15..11 12..16 16..2 16..3
0.038499 0.016234 0.026675 0.023962 0.024637 0.039635 0.045905 0.013926 0.067315 0.167088 0.093359 0.097026 0.010049 0.007907 0.015380 2.733658 0.979758 0.000000 0.009448 2.026445
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.68760
(1: 0.038499, ((4: 0.023962, 5: 0.024637): 0.026675, (6: 0.045905, 7: 0.013926, 8: 0.067315, 9: 0.167088, 10: 0.093359, 11: 0.097026): 0.039635): 0.016234, (2: 0.007907, 3: 0.015380): 0.010049);
(D_melanogaster_nSyb-PI: 0.038499, ((D_yakuba_nSyb-PI: 0.023962, D_erecta_nSyb-PI: 0.024637): 0.026675, (D_biarmipes_nSyb-PI: 0.045905, D_suzukii_nSyb-PI: 0.013926, D_eugracilis_nSyb-PI: 0.067315, D_ficusphila_nSyb-PI: 0.167088, D_rhopaloa_nSyb-PI: 0.093359, D_elegans_nSyb-PI: 0.097026): 0.039635): 0.016234, (D_sechellia_nSyb-PI: 0.007907, D_simulans_nSyb-PI: 0.015380): 0.010049);
Detailed output identifying parameters
kappa (ts/tv) = 2.73366
dN/dS (w) for site classes (K=3)
p: 0.97976 0.00000 0.02024
w: 0.00945 1.00000 2.02645
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.038 312.4 92.6 0.0503 0.0024 0.0480 0.8 4.4
12..13 0.016 312.4 92.6 0.0503 0.0010 0.0202 0.3 1.9
13..14 0.027 312.4 92.6 0.0503 0.0017 0.0332 0.5 3.1
14..4 0.024 312.4 92.6 0.0503 0.0015 0.0299 0.5 2.8
14..5 0.025 312.4 92.6 0.0503 0.0015 0.0307 0.5 2.8
13..15 0.040 312.4 92.6 0.0503 0.0025 0.0494 0.8 4.6
15..6 0.046 312.4 92.6 0.0503 0.0029 0.0572 0.9 5.3
15..7 0.014 312.4 92.6 0.0503 0.0009 0.0174 0.3 1.6
15..8 0.067 312.4 92.6 0.0503 0.0042 0.0839 1.3 7.8
15..9 0.167 312.4 92.6 0.0503 0.0105 0.2082 3.3 19.3
15..10 0.093 312.4 92.6 0.0503 0.0058 0.1163 1.8 10.8
15..11 0.097 312.4 92.6 0.0503 0.0061 0.1209 1.9 11.2
12..16 0.010 312.4 92.6 0.0503 0.0006 0.0125 0.2 1.2
16..2 0.008 312.4 92.6 0.0503 0.0005 0.0099 0.2 0.9
16..3 0.015 312.4 92.6 0.0503 0.0010 0.0192 0.3 1.8
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_nSyb-PI)
Pr(w>1) post mean +- SE for w
10 Q 1.000** 2.026
27 A 1.000** 2.026
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_nSyb-PI)
Pr(w>1) post mean +- SE for w
10 Q 0.701 2.437 +- 1.591
27 A 0.514 1.892 +- 1.273
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.272 0.276 0.180 0.101 0.057 0.036 0.025 0.020 0.017 0.016
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.998
sum of density on p0-p1 = 1.000000
Time used: 0:48
Model 3: discrete (3 categories)
TREE # 1: (1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 81
lnL(ntime: 15 np: 21): -935.866460 +0.000000
12..1 12..13 13..14 14..4 14..5 13..15 15..6 15..7 15..8 15..9 15..10 15..11 12..16 16..2 16..3
0.038499 0.016234 0.026675 0.023962 0.024637 0.039635 0.045905 0.013926 0.067315 0.167088 0.093359 0.097026 0.010049 0.007907 0.015380 2.733659 0.122825 0.856933 0.009445 0.009448 2.026448
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.68760
(1: 0.038499, ((4: 0.023962, 5: 0.024637): 0.026675, (6: 0.045905, 7: 0.013926, 8: 0.067315, 9: 0.167088, 10: 0.093359, 11: 0.097026): 0.039635): 0.016234, (2: 0.007907, 3: 0.015380): 0.010049);
(D_melanogaster_nSyb-PI: 0.038499, ((D_yakuba_nSyb-PI: 0.023962, D_erecta_nSyb-PI: 0.024637): 0.026675, (D_biarmipes_nSyb-PI: 0.045905, D_suzukii_nSyb-PI: 0.013926, D_eugracilis_nSyb-PI: 0.067315, D_ficusphila_nSyb-PI: 0.167088, D_rhopaloa_nSyb-PI: 0.093359, D_elegans_nSyb-PI: 0.097026): 0.039635): 0.016234, (D_sechellia_nSyb-PI: 0.007907, D_simulans_nSyb-PI: 0.015380): 0.010049);
Detailed output identifying parameters
kappa (ts/tv) = 2.73366
dN/dS (w) for site classes (K=3)
p: 0.12283 0.85693 0.02024
w: 0.00944 0.00945 2.02645
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.038 312.4 92.6 0.0503 0.0024 0.0480 0.8 4.4
12..13 0.016 312.4 92.6 0.0503 0.0010 0.0202 0.3 1.9
13..14 0.027 312.4 92.6 0.0503 0.0017 0.0332 0.5 3.1
14..4 0.024 312.4 92.6 0.0503 0.0015 0.0299 0.5 2.8
14..5 0.025 312.4 92.6 0.0503 0.0015 0.0307 0.5 2.8
13..15 0.040 312.4 92.6 0.0503 0.0025 0.0494 0.8 4.6
15..6 0.046 312.4 92.6 0.0503 0.0029 0.0572 0.9 5.3
15..7 0.014 312.4 92.6 0.0503 0.0009 0.0174 0.3 1.6
15..8 0.067 312.4 92.6 0.0503 0.0042 0.0839 1.3 7.8
15..9 0.167 312.4 92.6 0.0503 0.0105 0.2082 3.3 19.3
15..10 0.093 312.4 92.6 0.0503 0.0058 0.1163 1.8 10.8
15..11 0.097 312.4 92.6 0.0503 0.0061 0.1209 1.9 11.2
12..16 0.010 312.4 92.6 0.0503 0.0006 0.0125 0.2 1.2
16..2 0.008 312.4 92.6 0.0503 0.0005 0.0099 0.2 0.9
16..3 0.015 312.4 92.6 0.0503 0.0010 0.0192 0.3 1.8
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_nSyb-PI)
Pr(w>1) post mean +- SE for w
10 Q 1.000** 2.026
27 A 1.000** 2.026
Time used: 1:09
Model 7: beta (10 categories)
TREE # 1: (1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 81
lnL(ntime: 15 np: 18): -939.110768 +0.000000
12..1 12..13 13..14 14..4 14..5 13..15 15..6 15..7 15..8 15..9 15..10 15..11 12..16 16..2 16..3
0.040240 0.017222 0.027229 0.025171 0.025348 0.041080 0.048131 0.014565 0.069907 0.172767 0.096613 0.098996 0.010361 0.008304 0.016160 2.675548 0.009988 0.170953
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.71209
(1: 0.040240, ((4: 0.025171, 5: 0.025348): 0.027229, (6: 0.048131, 7: 0.014565, 8: 0.069907, 9: 0.172767, 10: 0.096613, 11: 0.098996): 0.041080): 0.017222, (2: 0.008304, 3: 0.016160): 0.010361);
(D_melanogaster_nSyb-PI: 0.040240, ((D_yakuba_nSyb-PI: 0.025171, D_erecta_nSyb-PI: 0.025348): 0.027229, (D_biarmipes_nSyb-PI: 0.048131, D_suzukii_nSyb-PI: 0.014565, D_eugracilis_nSyb-PI: 0.069907, D_ficusphila_nSyb-PI: 0.172767, D_rhopaloa_nSyb-PI: 0.096613, D_elegans_nSyb-PI: 0.098996): 0.041080): 0.017222, (D_sechellia_nSyb-PI: 0.008304, D_simulans_nSyb-PI: 0.016160): 0.010361);
Detailed output identifying parameters
kappa (ts/tv) = 2.67555
Parameters in M7 (beta):
p = 0.00999 q = 0.17095
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 0.62572
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.040 312.7 92.3 0.0626 0.0030 0.0486 1.0 4.5
12..13 0.017 312.7 92.3 0.0626 0.0013 0.0208 0.4 1.9
13..14 0.027 312.7 92.3 0.0626 0.0021 0.0329 0.6 3.0
14..4 0.025 312.7 92.3 0.0626 0.0019 0.0304 0.6 2.8
14..5 0.025 312.7 92.3 0.0626 0.0019 0.0306 0.6 2.8
13..15 0.041 312.7 92.3 0.0626 0.0031 0.0496 1.0 4.6
15..6 0.048 312.7 92.3 0.0626 0.0036 0.0581 1.1 5.4
15..7 0.015 312.7 92.3 0.0626 0.0011 0.0176 0.3 1.6
15..8 0.070 312.7 92.3 0.0626 0.0053 0.0844 1.7 7.8
15..9 0.173 312.7 92.3 0.0626 0.0130 0.2085 4.1 19.2
15..10 0.097 312.7 92.3 0.0626 0.0073 0.1166 2.3 10.8
15..11 0.099 312.7 92.3 0.0626 0.0075 0.1195 2.3 11.0
12..16 0.010 312.7 92.3 0.0626 0.0008 0.0125 0.2 1.2
16..2 0.008 312.7 92.3 0.0626 0.0006 0.0100 0.2 0.9
16..3 0.016 312.7 92.3 0.0626 0.0012 0.0195 0.4 1.8
Time used: 2:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 81
lnL(ntime: 15 np: 20): -935.883677 +0.000000
12..1 12..13 13..14 14..4 14..5 13..15 15..6 15..7 15..8 15..9 15..10 15..11 12..16 16..2 16..3
0.038499 0.016234 0.026673 0.023959 0.024634 0.039635 0.045910 0.013927 0.067317 0.167104 0.093360 0.097022 0.010049 0.007907 0.015380 2.733686 0.979751 0.985702 99.000000 2.026027
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.68761
(1: 0.038499, ((4: 0.023959, 5: 0.024634): 0.026673, (6: 0.045910, 7: 0.013927, 8: 0.067317, 9: 0.167104, 10: 0.093360, 11: 0.097022): 0.039635): 0.016234, (2: 0.007907, 3: 0.015380): 0.010049);
(D_melanogaster_nSyb-PI: 0.038499, ((D_yakuba_nSyb-PI: 0.023959, D_erecta_nSyb-PI: 0.024634): 0.026673, (D_biarmipes_nSyb-PI: 0.045910, D_suzukii_nSyb-PI: 0.013927, D_eugracilis_nSyb-PI: 0.067317, D_ficusphila_nSyb-PI: 0.167104, D_rhopaloa_nSyb-PI: 0.093360, D_elegans_nSyb-PI: 0.097022): 0.039635): 0.016234, (D_sechellia_nSyb-PI: 0.007907, D_simulans_nSyb-PI: 0.015380): 0.010049);
Detailed output identifying parameters
kappa (ts/tv) = 2.73369
Parameters in M8 (beta&w>1):
p0 = 0.97975 p = 0.98570 q = 99.00000
(p1 = 0.02025) w = 2.02603
dN/dS (w) for site classes (K=11)
p: 0.09798 0.09798 0.09798 0.09798 0.09798 0.09798 0.09798 0.09798 0.09798 0.09798 0.02025
w: 0.00049 0.00158 0.00282 0.00424 0.00589 0.00788 0.01038 0.01371 0.01876 0.02954 2.02603
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.038 312.4 92.6 0.0504 0.0024 0.0480 0.8 4.4
12..13 0.016 312.4 92.6 0.0504 0.0010 0.0202 0.3 1.9
13..14 0.027 312.4 92.6 0.0504 0.0017 0.0332 0.5 3.1
14..4 0.024 312.4 92.6 0.0504 0.0015 0.0299 0.5 2.8
14..5 0.025 312.4 92.6 0.0504 0.0015 0.0307 0.5 2.8
13..15 0.040 312.4 92.6 0.0504 0.0025 0.0494 0.8 4.6
15..6 0.046 312.4 92.6 0.0504 0.0029 0.0572 0.9 5.3
15..7 0.014 312.4 92.6 0.0504 0.0009 0.0174 0.3 1.6
15..8 0.067 312.4 92.6 0.0504 0.0042 0.0839 1.3 7.8
15..9 0.167 312.4 92.6 0.0504 0.0105 0.2082 3.3 19.3
15..10 0.093 312.4 92.6 0.0504 0.0059 0.1163 1.8 10.8
15..11 0.097 312.4 92.6 0.0504 0.0061 0.1209 1.9 11.2
12..16 0.010 312.4 92.6 0.0504 0.0006 0.0125 0.2 1.2
16..2 0.008 312.4 92.6 0.0504 0.0005 0.0099 0.2 0.9
16..3 0.015 312.4 92.6 0.0504 0.0010 0.0192 0.3 1.8
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_nSyb-PI)
Pr(w>1) post mean +- SE for w
10 Q 1.000** 2.026
27 A 1.000** 2.025
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_nSyb-PI)
Pr(w>1) post mean +- SE for w
10 Q 0.915 2.574 +- 1.415
27 A 0.749 2.086 +- 1.335
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.002 0.012 0.046 0.126 0.280 0.534
ws: 0.345 0.318 0.178 0.082 0.037 0.018 0.009 0.006 0.004 0.003
Time used: 3:54
Model 1: NearlyNeutral -936.690939
Model 2: PositiveSelection -935.86646
Model 0: one-ratio -951.082436
Model 3: discrete -935.86646
Model 7: beta -939.110768
Model 8: beta&w>1 -935.883677
Model 0 vs 1 28.782994000000144
Model 2 vs 1 1.6489579999999933
Model 8 vs 7 6.454181999999946
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_nSyb-PI)
Pr(w>1) post mean +- SE for w
10 Q 1.000** 2.026
27 A 1.000** 2.025
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_nSyb-PI)
Pr(w>1) post mean +- SE for w
10 Q 0.915 2.574 +- 1.415
27 A 0.749 2.086 +- 1.335
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
